FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15726

FusionGeneSummary for GXYLT2_NEK3

check button Fusion gene summary
Fusion gene informationFusion gene name: GXYLT2_NEK3
Fusion gene ID: 15726
HgeneTgene
Gene symbol

GXYLT2

NEK3

Gene ID

727936

4752

Gene nameglucoside xylosyltransferase 2NIMA related kinase 3
SynonymsGLT8D4HSPK36
Cytomap

3p13

13q14.3

Type of geneprotein-codingprotein-coding
Descriptionglucoside xylosyltransferase 2glycosyltransferase 8 domain containing 4glycosyltransferase 8 domain-containing protein 4serine/threonine-protein kinase Nek3HSPK 36NIMA (never in mitosis gene a)-related kinase 3glycogen synthase A kinasehydroxyalkyl-protein kinasenever in mitosis A-related kinase 3nimA-related protein kinase 3phosphorylase B kinase kinase
Modification date2018051920180519
UniProtAcc

A0PJZ3

P51956

Ensembl transtripts involved in fusion geneENST00000389617, ENST00000378101, 
ENST00000339406, ENST00000452082, 
ENST00000400357, 
Fusion gene scores* DoF score3 X 2 X 2=121 X 1 X 1=1
# samples 31
** MAII scorelog2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: GXYLT2 [Title/Abstract] AND NEK3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneGXYLT2

GO:0016266

O-glycan processing

19940119


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-EB-A44R-06AGXYLT2chr3

72971486

+NEK3chr13

52719026

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000389617ENST00000378101GXYLT2chr3

72971486

+NEK3chr13

52719026

-
In-frameENST00000389617ENST00000339406GXYLT2chr3

72971486

+NEK3chr13

52719026

-
In-frameENST00000389617ENST00000452082GXYLT2chr3

72971486

+NEK3chr13

52719026

-
In-frameENST00000389617ENST00000400357GXYLT2chr3

72971486

+NEK3chr13

52719026

-

Top

FusionProtFeatures for GXYLT2_NEK3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GXYLT2

A0PJZ3

NEK3

P51956

Glycosyltransferase which elongates the O-linked glucoseattached to EGF-like repeats in the extracellular domain of Notchproteins by catalyzing the addition of xylose.{ECO:0000269|PubMed:19940119}. Protein kinase which influences neuronal morphogenesisand polarity through effects on microtubules. Regulatesmicrotubule acetylation in neurons. Contributes to prolactin-mediated phosphorylation of PXN and VAV2. Implicated in prolactin-mediated cytoskeletal reorganization and motility of breast cancercells through mechanisms involving RAC1 activation andphosphorylation of PXN and VAV2. {ECO:0000269|PubMed:15618286,ECO:0000269|PubMed:17297458}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGXYLT2chr3:72971486chr13:52719026ENST00000389617+3768_98200444Compositional biasNote=Arg-rich
HgeneGXYLT2chr3:72971486chr13:52719026ENST00000389617+371_4200444Topological domainCytoplasmic
HgeneGXYLT2chr3:72971486chr13:52719026ENST00000389617+375_25200444TransmembraneHelical%3B Signal-anchor for type II membrane protein

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGXYLT2chr3:72971486chr13:52719026ENST00000389617+3726_443200444Topological domainLumenal
TgeneNEK3chr3:72971486chr13:52719026ENST00000400357-6144_257201490DomainProtein kinase
TgeneNEK3chr3:72971486chr13:52719026ENST00000400357-61410_18201490Nucleotide bindingATP


Top

FusionGeneSequence for GXYLT2_NEK3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_NEK3_ENST00000378101_chr13_52719026_-_506aa
MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKL
ARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSTTKKFEHRIYPITFSVG
NPQEWKKLFKPCAAQRLFLPFQANSWKNLILKVCQGCISPLPSHYSTELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIM
ETGEEVLEEIKNSKHNTPRKKANPSRIRIALGNEASTVQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHLRKASSPNLHRR
QWEKNVPNTALTALENASILTSSLTAEDDRGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTITRPGSEGFLKGPLSEETE

