FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15811

FusionGeneSummary for HADH_HPGD

check button Fusion gene summary
Fusion gene informationFusion gene name: HADH_HPGD
Fusion gene ID: 15811
HgeneTgene
Gene symbol

HADH

HPGD

Gene ID

3033

3248

Gene namehydroxyacyl-CoA dehydrogenase15-hydroxyprostaglandin dehydrogenase
SynonymsHAD|HADH1|HADHSC|HCDH|HHF4|MSCHAD|SCHAD15-PGDH|PGDH|PGDH1|PHOAR1|SDR36C1
Cytomap

4q25

4q34.1

Type of geneprotein-codingprotein-coding
Descriptionhydroxyacyl-coenzyme A dehydrogenase, mitochondrialL-3-hydroxyacyl-Coenzyme A dehydrogenase, short chainmedium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenaseshort-chain 3-hydroxyacyl-CoA dehydrogenasetestis secretory sperm-binding protein Li15-hydroxyprostaglandin dehydrogenase [NAD(+)]15-hydroxyprostaglandin dehydrogenase (NAD(+))NAD+-dependent 15-hydroxyprostaglandin dehydrogenasehydroxyprostaglandin dehydrogenase 15-(NAD)prostaglandin dehydrogenase 1short chain dehydrogenase/reductas
Modification date2018051920180524
UniProtAcc

Q16836

P15428

Ensembl transtripts involved in fusion geneENST00000603302, ENST00000403312, 
ENST00000309522, ENST00000505878, 
ENST00000454409, ENST00000510728, 
ENST00000296522, ENST00000296521, 
ENST00000510901, ENST00000422112, 
ENST00000541923, ENST00000542498, 
ENST00000504433, 
Fusion gene scores* DoF score6 X 5 X 3=903 X 3 X 2=18
# samples 73
** MAII scorelog2(7/90*10)=-0.362570079384708
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: HADH [Title/Abstract] AND HPGD [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneHPGD

GO:0006693

prostaglandin metabolic process

16828555

TgeneHPGD

GO:0007179

transforming growth factor beta receptor signaling pathway

15574495

TgeneHPGD

GO:0007565

female pregnancy

15531523

TgeneHPGD

GO:0007567

parturition

15531523

TgeneHPGD

GO:0045786

negative regulation of cell cycle

15574495


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCECTCGA-AJ-A3NF-01AHADHchr4

108911220

+HPGDchr4

175429943

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000603302ENST00000296522HADHchr4

108911220

+HPGDchr4

175429943

-
In-frameENST00000603302ENST00000296521HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-5UTRENST00000603302ENST00000510901HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-intronENST00000603302ENST00000422112HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-5UTRENST00000603302ENST00000541923HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-5UTRENST00000603302ENST00000542498HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-5UTRENST00000603302ENST00000504433HADHchr4

108911220

+HPGDchr4

175429943

-
In-frameENST00000403312ENST00000296522HADHchr4

108911220

+HPGDchr4

175429943

-
In-frameENST00000403312ENST00000296521HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-5UTRENST00000403312ENST00000510901HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-intronENST00000403312ENST00000422112HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-5UTRENST00000403312ENST00000541923HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-5UTRENST00000403312ENST00000542498HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-5UTRENST00000403312ENST00000504433HADHchr4

108911220

+HPGDchr4

175429943

-
In-frameENST00000309522ENST00000296522HADHchr4

108911220

+HPGDchr4

175429943

-
In-frameENST00000309522ENST00000296521HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-5UTRENST00000309522ENST00000510901HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-intronENST00000309522ENST00000422112HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-5UTRENST00000309522ENST00000541923HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-5UTRENST00000309522ENST00000542498HADHchr4