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_NEK3_ENST00000339406_chr13_52719026_-_506aa
MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKL
ARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSTTKKFEHRIYPITFSVG
NPQEWKKLFKPCAAQRLFLPFQANSWKNLILKVCQGCISPLPSHYSTELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIM
ETGEEVLEEIKNSKHNTPRKKANPSRIRIALGNEASTVQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHLRKASSPNLHRR
QWEKNVPNTALTALENASILTSSLTAEDDRGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTITRPGSEGFLKGPLSEETE

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_NEK3_ENST00000452082_chr13_52719026_-_489aa
MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKL
ARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSTTKKFEHRIYPITFSVG
NPQEWKKLFKPCAAQRLFLPFQANSWKNLILKVCQGCISPLPSHYSTELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIM
ETGEEVLEEIKNSKHNTPRKKQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHLRKASSPNLHRRQWEKNVPNTALTALENA
SILTSSLTAEDDRGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTITRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPE

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_NEK3_ENST00000400357_chr13_52719026_-_489aa
MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKL
ARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSTTKKFEHRIYPITFSVG
NPQEWKKLFKPCAAQRLFLPFQANSWKNLILKVCQGCISPLPSHYSTELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIM
ETGEEVLEEIKNSKHNTPRKKQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHLRKASSPNLHRRQWEKNVPNTALTALENA
SILTSSLTAEDDRGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTITRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_NEK3_ENST00000378101_chr13_52719026_-_1518nt
ATGAAGCTCCGCAGCAAGGCGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCT
GAGCCCCCAGCGCTGCCCGCGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTC
CCCGGGGCCAGCCCGGGAGTTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTG
GCGAGGAGGCCTGGAGAACCCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGG
CTGGAGGAGACGCTGGTCATGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAG
CCCGAGTTTGATAAGCAGTTACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGA
AACCCTCAGGAGTGGAAGAAATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGTTTCAGGCAAATAGTTGGAAAAATCTTATC
CTCAAAGTATGTCAAGGGTGCATCAGTCCACTGCCGTCTCATTACTCCTATGAACTTCAGTTCCTAGTCAAGCAGATGTTTAAAAGGAAT
CCCTCACATCGCCCCTCGGCTACAACGCTTCTCTCTCGAGGCATCGTAGCTCGGCTTGTCCAGAAGTGCTTACCCCCCGAGATCATCATG
GAATATGGTGAGGAAGTATTAGAAGAAATAAAAAATTCGAAGCATAACACACCAAGAAAAAAAGCAAACCCCAGCAGAATCAGGATAGCT
TTGGGAAATGAAGCAAGCACAGTGCAAGAGGAAGAACAAGATAGAAAGGGTAGCCATACTGATTTGGAAAGCATTAATGAAAATTTAGTT
GAAAGTGCATTGAGAAGAGTAAACAGAGAAGAAAAAGGTAATAAGTCAGTCCATCTGAGGAAAGCCAGTTCACCAAATCTTCATAGACGA
CAGTGGGAGAAAAATGTACCCAATACAGCTCTTACAGCTTTGGAAAATGCATCCATACTCACCTCCAGTTTAACAGCAGAGGACGATAGA
GGTGGTTCTGTAATAAAGTACAGCAAAAATACTACTCGTAAGCAGTGGCTCAAAGAGACCCCTGACACTTTGTTGAACATCCTTAAGAAT
GCTGATCTCAGCTTGGCTTTTCAAACATACACAATATATAGACCAGGTTCAGAAGGGTTCTTGAAAGGCCCCCTGTCTGAAGAAACAGAA
GCATCGGACAGTGTTGATGGAGGTCACGATTCTGTCATTTTGGATCCAGAGCGACTTGAGCCTGGGCTAGATGAGGAGGACACGGACTTT