108911220

+HPGDchr4

175429943

-
5CDS-5UTRENST00000309522ENST00000504433HADHchr4

108911220

+HPGDchr4

175429943

-
5UTR-3CDSENST00000505878ENST00000296522HADHchr4

108911220

+HPGDchr4

175429943

-
5UTR-3CDSENST00000505878ENST00000296521HADHchr4

108911220

+HPGDchr4

175429943

-
5UTR-5UTRENST00000505878ENST00000510901HADHchr4

108911220

+HPGDchr4

175429943

-
5UTR-intronENST00000505878ENST00000422112HADHchr4

108911220

+HPGDchr4

175429943

-
5UTR-5UTRENST00000505878ENST00000541923HADHchr4

108911220

+HPGDchr4

175429943

-
5UTR-5UTRENST00000505878ENST00000542498HADHchr4

108911220

+HPGDchr4

175429943

-
5UTR-5UTRENST00000505878ENST00000504433HADHchr4

108911220

+HPGDchr4

175429943

-
intron-3CDSENST00000454409ENST00000296522HADHchr4

108911220

+HPGDchr4

175429943

-
intron-3CDSENST00000454409ENST00000296521HADHchr4

108911220

+HPGDchr4

175429943

-
intron-5UTRENST00000454409ENST00000510901HADHchr4

108911220

+HPGDchr4

175429943

-
intron-intronENST00000454409ENST00000422112HADHchr4

108911220

+HPGDchr4

175429943

-
intron-5UTRENST00000454409ENST00000541923HADHchr4

108911220

+HPGDchr4

175429943

-
intron-5UTRENST00000454409ENST00000542498HADHchr4

108911220

+HPGDchr4

175429943

-
intron-5UTRENST00000454409ENST00000504433HADHchr4

108911220

+HPGDchr4

175429943

-
intron-3CDSENST00000510728ENST00000296522HADHchr4

108911220

+HPGDchr4

175429943

-
intron-3CDSENST00000510728ENST00000296521HADHchr4

108911220

+HPGDchr4

175429943

-
intron-5UTRENST00000510728ENST00000510901HADHchr4

108911220

+HPGDchr4

175429943

-
intron-intronENST00000510728ENST00000422112HADHchr4

108911220

+HPGDchr4

175429943

-
intron-5UTRENST00000510728ENST00000541923HADHchr4

108911220

+HPGDchr4

175429943

-
intron-5UTRENST00000510728ENST00000542498HADHchr4

108911220

+HPGDchr4

175429943

-
intron-5UTRENST00000510728ENST00000504433HADHchr4

108911220

+HPGDchr4

175429943

-

Top

FusionProtFeatures for HADH_HPGD


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
HADH

Q16836

HPGD

P15428

Plays an essential role in the mitochondrial beta-oxidation of short chain fatty acids. Exerts it highest activitytoward 3-hydroxybutyryl-CoA.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneHADHchr4:108911220chr4:175429943ENST00000309522+1834_3944315Nucleotide bindingNAD
HgeneHADHchr4:108911220chr4:175429943ENST00000603302+1934_3944332Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000296521-26151_155108179Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000296522-27151_155108267Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000422112-0512_20-13199Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000422112-05151_155-13199Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000422112-0536_37-13199Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000422112-0563_65-13199Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000510901-2712_20-13146Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000510901-27151_155-13146Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000510901-2736_37-13146Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000510901-2763_65-13146Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000541923-1612_20-13146Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000541923-16151_155-13146Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000541923-1636_37-13146Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000541923-1663_65-13146Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000542498-25151_155108144Nucleotide bindingNAD

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneHPGDchr4:108911220chr4:175429943ENST00000296521-2612_20108179Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000296521-2636_37108179Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000296521-2663_65108179Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000296522-2712_20108267Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000296522-2736_37108267Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000296522-2763_65108267Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000542498-2512_20108144Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000542498-2536_37108144Nucleotide bindingNAD
TgeneHPGDchr4:108911220chr4:175429943ENST00000542498-2563_65108144Nucleotide bindingNAD


Top

FusionGeneSequence for HADH_HPGD


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_HADH_ENST00000603302_chr4_108911220_+_HPGD_ENST00000296522_chr4_175429943_-_203aa
MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCAS
KHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMK

>In-frame_HADH_ENST00000603302_chr4_108911220_+_HPGD_ENST00000296521_chr4_175429943_-_115aa
MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCAS

>In-frame_HADH_ENST00000403312_chr4_108911220_+_HPGD_ENST00000296522_chr4_175429943_-_262aa
MGRAGLEAPPPPCGVTGTPGARGLQGRVGPRPQSLAFRGCPPRASSLPGSPRCRRRCHTMAFVTRQFMRSVSSSSTASASAKKIIVKHVT
VIGGGLMGAGIAQVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGF

>In-frame_HADH_ENST00000403312_chr4_108911220_+_HPGD_ENST00000296521_chr4_175429943_-_174aa
MGRAGLEAPPPPCGVTGTPGARGLQGRVGPRPQSLAFRGCPPRASSLPGSPRCRRRCHTMAFVTRQFMRSVSSSSTASASAKKIIVKHVT

>In-frame_HADH_ENST00000309522_chr4_108911220_+_HPGD_ENST00000296522_chr4_175429943_-_203aa
MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCAS
KHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMK

>In-frame_HADH_ENST00000309522_chr4_108911220_+_HPGD_ENST00000296521_chr4_175429943_-_115aa
MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCAS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_HADH_ENST00000603302_chr4_108911220_+_HPGD_ENST00000296522_chr4_175429943_-_609nt
ATGGCCTTCGTCACCAGGCAGTTCATGCGTTCCGTGTCCTCCTCGTCCACCGCCTCGGCCTCGGCCAAGAAGATAATCGTCAAGCACGTG
ACGGTCATCGGCGGCGGGCTGATGGGCGCCGGCATTGCCCAGGTTTCTGTTATCAGTGGAACCTATCTTGGTTTGGATTACATGAGTAAG
CAAAATGGAGGTGAAGGCGGCATCATTATCAATATGTCATCTTTAGCAGGACTCATGCCCGTTGCACAGCAGCCGGTTTATTGTGCTTCA
AAGCATGGCATAGTTGGATTCACACGCTCAGCAGCGTTGGCTGCTAATCTTATGAACAGTGGTGTGAGACTGAATGCCATTTGTCCAGGC
TTTGTTAACACAGCCATCCTTGAATCAATTGAAAAAGAAGAAAACATGGGACAATATATAGAATATAAGGATCATATCAAGGATATGATT
AAATACTATGGAATTTTGGACCCACCATTGATTGCCAATGGATTGATAACACTCATTGAAGATGATGCTTTAAATGGTGCTATTATGAAG