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_NEK3_ENST00000339406_chr13_52719026_-_1518nt
ATGAAGCTCCGCAGCAAGGCGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCT
GAGCCCCCAGCGCTGCCCGCGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTC
CCCGGGGCCAGCCCGGGAGTTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTG
GCGAGGAGGCCTGGAGAACCCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGG
CTGGAGGAGACGCTGGTCATGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAG
CCCGAGTTTGATAAGCAGTTACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGA
AACCCTCAGGAGTGGAAGAAATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGTTTCAGGCAAATAGTTGGAAAAATCTTATC
CTCAAAGTATGTCAAGGGTGCATCAGTCCACTGCCGTCTCATTACTCCTATGAACTTCAGTTCCTAGTCAAGCAGATGTTTAAAAGGAAT
CCCTCACATCGCCCCTCGGCTACAACGCTTCTCTCTCGAGGCATCGTAGCTCGGCTTGTCCAGAAGTGCTTACCCCCCGAGATCATCATG
GAATATGGTGAGGAAGTATTAGAAGAAATAAAAAATTCGAAGCATAACACACCAAGAAAAAAAGCAAACCCCAGCAGAATCAGGATAGCT
TTGGGAAATGAAGCAAGCACAGTGCAAGAGGAAGAACAAGATAGAAAGGGTAGCCATACTGATTTGGAAAGCATTAATGAAAATTTAGTT
GAAAGTGCATTGAGAAGAGTAAACAGAGAAGAAAAAGGTAATAAGTCAGTCCATCTGAGGAAAGCCAGTTCACCAAATCTTCATAGACGA
CAGTGGGAGAAAAATGTACCCAATACAGCTCTTACAGCTTTGGAAAATGCATCCATACTCACCTCCAGTTTAACAGCAGAGGACGATAGA
GGTGGTTCTGTAATAAAGTACAGCAAAAATACTACTCGTAAGCAGTGGCTCAAAGAGACCCCTGACACTTTGTTGAACATCCTTAAGAAT
GCTGATCTCAGCTTGGCTTTTCAAACATACACAATATATAGACCAGGTTCAGAAGGGTTCTTGAAAGGCCCCCTGTCTGAAGAAACAGAA
GCATCGGACAGTGTTGATGGAGGTCACGATTCTGTCATTTTGGATCCAGAGCGACTTGAGCCTGGGCTAGATGAGGAGGACACGGACTTT

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_NEK3_ENST00000452082_chr13_52719026_-_1467nt
ATGAAGCTCCGCAGCAAGGCGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCT
GAGCCCCCAGCGCTGCCCGCGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTC
CCCGGGGCCAGCCCGGGAGTTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTG
GCGAGGAGGCCTGGAGAACCCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGG
CTGGAGGAGACGCTGGTCATGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAG
CCCGAGTTTGATAAGCAGTTACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGA
AACCCTCAGGAGTGGAAGAAATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGTTTCAGGCAAATAGTTGGAAAAATCTTATC
CTCAAAGTATGTCAAGGGTGCATCAGTCCACTGCCGTCTCATTACTCCTATGAACTTCAGTTCCTAGTCAAGCAGATGTTTAAAAGGAAT
CCCTCACATCGCCCCTCGGCTACAACGCTTCTCTCTCGAGGCATCGTAGCTCGGCTTGTCCAGAAGTGCTTACCCCCCGAGATCATCATG
GAATATGGTGAGGAAGTATTAGAAGAAATAAAAAATTCGAAGCATAACACACCAAGAAAAAAACAAGAGGAAGAACAAGATAGAAAGGGT
AGCCATACTGATTTGGAAAGCATTAATGAAAATTTAGTTGAAAGTGCATTGAGAAGAGTAAACAGAGAAGAAAAAGGTAATAAGTCAGTC
CATCTGAGGAAAGCCAGTTCACCAAATCTTCATAGACGACAGTGGGAGAAAAATGTACCCAATACAGCTCTTACAGCTTTGGAAAATGCA
TCCATACTCACCTCCAGTTTAACAGCAGAGGACGATAGAGGTGGTTCTGTAATAAAGTACAGCAAAAATACTACTCGTAAGCAGTGGCTC
AAAGAGACCCCTGACACTTTGTTGAACATCCTTAAGAATGCTGATCTCAGCTTGGCTTTTCAAACATACACAATATATAGACCAGGTTCA
GAAGGGTTCTTGAAAGGCCCCCTGTCTGAAGAAACAGAAGCATCGGACAGTGTTGATGGAGGTCACGATTCTGTCATTTTGGATCCAGAG
CGACTTGAGCCTGGGCTAGATGAGGAGGACACGGACTTTGAGGAGGAAGATGACAACCCCGACTGGGTGTCAGAGCTGAAGAAGCGAGCT