>In-frame_HADH_ENST00000603302_chr4_108911220_+_HPGD_ENST00000296521_chr4_175429943_-_345nt
ATGGCCTTCGTCACCAGGCAGTTCATGCGTTCCGTGTCCTCCTCGTCCACCGCCTCGGCCTCGGCCAAGAAGATAATCGTCAAGCACGTG
ACGGTCATCGGCGGCGGGCTGATGGGCGCCGGCATTGCCCAGGTTTCTGTTATCAGTGGAACCTATCTTGGTTTGGATTACATGAGTAAG
CAAAATGGAGGTGAAGGCGGCATCATTATCAATATGTCATCTTTAGCAGGACTCATGCCCGTTGCACAGCAGCCGGTTTATTGTGCTTCA

>In-frame_HADH_ENST00000403312_chr4_108911220_+_HPGD_ENST00000296522_chr4_175429943_-_786nt
ATGGGCAGAGCGGGACTCGAGGCCCCGCCCCCGCCTTGTGGCGTCACGGGGACGCCGGGGGCGCGCGGGCTGCAGGGCCGCGTAGGTCCC
CGCCCCCAGAGTCTGGCTTTCCGCGGCTGCCCGCCTCGCGCGTCTTCCCTGCCCGGGTCTCCTCGCTGTCGCCGCCGCTGCCACACCATG
GCCTTCGTCACCAGGCAGTTCATGCGTTCCGTGTCCTCCTCGTCCACCGCCTCGGCCTCGGCCAAGAAGATAATCGTCAAGCACGTGACG
GTCATCGGCGGCGGGCTGATGGGCGCCGGCATTGCCCAGGTTTCTGTTATCAGTGGAACCTATCTTGGTTTGGATTACATGAGTAAGCAA
AATGGAGGTGAAGGCGGCATCATTATCAATATGTCATCTTTAGCAGGACTCATGCCCGTTGCACAGCAGCCGGTTTATTGTGCTTCAAAG
CATGGCATAGTTGGATTCACACGCTCAGCAGCGTTGGCTGCTAATCTTATGAACAGTGGTGTGAGACTGAATGCCATTTGTCCAGGCTTT
GTTAACACAGCCATCCTTGAATCAATTGAAAAAGAAGAAAACATGGGACAATATATAGAATATAAGGATCATATCAAGGATATGATTAAA
TACTATGGAATTTTGGACCCACCATTGATTGCCAATGGATTGATAACACTCATTGAAGATGATGCTTTAAATGGTGCTATTATGAAGATC

>In-frame_HADH_ENST00000403312_chr4_108911220_+_HPGD_ENST00000296521_chr4_175429943_-_522nt
ATGGGCAGAGCGGGACTCGAGGCCCCGCCCCCGCCTTGTGGCGTCACGGGGACGCCGGGGGCGCGCGGGCTGCAGGGCCGCGTAGGTCCC
CGCCCCCAGAGTCTGGCTTTCCGCGGCTGCCCGCCTCGCGCGTCTTCCCTGCCCGGGTCTCCTCGCTGTCGCCGCCGCTGCCACACCATG
GCCTTCGTCACCAGGCAGTTCATGCGTTCCGTGTCCTCCTCGTCCACCGCCTCGGCCTCGGCCAAGAAGATAATCGTCAAGCACGTGACG
GTCATCGGCGGCGGGCTGATGGGCGCCGGCATTGCCCAGGTTTCTGTTATCAGTGGAACCTATCTTGGTTTGGATTACATGAGTAAGCAA
AATGGAGGTGAAGGCGGCATCATTATCAATATGTCATCTTTAGCAGGACTCATGCCCGTTGCACAGCAGCCGGTTTATTGTGCTTCAAAG

>In-frame_HADH_ENST00000309522_chr4_108911220_+_HPGD_ENST00000296522_chr4_175429943_-_609nt
ATGGCCTTCGTCACCAGGCAGTTCATGCGTTCCGTGTCCTCCTCGTCCACCGCCTCGGCCTCGGCCAAGAAGATAATCGTCAAGCACGTG
ACGGTCATCGGCGGCGGGCTGATGGGCGCCGGCATTGCCCAGGTTTCTGTTATCAGTGGAACCTATCTTGGTTTGGATTACATGAGTAAG
CAAAATGGAGGTGAAGGCGGCATCATTATCAATATGTCATCTTTAGCAGGACTCATGCCCGTTGCACAGCAGCCGGTTTATTGTGCTTCA
AAGCATGGCATAGTTGGATTCACACGCTCAGCAGCGTTGGCTGCTAATCTTATGAACAGTGGTGTGAGACTGAATGCCATTTGTCCAGGC
TTTGTTAACACAGCCATCCTTGAATCAATTGAAAAAGAAGAAAACATGGGACAATATATAGAATATAAGGATCATATCAAGGATATGATT
AAATACTATGGAATTTTGGACCCACCATTGATTGCCAATGGATTGATAACACTCATTGAAGATGATGCTTTAAATGGTGCTATTATGAAG