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_NEK3_ENST00000400357_chr13_52719026_-_1467nt
ATGAAGCTCCGCAGCAAGGCGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCT
GAGCCCCCAGCGCTGCCCGCGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTC
CCCGGGGCCAGCCCGGGAGTTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTG
GCGAGGAGGCCTGGAGAACCCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGG
CTGGAGGAGACGCTGGTCATGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAG
CCCGAGTTTGATAAGCAGTTACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGA
AACCCTCAGGAGTGGAAGAAATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGTTTCAGGCAAATAGTTGGAAAAATCTTATC
CTCAAAGTATGTCAAGGGTGCATCAGTCCACTGCCGTCTCATTACTCCTATGAACTTCAGTTCCTAGTCAAGCAGATGTTTAAAAGGAAT
CCCTCACATCGCCCCTCGGCTACAACGCTTCTCTCTCGAGGCATCGTAGCTCGGCTTGTCCAGAAGTGCTTACCCCCCGAGATCATCATG
GAATATGGTGAGGAAGTATTAGAAGAAATAAAAAATTCGAAGCATAACACACCAAGAAAAAAACAAGAGGAAGAACAAGATAGAAAGGGT
AGCCATACTGATTTGGAAAGCATTAATGAAAATTTAGTTGAAAGTGCATTGAGAAGAGTAAACAGAGAAGAAAAAGGTAATAAGTCAGTC
CATCTGAGGAAAGCCAGTTCACCAAATCTTCATAGACGACAGTGGGAGAAAAATGTACCCAATACAGCTCTTACAGCTTTGGAAAATGCA
TCCATACTCACCTCCAGTTTAACAGCAGAGGACGATAGAGGTGGTTCTGTAATAAAGTACAGCAAAAATACTACTCGTAAGCAGTGGCTC
AAAGAGACCCCTGACACTTTGTTGAACATCCTTAAGAATGCTGATCTCAGCTTGGCTTTTCAAACATACACAATATATAGACCAGGTTCA
GAAGGGTTCTTGAAAGGCCCCCTGTCTGAAGAAACAGAAGCATCGGACAGTGTTGATGGAGGTCACGATTCTGTCATTTTGGATCCAGAG
CGACTTGAGCCTGGGCTAGATGAGGAGGACACGGACTTTGAGGAGGAAGATGACAACCCCGACTGGGTGTCAGAGCTGAAGAAGCGAGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_NEK3_ENST00000378101_chr13_52719026_-_2178nt
GTCGCCGCCGCCGCCGGCCGCCCGCCGGCCGCCACGACCCCAGTCCCCGGCGGGCGGGCGGAGGAGGCGACCGCCGCGCGCTGCTGCACT
CATCCTGCCGCCGCCGCGATGCGCAGAGGGGCCGAGCCGCCTGGGGGCCGCCGCCGCCGCCGCGCCGCACCATGAAGCTCCGCAGCAAGG
CGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCTGAGCCCCCAGCGCTGCCCG
CGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTCCCCGGGGCCAGCCCGGGAG
TTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTGGCGAGGAGGCCTGGAGAAC
CCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGGCTGGAGGAGACGCTGGTCA
TGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAGCCCGAGTTTGATAAGCAGT
TACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGAAACCCTCAGGAGTGGAAGA
AATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGTTTCAGGCAAATAGTTGGAAAAATCTTATCCTCAAAGTATGTCAAGGGT
GCATCAGTCCACTGCCGTCTCATTACTCCTATGAACTTCAGTTCCTAGTCAAGCAGATGTTTAAAAGGAATCCCTCACATCGCCCCTCGG
CTACAACGCTTCTCTCTCGAGGCATCGTAGCTCGGCTTGTCCAGAAGTGCTTACCCCCCGAGATCATCATGGAATATGGTGAGGAAGTAT
TAGAAGAAATAAAAAATTCGAAGCATAACACACCAAGAAAAAAAGCAAACCCCAGCAGAATCAGGATAGCTTTGGGAAATGAAGCAAGCA
CAGTGCAAGAGGAAGAACAAGATAGAAAGGGTAGCCATACTGATTTGGAAAGCATTAATGAAAATTTAGTTGAAAGTGCATTGAGAAGAG
TAAACAGAGAAGAAAAAGGTAATAAGTCAGTCCATCTGAGGAAAGCCAGTTCACCAAATCTTCATAGACGACAGTGGGAGAAAAATGTAC
CCAATACAGCTCTTACAGCTTTGGAAAATGCATCCATACTCACCTCCAGTTTAACAGCAGAGGACGATAGAGGTGGTTCTGTAATAAAGT
ACAGCAAAAATACTACTCGTAAGCAGTGGCTCAAAGAGACCCCTGACACTTTGTTGAACATCCTTAAGAATGCTGATCTCAGCTTGGCTT
TTCAAACATACACAATATATAGACCAGGTTCAGAAGGGTTCTTGAAAGGCCCCCTGTCTGAAGAAACAGAAGCATCGGACAGTGTTGATG
GAGGTCACGATTCTGTCATTTTGGATCCAGAGCGACTTGAGCCTGGGCTAGATGAGGAGGACACGGACTTTGAGGAGGAAGATGACAACC
CCGACTGGGTGTCAGAGCTGAAGAAGCGAGCTGGATGGCAAGGCCTGTGCGACAGATAATGCCTGAGGAAATGTTCCTGAGTCACGCTGA
GGAGAGGCTTCACTCAGGAGTTCATGCTGAGATGATCATGAGTTCATGCGACGTATATTTTCCTTTGGAAACAGAATGAAGCAGAGGAAA
CTCTTAATACTTAAAATCGTTCTTGATTAGTATCGTGAGTTTGAAAAGTCTAGAACTCCTGTAAGTTTTTGAACTCAAGGGAGAAGGTAT
AGTGGAATGAGTGTGAGCATCGGGCTTTGCAGTCCCATAGAACAGAAATGGGATGCTAGCGTGCCACTACCTACTTGTGTGATTGTGGGA
AATTACTTAACCTCTTCAAGCCCCAATTTCCTCAACCATAAAATGAAGATAATAATGCCTACCTCAGAGGGATGCTGACCACAGACCTTT
ATAGCAGCCCGTATGATATTATTCACATTATGATATGTGTTTATTATTATGTGACTCTTTTTACATTTCCTAAAGGTTTGAGAATTAAAT