>In-frame_HADH_ENST00000309522_chr4_108911220_+_HPGD_ENST00000296521_chr4_175429943_-_345nt
ATGGCCTTCGTCACCAGGCAGTTCATGCGTTCCGTGTCCTCCTCGTCCACCGCCTCGGCCTCGGCCAAGAAGATAATCGTCAAGCACGTG
ACGGTCATCGGCGGCGGGCTGATGGGCGCCGGCATTGCCCAGGTTTCTGTTATCAGTGGAACCTATCTTGGTTTGGATTACATGAGTAAG
CAAAATGGAGGTGAAGGCGGCATCATTATCAATATGTCATCTTTAGCAGGACTCATGCCCGTTGCACAGCAGCCGGTTTATTGTGCTTCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_HADH_ENST00000603302_chr4_108911220_+_HPGD_ENST00000296522_chr4_175429943_-_2607nt
CGTGTATACCCGCTCAACGCTGGGACGTTACAGCCAGGGCCAATGGGCAGAGCGGGACTCGAGGCCCCGCCCCCGCCTTGTGGCGTCACG
GGGACGCCGGGGGCGCGCGGGCTGCAGGGCCGCGTAGGTCCCCGCCCCCAGAGTCTGGCTTTCCGCGGCTGCCCGCCTCGCGCGTCTTCC
CTGCCCGGGTCTCCTCGCTGTCGCCGCCGCTGCCACACCATGGCCTTCGTCACCAGGCAGTTCATGCGTTCCGTGTCCTCCTCGTCCACC
GCCTCGGCCTCGGCCAAGAAGATAATCGTCAAGCACGTGACGGTCATCGGCGGCGGGCTGATGGGCGCCGGCATTGCCCAGGTTTCTGTT
ATCAGTGGAACCTATCTTGGTTTGGATTACATGAGTAAGCAAAATGGAGGTGAAGGCGGCATCATTATCAATATGTCATCTTTAGCAGGA
CTCATGCCCGTTGCACAGCAGCCGGTTTATTGTGCTTCAAAGCATGGCATAGTTGGATTCACACGCTCAGCAGCGTTGGCTGCTAATCTT
ATGAACAGTGGTGTGAGACTGAATGCCATTTGTCCAGGCTTTGTTAACACAGCCATCCTTGAATCAATTGAAAAAGAAGAAAACATGGGA
CAATATATAGAATATAAGGATCATATCAAGGATATGATTAAATACTATGGAATTTTGGACCCACCATTGATTGCCAATGGATTGATAACA
CTCATTGAAGATGATGCTTTAAATGGTGCTATTATGAAGATCACAACTTCTAAGGGAATTCATTTTCAAGACTATGATACAACTCCATTT
CAAGCAAAAACCCAATGAACAGCTTATGTGTTAGCCATAGCTGAAAATAAGCACAAATAGCTTATATTCAGATCCTATCTTCATTTGAAT
ATAGCTTTTAAATGAAATGTTACAGTTTGAAGTTTTCCTTCATGCACTTGGTGATAAACGTTTTCTAAATTTTTAGTTAAGTATATGGAT
AAAAAGTTATGAACTATTAAAAATGTGATGTGGACCAAAGGCTAGGTTGTAATCTTGATAGTCTAAAAAATGATCAAAACAAATGATTTT
CAAGGAATATTCAATATTCTGCCTTTCAGAAAGTGTATTTATATCTGTGCTTCATAAATATTAATGTTCTTCAGAACATCATTTTAAAGG
AGATACTTGAATTGTTATTTAAATCAAACCAGATGTAAAACACTCACATACAAGTTCATACTTTAAAAGAGGAAAGCTACTTAACAATGA
CAAATATTTCACAATAATAATTTTTACTTATATACCATCTTTCAACTGAACATTTCAGTTCTTCCAAGAGCTTCTTAGAGTAGTATATTT
TGGGGGCAGTCAAGGAATAAACTACAGTGTAAACATATCCCAGATGAAAACTGCTGTATGGAAAAATGACAGAAAGTAACTGATTGACAC
TGTTGATTCACAGTTCAGCCTCCTATCTGGGAAAGACATTTCTTTCCTCTGCTCACTTTAAGAACTTTTACCGACTCCAAAAATCTCAGG
AATTAAACTTTTAACAGTTACAGCAATAAAGAATAGTTAGTACTCCAAAAATATTATATTTAAGATGCTCAACAAGAAAAAAATGCAAAT
GTAATATTTTTTTCAAATTACTTCTTTATTGACTTGTCCAAATTTCAAAAGTGCCTACCCTTCAATAAAACTTTTTTATTCTGATCTCCA
TAAATTACTTAGTCTTCTATGTATAGCTATCAAGGAAATAAAACCAATTTTGCCACAGCCACAACTGTAAATGTTTTTGTACCCATGCTG
AAACTCATAACAACACAGACATAAAAATAGCTGTGAGGTTTTGCTTTTTTTGTTGTCAGCTATCTTAAGAATCATTAAATACACCTGCTT
TGGGTAAAACTCTTTGCAAGCAGTAATTAACACTAGTAACAGTGAAAGCACAAGATTTCCAAATCAGTCGTTTTCTCAAAAAAATATCGT
ATAAGTGACTCATCCTGTCTGCTAACTCCAGACCTCCCAGCTTGAAGCCAAATCTTTCCATGTGAGATTGATATGGATTTCCTAGAAGTA
CTGGAATGTTGTCATATCTTGCCCTATTTTAATTCTGCTATAGAAAACAATTGCCTTCACTTTTAAGGAGTAATTTGAATATTAATAACT
CTGGTCTAGATTTTCATATAATGTATTAAAGACAAAGTAGTGAACATCAATGAACATCTGATAGAGATAAACTGTAATCAGGCATAAGCT
TGTTTGTATGTTCTGGCAGTGACTAATCAGTAAATGATGTCGGTTTGCCCAGTATCACTTATCTTCTGTATTTTTCCTCTGTCGTGTAAA
TAGTATAACCTTTTCATTTATGGACAATTTTTTGGACTAGTAGCCTTCAATATACATTCTGCTTTGAATTAATTTTTTCAAATCAATAAA
TTATGTAGACATTTAAAATCAAATATCAAGTAGAATTGAAAAATGTGAGTTACATAAGTTAAAAACTTACTTTAAATCTTACCTTCTATA