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_NEK3_ENST00000339406_chr13_52719026_-_2178nt
GTCGCCGCCGCCGCCGGCCGCCCGCCGGCCGCCACGACCCCAGTCCCCGGCGGGCGGGCGGAGGAGGCGACCGCCGCGCGCTGCTGCACT
CATCCTGCCGCCGCCGCGATGCGCAGAGGGGCCGAGCCGCCTGGGGGCCGCCGCCGCCGCCGCGCCGCACCATGAAGCTCCGCAGCAAGG
CGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCTGAGCCCCCAGCGCTGCCCG
CGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTCCCCGGGGCCAGCCCGGGAG
TTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTGGCGAGGAGGCCTGGAGAAC
CCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGGCTGGAGGAGACGCTGGTCA
TGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAGCCCGAGTTTGATAAGCAGT
TACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGAAACCCTCAGGAGTGGAAGA
AATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGTTTCAGGCAAATAGTTGGAAAAATCTTATCCTCAAAGTATGTCAAGGGT
GCATCAGTCCACTGCCGTCTCATTACTCCTATGAACTTCAGTTCCTAGTCAAGCAGATGTTTAAAAGGAATCCCTCACATCGCCCCTCGG
CTACAACGCTTCTCTCTCGAGGCATCGTAGCTCGGCTTGTCCAGAAGTGCTTACCCCCCGAGATCATCATGGAATATGGTGAGGAAGTAT
TAGAAGAAATAAAAAATTCGAAGCATAACACACCAAGAAAAAAAGCAAACCCCAGCAGAATCAGGATAGCTTTGGGAAATGAAGCAAGCA
CAGTGCAAGAGGAAGAACAAGATAGAAAGGGTAGCCATACTGATTTGGAAAGCATTAATGAAAATTTAGTTGAAAGTGCATTGAGAAGAG
TAAACAGAGAAGAAAAAGGTAATAAGTCAGTCCATCTGAGGAAAGCCAGTTCACCAAATCTTCATAGACGACAGTGGGAGAAAAATGTAC
CCAATACAGCTCTTACAGCTTTGGAAAATGCATCCATACTCACCTCCAGTTTAACAGCAGAGGACGATAGAGGTGGTTCTGTAATAAAGT
ACAGCAAAAATACTACTCGTAAGCAGTGGCTCAAAGAGACCCCTGACACTTTGTTGAACATCCTTAAGAATGCTGATCTCAGCTTGGCTT
TTCAAACATACACAATATATAGACCAGGTTCAGAAGGGTTCTTGAAAGGCCCCCTGTCTGAAGAAACAGAAGCATCGGACAGTGTTGATG
GAGGTCACGATTCTGTCATTTTGGATCCAGAGCGACTTGAGCCTGGGCTAGATGAGGAGGACACGGACTTTGAGGAGGAAGATGACAACC
CCGACTGGGTGTCAGAGCTGAAGAAGCGAGCTGGATGGCAAGGCCTGTGCGACAGATAATGCCTGAGGAAATGTTCCTGAGTCACGCTGA
GGAGAGGCTTCACTCAGGAGTTCATGCTGAGATGATCATGAGTTCATGCGACGTATATTTTCCTTTGGAAACAGAATGAAGCAGAGGAAA
CTCTTAATACTTAAAATCGTTCTTGATTAGTATCGTGAGTTTGAAAAGTCTAGAACTCCTGTAAGTTTTTGAACTCAAGGGAGAAGGTAT
AGTGGAATGAGTGTGAGCATCGGGCTTTGCAGTCCCATAGAACAGAAATGGGATGCTAGCGTGCCACTACCTACTTGTGTGATTGTGGGA
AATTACTTAACCTCTTCAAGCCCCAATTTCCTCAACCATAAAATGAAGATAATAATGCCTACCTCAGAGGGATGCTGACCACAGACCTTT
ATAGCAGCCCGTATGATATTATTCACATTATGATATGTGTTTATTATTATGTGACTCTTTTTACATTTCCTAAAGGTTTGAGAATTAAAT