>In-frame_HADH_ENST00000603302_chr4_108911220_+_HPGD_ENST00000296521_chr4_175429943_-_1162nt
CGTGTATACCCGCTCAACGCTGGGACGTTACAGCCAGGGCCAATGGGCAGAGCGGGACTCGAGGCCCCGCCCCCGCCTTGTGGCGTCACG
GGGACGCCGGGGGCGCGCGGGCTGCAGGGCCGCGTAGGTCCCCGCCCCCAGAGTCTGGCTTTCCGCGGCTGCCCGCCTCGCGCGTCTTCC
CTGCCCGGGTCTCCTCGCTGTCGCCGCCGCTGCCACACCATGGCCTTCGTCACCAGGCAGTTCATGCGTTCCGTGTCCTCCTCGTCCACC
GCCTCGGCCTCGGCCAAGAAGATAATCGTCAAGCACGTGACGGTCATCGGCGGCGGGCTGATGGGCGCCGGCATTGCCCAGGTTTCTGTT
ATCAGTGGAACCTATCTTGGTTTGGATTACATGAGTAAGCAAAATGGAGGTGAAGGCGGCATCATTATCAATATGTCATCTTTAGCAGGA
CTCATGCCCGTTGCACAGCAGCCGGTTTATTGTGCTTCAAAGCATGGCATAGTTGGATTCACACGCTCAGCAGCGCCCACCATTGATTGC
CAATGGATTGATAACACTCATTGAAGATGATGCTTTAAATGGTGCTATTATGAAGATCACAACTTCTAAGGGAATTCATTTTCAAGACTA
TGATACAACTCCATTTCAAGCAAAAACCCAATGAACAGCTTATGTGTTAGCCATAGCTGAAAATAAGCACAAATAGCTTATATTCAGATC
CTATCTTCATTTGAATATAGCTTTTAAATGAAATGTTACAGTTTGAAGTTTTCCTTCATGCACTTGGTGATAAACGTTTTCTAAATTTTT
AGTTAAGTATATGGATAAAAAGTTATGAACTATTAAAAATGTGATGTGGACCAAAGGCTAGGTTGTAATCTTGATAGTCTAAAAAATGAT
CAAAACAAATGATTTTCAAGGAATATTCAATATTCTGCCTTTCAGAAAGTGTATTTATATCTGTGCTTCATAAATATTAATGTTCTTCAG
AACATCATTTTAAAGGAGATACTTGAATTGTTATTTAAATCAAACCAGATGTAAAACACTCACATACAAGTTCATACTTTAAAAGAGGAA

>In-frame_HADH_ENST00000403312_chr4_108911220_+_HPGD_ENST00000296522_chr4_175429943_-_2607nt
CGTGTATACCCGCTCAACGCTGGGACGTTACAGCCAGGGCCAATGGGCAGAGCGGGACTCGAGGCCCCGCCCCCGCCTTGTGGCGTCACG
GGGACGCCGGGGGCGCGCGGGCTGCAGGGCCGCGTAGGTCCCCGCCCCCAGAGTCTGGCTTTCCGCGGCTGCCCGCCTCGCGCGTCTTCC
CTGCCCGGGTCTCCTCGCTGTCGCCGCCGCTGCCACACCATGGCCTTCGTCACCAGGCAGTTCATGCGTTCCGTGTCCTCCTCGTCCACC
GCCTCGGCCTCGGCCAAGAAGATAATCGTCAAGCACGTGACGGTCATCGGCGGCGGGCTGATGGGCGCCGGCATTGCCCAGGTTTCTGTT
ATCAGTGGAACCTATCTTGGTTTGGATTACATGAGTAAGCAAAATGGAGGTGAAGGCGGCATCATTATCAATATGTCATCTTTAGCAGGA
CTCATGCCCGTTGCACAGCAGCCGGTTTATTGTGCTTCAAAGCATGGCATAGTTGGATTCACACGCTCAGCAGCGTTGGCTGCTAATCTT
ATGAACAGTGGTGTGAGACTGAATGCCATTTGTCCAGGCTTTGTTAACACAGCCATCCTTGAATCAATTGAAAAAGAAGAAAACATGGGA
CAATATATAGAATATAAGGATCATATCAAGGATATGATTAAATACTATGGAATTTTGGACCCACCATTGATTGCCAATGGATTGATAACA
CTCATTGAAGATGATGCTTTAAATGGTGCTATTATGAAGATCACAACTTCTAAGGGAATTCATTTTCAAGACTATGATACAACTCCATTT
CAAGCAAAAACCCAATGAACAGCTTATGTGTTAGCCATAGCTGAAAATAAGCACAAATAGCTTATATTCAGATCCTATCTTCATTTGAAT
ATAGCTTTTAAATGAAATGTTACAGTTTGAAGTTTTCCTTCATGCACTTGGTGATAAACGTTTTCTAAATTTTTAGTTAAGTATATGGAT
AAAAAGTTATGAACTATTAAAAATGTGATGTGGACCAAAGGCTAGGTTGTAATCTTGATAGTCTAAAAAATGATCAAAACAAATGATTTT
CAAGGAATATTCAATATTCTGCCTTTCAGAAAGTGTATTTATATCTGTGCTTCATAAATATTAATGTTCTTCAGAACATCATTTTAAAGG
AGATACTTGAATTGTTATTTAAATCAAACCAGATGTAAAACACTCACATACAAGTTCATACTTTAAAAGAGGAAAGCTACTTAACAATGA
CAAATATTTCACAATAATAATTTTTACTTATATACCATCTTTCAACTGAACATTTCAGTTCTTCCAAGAGCTTCTTAGAGTAGTATATTT
TGGGGGCAGTCAAGGAATAAACTACAGTGTAAACATATCCCAGATGAAAACTGCTGTATGGAAAAATGACAGAAAGTAACTGATTGACAC
TGTTGATTCACAGTTCAGCCTCCTATCTGGGAAAGACATTTCTTTCCTCTGCTCACTTTAAGAACTTTTACCGACTCCAAAAATCTCAGG
AATTAAACTTTTAACAGTTACAGCAATAAAGAATAGTTAGTACTCCAAAAATATTATATTTAAGATGCTCAACAAGAAAAAAATGCAAAT
GTAATATTTTTTTCAAATTACTTCTTTATTGACTTGTCCAAATTTCAAAAGTGCCTACCCTTCAATAAAACTTTTTTATTCTGATCTCCA
TAAATTACTTAGTCTTCTATGTATAGCTATCAAGGAAATAAAACCAATTTTGCCACAGCCACAACTGTAAATGTTTTTGTACCCATGCTG
AAACTCATAACAACACAGACATAAAAATAGCTGTGAGGTTTTGCTTTTTTTGTTGTCAGCTATCTTAAGAATCATTAAATACACCTGCTT
TGGGTAAAACTCTTTGCAAGCAGTAATTAACACTAGTAACAGTGAAAGCACAAGATTTCCAAATCAGTCGTTTTCTCAAAAAAATATCGT
ATAAGTGACTCATCCTGTCTGCTAACTCCAGACCTCCCAGCTTGAAGCCAAATCTTTCCATGTGAGATTGATATGGATTTCCTAGAAGTA
CTGGAATGTTGTCATATCTTGCCCTATTTTAATTCTGCTATAGAAAACAATTGCCTTCACTTTTAAGGAGTAATTTGAATATTAATAACT
CTGGTCTAGATTTTCATATAATGTATTAAAGACAAAGTAGTGAACATCAATGAACATCTGATAGAGATAAACTGTAATCAGGCATAAGCT
TGTTTGTATGTTCTGGCAGTGACTAATCAGTAAATGATGTCGGTTTGCCCAGTATCACTTATCTTCTGTATTTTTCCTCTGTCGTGTAAA
TAGTATAACCTTTTCATTTATGGACAATTTTTTGGACTAGTAGCCTTCAATATACATTCTGCTTTGAATTAATTTTTTCAAATCAATAAA
TTATGTAGACATTTAAAATCAAATATCAAGTAGAATTGAAAAATGTGAGTTACATAAGTTAAAAACTTACTTTAAATCTTACCTTCTATA

>In-frame_HADH_ENST00000403312_chr4_108911220_+_HPGD_ENST00000296521_chr4_175429943_-_1162nt
CGTGTATACCCGCTCAACGCTGGGACGTTACAGCCAGGGCCAATGGGCAGAGCGGGACTCGAGGCCCCGCCCCCGCCTTGTGGCGTCACG
GGGACGCCGGGGGCGCGCGGGCTGCAGGGCCGCGTAGGTCCCCGCCCCCAGAGTCTGGCTTTCCGCGGCTGCCCGCCTCGCGCGTCTTCC
CTGCCCGGGTCTCCTCGCTGTCGCCGCCGCTGCCACACCATGGCCTTCGTCACCAGGCAGTTCATGCGTTCCGTGTCCTCCTCGTCCACC
GCCTCGGCCTCGGCCAAGAAGATAATCGTCAAGCACGTGACGGTCATCGGCGGCGGGCTGATGGGCGCCGGCATTGCCCAGGTTTCTGTT
ATCAGTGGAACCTATCTTGGTTTGGATTACATGAGTAAGCAAAATGGAGGTGAAGGCGGCATCATTATCAATATGTCATCTTTAGCAGGA
CTCATGCCCGTTGCACAGCAGCCGGTTTATTGTGCTTCAAAGCATGGCATAGTTGGATTCACACGCTCAGCAGCGCCCACCATTGATTGC
CAATGGATTGATAACACTCATTGAAGATGATGCTTTAAATGGTGCTATTATGAAGATCACAACTTCTAAGGGAATTCATTTTCAAGACTA
TGATACAACTCCATTTCAAGCAAAAACCCAATGAACAGCTTATGTGTTAGCCATAGCTGAAAATAAGCACAAATAGCTTATATTCAGATC
CTATCTTCATTTGAATATAGCTTTTAAATGAAATGTTACAGTTTGAAGTTTTCCTTCATGCACTTGGTGATAAACGTTTTCTAAATTTTT
AGTTAAGTATATGGATAAAAAGTTATGAACTATTAAAAATGTGATGTGGACCAAAGGCTAGGTTGTAATCTTGATAGTCTAAAAAATGAT
CAAAACAAATGATTTTCAAGGAATATTCAATATTCTGCCTTTCAGAAAGTGTATTTATATCTGTGCTTCATAAATATTAATGTTCTTCAG
AACATCATTTTAAAGGAGATACTTGAATTGTTATTTAAATCAAACCAGATGTAAAACACTCACATACAAGTTCATACTTTAAAAGAGGAA

>In-frame_HADH_ENST00000309522_chr4_108911220_+_HPGD_ENST00000296522_chr4_175429943_-_2537nt
CCCCGCCTTGTGGCGTCACGGGGACGCCGGGGGCGCGCGGGCTGCAGGGCCGCGTAGGTCCCCGCCCCCAGAGTCTGGCTTTCCGCGGCT
GCCCGCCTCGCGCGTCTTCCCTGCCCGGGTCTCCTCGCTGTCGCCGCCGCTGCCACACCATGGCCTTCGTCACCAGGCAGTTCATGCGTT
CCGTGTCCTCCTCGTCCACCGCCTCGGCCTCGGCCAAGAAGATAATCGTCAAGCACGTGACGGTCATCGGCGGCGGGCTGATGGGCGCCG
GCATTGCCCAGGTTTCTGTTATCAGTGGAACCTATCTTGGTTTGGATTACATGAGTAAGCAAAATGGAGGTGAAGGCGGCATCATTATCA
ATATGTCATCTTTAGCAGGACTCATGCCCGTTGCACAGCAGCCGGTTTATTGTGCTTCAAAGCATGGCATAGTTGGATTCACACGCTCAG
CAGCGTTGGCTGCTAATCTTATGAACAGTGGTGTGAGACTGAATGCCATTTGTCCAGGCTTTGTTAACACAGCCATCCTTGAATCAATTG
AAAAAGAAGAAAACATGGGACAATATATAGAATATAAGGATCATATCAAGGATATGATTAAATACTATGGAATTTTGGACCCACCATTGA
TTGCCAATGGATTGATAACACTCATTGAAGATGATGCTTTAAATGGTGCTATTATGAAGATCACAACTTCTAAGGGAATTCATTTTCAAG
ACTATGATACAACTCCATTTCAAGCAAAAACCCAATGAACAGCTTATGTGTTAGCCATAGCTGAAAATAAGCACAAATAGCTTATATTCA
GATCCTATCTTCATTTGAATATAGCTTTTAAATGAAATGTTACAGTTTGAAGTTTTCCTTCATGCACTTGGTGATAAACGTTTTCTAAAT
TTTTAGTTAAGTATATGGATAAAAAGTTATGAACTATTAAAAATGTGATGTGGACCAAAGGCTAGGTTGTAATCTTGATAGTCTAAAAAA
TGATCAAAACAAATGATTTTCAAGGAATATTCAATATTCTGCCTTTCAGAAAGTGTATTTATATCTGTGCTTCATAAATATTAATGTTCT
TCAGAACATCATTTTAAAGGAGATACTTGAATTGTTATTTAAATCAAACCAGATGTAAAACACTCACATACAAGTTCATACTTTAAAAGA
GGAAAGCTACTTAACAATGACAAATATTTCACAATAATAATTTTTACTTATATACCATCTTTCAACTGAACATTTCAGTTCTTCCAAGAG
CTTCTTAGAGTAGTATATTTTGGGGGCAGTCAAGGAATAAACTACAGTGTAAACATATCCCAGATGAAAACTGCTGTATGGAAAAATGAC
AGAAAGTAACTGATTGACACTGTTGATTCACAGTTCAGCCTCCTATCTGGGAAAGACATTTCTTTCCTCTGCTCACTTTAAGAACTTTTA
CCGACTCCAAAAATCTCAGGAATTAAACTTTTAACAGTTACAGCAATAAAGAATAGTTAGTACTCCAAAAATATTATATTTAAGATGCTC
AACAAGAAAAAAATGCAAATGTAATATTTTTTTCAAATTACTTCTTTATTGACTTGTCCAAATTTCAAAAGTGCCTACCCTTCAATAAAA
CTTTTTTATTCTGATCTCCATAAATTACTTAGTCTTCTATGTATAGCTATCAAGGAAATAAAACCAATTTTGCCACAGCCACAACTGTAA
ATGTTTTTGTACCCATGCTGAAACTCATAACAACACAGACATAAAAATAGCTGTGAGGTTTTGCTTTTTTTGTTGTCAGCTATCTTAAGA
ATCATTAAATACACCTGCTTTGGGTAAAACTCTTTGCAAGCAGTAATTAACACTAGTAACAGTGAAAGCACAAGATTTCCAAATCAGTCG
TTTTCTCAAAAAAATATCGTATAAGTGACTCATCCTGTCTGCTAACTCCAGACCTCCCAGCTTGAAGCCAAATCTTTCCATGTGAGATTG
ATATGGATTTCCTAGAAGTACTGGAATGTTGTCATATCTTGCCCTATTTTAATTCTGCTATAGAAAACAATTGCCTTCACTTTTAAGGAG
TAATTTGAATATTAATAACTCTGGTCTAGATTTTCATATAATGTATTAAAGACAAAGTAGTGAACATCAATGAACATCTGATAGAGATAA
ACTGTAATCAGGCATAAGCTTGTTTGTATGTTCTGGCAGTGACTAATCAGTAAATGATGTCGGTTTGCCCAGTATCACTTATCTTCTGTA
TTTTTCCTCTGTCGTGTAAATAGTATAACCTTTTCATTTATGGACAATTTTTTGGACTAGTAGCCTTCAATATACATTCTGCTTTGAATT
AATTTTTTCAAATCAATAAATTATGTAGACATTTAAAATCAAATATCAAGTAGAATTGAAAAATGTGAGTTACATAAGTTAAAAACTTAC
TTTAAATCTTACCTTCTATAGGTAGCTCTAAATAAATTCATATGGTTATATGGCATCTCTGGTGTATACTGATTGAGAAAATAATTAAAC

>In-frame_HADH_ENST00000309522_chr4_108911220_+_HPGD_ENST00000296521_chr4_175429943_-_1092nt
CCCCGCCTTGTGGCGTCACGGGGACGCCGGGGGCGCGCGGGCTGCAGGGCCGCGTAGGTCCCCGCCCCCAGAGTCTGGCTTTCCGCGGCT
GCCCGCCTCGCGCGTCTTCCCTGCCCGGGTCTCCTCGCTGTCGCCGCCGCTGCCACACCATGGCCTTCGTCACCAGGCAGTTCATGCGTT
CCGTGTCCTCCTCGTCCACCGCCTCGGCCTCGGCCAAGAAGATAATCGTCAAGCACGTGACGGTCATCGGCGGCGGGCTGATGGGCGCCG
GCATTGCCCAGGTTTCTGTTATCAGTGGAACCTATCTTGGTTTGGATTACATGAGTAAGCAAAATGGAGGTGAAGGCGGCATCATTATCA
ATATGTCATCTTTAGCAGGACTCATGCCCGTTGCACAGCAGCCGGTTTATTGTGCTTCAAAGCATGGCATAGTTGGATTCACACGCTCAG
CAGCGCCCACCATTGATTGCCAATGGATTGATAACACTCATTGAAGATGATGCTTTAAATGGTGCTATTATGAAGATCACAACTTCTAAG
GGAATTCATTTTCAAGACTATGATACAACTCCATTTCAAGCAAAAACCCAATGAACAGCTTATGTGTTAGCCATAGCTGAAAATAAGCAC
AAATAGCTTATATTCAGATCCTATCTTCATTTGAATATAGCTTTTAAATGAAATGTTACAGTTTGAAGTTTTCCTTCATGCACTTGGTGA
TAAACGTTTTCTAAATTTTTAGTTAAGTATATGGATAAAAAGTTATGAACTATTAAAAATGTGATGTGGACCAAAGGCTAGGTTGTAATC
TTGATAGTCTAAAAAATGATCAAAACAAATGATTTTCAAGGAATATTCAATATTCTGCCTTTCAGAAAGTGTATTTATATCTGTGCTTCA
TAAATATTAATGTTCTTCAGAACATCATTTTAAAGGAGATACTTGAATTGTTATTTAAATCAAACCAGATGTAAAACACTCACATACAAG
TTCATACTTTAAAAGAGGAAAGCTACTTAACAATGACAAATATTTCACAATAATAATTTTTACTTATATACCATCTTTCAACTGAACATT


Top

FusionGenePPI for HADH_HPGD


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
HADHUBA5, MAPK3, APP, ADH1A, STAT1, MOV10, NXF1, CLIC3, CLIC4, ETFA, ETFB, FKBP2, ACAT2, MMAB, PITPNA, PSMA1, PSMA2, PSMB8, RSU1, SF1, UBE2N, NTRK1, CLK1HPGDAPP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for HADH_HPGD


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for HADH_HPGD


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneHADHC0028754Obesity1CTD_human
HgeneHADHC0032927Precancerous Conditions1CTD_human
HgeneHADHC1864948Hyperinsulinemic Hypoglycemia, Familial, 41CTD_human;ORPHANET;UNIPROT
TgeneHPGDC0029411Osteoarthropathy, Primary Hypertrophic2CTD_human;ORPHANET;UNIPROT
TgeneHPGDC0033578Prostatic Neoplasms1CTD_human
TgeneHPGDC0040136Thyroid Neoplasm1CTD_human
TgeneHPGDC0206693Medullary carcinoma1CTD_human
TgeneHPGDC0345408Hereditary clubbing1ORPHANET;UNIPROT