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_NEK3_ENST00000452082_chr13_52719026_-_2119nt
GTCGCCGCCGCCGCCGGCCGCCCGCCGGCCGCCACGACCCCAGTCCCCGGCGGGCGGGCGGAGGAGGCGACCGCCGCGCGCTGCTGCACT
CATCCTGCCGCCGCCGCGATGCGCAGAGGGGCCGAGCCGCCTGGGGGCCGCCGCCGCCGCCGCGCCGCACCATGAAGCTCCGCAGCAAGG
CGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCTGAGCCCCCAGCGCTGCCCG
CGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTCCCCGGGGCCAGCCCGGGAG
TTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTGGCGAGGAGGCCTGGAGAAC
CCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGGCTGGAGGAGACGCTGGTCA
TGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAGCCCGAGTTTGATAAGCAGT
TACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGAAACCCTCAGGAGTGGAAGA
AATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGTTTCAGGCAAATAGTTGGAAAAATCTTATCCTCAAAGTATGTCAAGGGT
GCATCAGTCCACTGCCGTCTCATTACTCCTATGAACTTCAGTTCCTAGTCAAGCAGATGTTTAAAAGGAATCCCTCACATCGCCCCTCGG
CTACAACGCTTCTCTCTCGAGGCATCGTAGCTCGGCTTGTCCAGAAGTGCTTACCCCCCGAGATCATCATGGAATATGGTGAGGAAGTAT
TAGAAGAAATAAAAAATTCGAAGCATAACACACCAAGAAAAAAACAAGAGGAAGAACAAGATAGAAAGGGTAGCCATACTGATTTGGAAA
GCATTAATGAAAATTTAGTTGAAAGTGCATTGAGAAGAGTAAACAGAGAAGAAAAAGGTAATAAGTCAGTCCATCTGAGGAAAGCCAGTT
CACCAAATCTTCATAGACGACAGTGGGAGAAAAATGTACCCAATACAGCTCTTACAGCTTTGGAAAATGCATCCATACTCACCTCCAGTT
TAACAGCAGAGGACGATAGAGGTGGTTCTGTAATAAAGTACAGCAAAAATACTACTCGTAAGCAGTGGCTCAAAGAGACCCCTGACACTT
TGTTGAACATCCTTAAGAATGCTGATCTCAGCTTGGCTTTTCAAACATACACAATATATAGACCAGGTTCAGAAGGGTTCTTGAAAGGCC
CCCTGTCTGAAGAAACAGAAGCATCGGACAGTGTTGATGGAGGTCACGATTCTGTCATTTTGGATCCAGAGCGACTTGAGCCTGGGCTAG
ATGAGGAGGACACGGACTTTGAGGAGGAAGATGACAACCCCGACTGGGTGTCAGAGCTGAAGAAGCGAGCTGGATGGCAAGGCCTGTGCG
ACAGATAATGCCTGAGGAAATGTTCCTGAGTCACGCTGAGGAGAGGCTTCACTCAGGAGTTCATGCTGAGATGATCATGAGTTCATGCGA
CGTATATTTTCCTTTGGAAACAGAATGAAGCAGAGGAAACTCTTAATACTTAAAATCGTTCTTGATTAGTATCGTGAGTTTGAAAAGTCT
AGAACTCCTGTAAGTTTTTGAACTCAAGGGAGAAGGTATAGTGGAATGAGTGTGAGCATCGGGCTTTGCAGTCCCATAGAACAGAAATGG
GATGCTAGCGTGCCACTACCTACTTGTGTGATTGTGGGAAATTACTTAACCTCTTCAAGCCCCAATTTCCTCAACCATAAAATGAAGATA
ATAATGCCTACCTCAGAGGGATGCTGACCACAGACCTTTATAGCAGCCCGTATGATATTATTCACATTATGATATGTGTTTATTATTATG

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_NEK3_ENST00000400357_chr13_52719026_-_2119nt
GTCGCCGCCGCCGCCGGCCGCCCGCCGGCCGCCACGACCCCAGTCCCCGGCGGGCGGGCGGAGGAGGCGACCGCCGCGCGCTGCTGCACT
CATCCTGCCGCCGCCGCGATGCGCAGAGGGGCCGAGCCGCCTGGGGGCCGCCGCCGCCGCCGCGCCGCACCATGAAGCTCCGCAGCAAGG
CGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCTGAGCCCCCAGCGCTGCCCG
CGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTCCCCGGGGCCAGCCCGGGAG
TTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTGGCGAGGAGGCCTGGAGAAC
CCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGGCTGGAGGAGACGCTGGTCA
TGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAGCCCGAGTTTGATAAGCAGT
TACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGAAACCCTCAGGAGTGGAAGA
AATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGTTTCAGGCAAATAGTTGGAAAAATCTTATCCTCAAAGTATGTCAAGGGT
GCATCAGTCCACTGCCGTCTCATTACTCCTATGAACTTCAGTTCCTAGTCAAGCAGATGTTTAAAAGGAATCCCTCACATCGCCCCTCGG
CTACAACGCTTCTCTCTCGAGGCATCGTAGCTCGGCTTGTCCAGAAGTGCTTACCCCCCGAGATCATCATGGAATATGGTGAGGAAGTAT
TAGAAGAAATAAAAAATTCGAAGCATAACACACCAAGAAAAAAACAAGAGGAAGAACAAGATAGAAAGGGTAGCCATACTGATTTGGAAA
GCATTAATGAAAATTTAGTTGAAAGTGCATTGAGAAGAGTAAACAGAGAAGAAAAAGGTAATAAGTCAGTCCATCTGAGGAAAGCCAGTT
CACCAAATCTTCATAGACGACAGTGGGAGAAAAATGTACCCAATACAGCTCTTACAGCTTTGGAAAATGCATCCATACTCACCTCCAGTT
TAACAGCAGAGGACGATAGAGGTGGTTCTGTAATAAAGTACAGCAAAAATACTACTCGTAAGCAGTGGCTCAAAGAGACCCCTGACACTT
TGTTGAACATCCTTAAGAATGCTGATCTCAGCTTGGCTTTTCAAACATACACAATATATAGACCAGGTTCAGAAGGGTTCTTGAAAGGCC
CCCTGTCTGAAGAAACAGAAGCATCGGACAGTGTTGATGGAGGTCACGATTCTGTCATTTTGGATCCAGAGCGACTTGAGCCTGGGCTAG
ATGAGGAGGACACGGACTTTGAGGAGGAAGATGACAACCCCGACTGGGTGTCAGAGCTGAAGAAGCGAGCTGGATGGCAAGGCCTGTGCG
ACAGATAATGCCTGAGGAAATGTTCCTGAGTCACGCTGAGGAGAGGCTTCACTCAGGAGTTCATGCTGAGATGATCATGAGTTCATGCGA
CGTATATTTTCCTTTGGAAACAGAATGAAGCAGAGGAAACTCTTAATACTTAAAATCGTTCTTGATTAGTATCGTGAGTTTGAAAAGTCT
AGAACTCCTGTAAGTTTTTGAACTCAAGGGAGAAGGTATAGTGGAATGAGTGTGAGCATCGGGCTTTGCAGTCCCATAGAACAGAAATGG
GATGCTAGCGTGCCACTACCTACTTGTGTGATTGTGGGAAATTACTTAACCTCTTCAAGCCCCAATTTCCTCAACCATAAAATGAAGATA
ATAATGCCTACCTCAGAGGGATGCTGACCACAGACCTTTATAGCAGCCCGTATGATATTATTCACATTATGATATGTGTTTATTATTATG


Top

FusionGenePPI for GXYLT2_NEK3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GXYLT2FBL, SRPK2, MGAT4C, CD70, NEUROG3, HLA-DPA1, SCGB2A2, KCNC4, KLRG2, TRIM25NEK3HDAC6, NMNAT1, BPGM, CDCA8, VSIG4, CDK13, TNFSF8, CPNE2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneNEK3chr3:72971486chr13:52719026ENST00000400357-6141_285201490VAV2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GXYLT2_NEK3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GXYLT2_NEK3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource