FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15428

FusionGeneSummary for GRIK2_GPC1

check button Fusion gene summary
Fusion gene informationFusion gene name: GRIK2_GPC1
Fusion gene ID: 15428
HgeneTgene
Gene symbol

GRIK2

GPC1

Gene ID

2901

2817

Gene nameglutamate ionotropic receptor kainate type subunit 5glypican 1
SynonymsEAA2|GRIK2|GluK5|KA2glypican
Cytomap

19q13.2

2q37.3

Type of geneprotein-codingprotein-coding
Descriptionglutamate receptor ionotropic, kainate 5excitatory amino acid receptor 2glutamate receptor KA2glypican-1glypican proteoglycan 1
Modification date2018052320180522
UniProtAcc

Q13002

P35052

Ensembl transtripts involved in fusion geneENST00000413795, ENST00000369138, 
ENST00000421544, ENST00000358361, 
ENST00000318991, ENST00000369137, 
ENST00000369134, 
ENST00000264039, 
ENST00000466624, 
Fusion gene scores* DoF score7 X 3 X 4=842 X 2 X 2=8
# samples 62
** MAII scorelog2(6/84*10)=-0.485426827170242
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: GRIK2 [Title/Abstract] AND GPC1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneGPC1

GO:0030200

heparan sulfate proteoglycan catabolic process

12732622


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-D3-A2JP-06AGRIK2chr6

101847268

+GPC1chr2

241398447

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000413795ENST00000264039GRIK2chr6

101847268

+GPC1chr2

241398447

+
5CDS-intronENST00000413795ENST00000466624GRIK2chr6

101847268

+GPC1chr2

241398447

+
In-frameENST00000369138ENST00000264039GRIK2chr6

101847268

+GPC1chr2

241398447

+
5CDS-intronENST00000369138ENST00000466624GRIK2chr6

101847268

+GPC1chr2

241398447

+
In-frameENST00000421544ENST00000264039GRIK2chr6

101847268

+GPC1chr2

241398447

+
5CDS-intronENST00000421544ENST00000466624GRIK2chr6

101847268

+GPC1chr2

241398447

+
In-frameENST00000358361ENST00000264039GRIK2chr6

101847268

+GPC1chr2

241398447

+
5CDS-intronENST00000358361ENST00000466624GRIK2chr6

101847268

+GPC1chr2

241398447

+
In-frameENST00000318991ENST00000264039GRIK2chr6

101847268

+GPC1chr2

241398447

+
5CDS-intronENST00000318991ENST00000466624GRIK2chr6

101847268

+GPC1chr2

241398447

+
In-frameENST00000369137ENST00000264039GRIK2chr6

101847268

+GPC1chr2

241398447

+
5CDS-intronENST00000369137ENST00000466624GRIK2chr6

101847268

+GPC1chr2

241398447

+
intron-3CDSENST00000369134ENST00000264039GRIK2chr6

101847268

+GPC1chr2

241398447

+
intron-intronENST00000369134ENST00000466624GRIK2chr6

101847268

+GPC1chr2

241398447

+

Top

FusionProtFeatures for GRIK2_GPC1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GRIK2

Q13002

GPC1

P35052

Cell surface proteoglycan that bears heparan sulfate.Binds, via the heparan sulfate side chains, alpha-4 (V) collagenand participates in Schwann cell myelination (By similarity). Mayact as a catalyst in increasing the rate of conversion of prionprotein PRPN(C) to PRNP(Sc) via associating (via the heparansulfate side chains) with both forms of PRPN, targeting them tolipid rafts and facilitating their interaction. Required forproper skeletal muscle differentiation by sequestering FGF2 inlipid rafts preventing its binding to receptors (FGFRs) andinhibiting the FGF-mediated signaling. {ECO:0000250,ECO:0000269|PubMed:19936054, ECO:0000269|PubMed:21642435}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGRIK2chr6:101847268chr2:241398447ENST00000318991+116516_51838870RegionGlutamate binding
HgeneGRIK2chr6:101847268chr2:241398447ENST00000318991+116689_69038870RegionGlutamate binding
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369137+115516_51838833RegionGlutamate binding
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369137+115689_69038833RegionGlutamate binding
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369138+117516_518381270RegionGlutamate binding
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369138+117689_690381270RegionGlutamate binding
HgeneGRIK2chr6:101847268chr2:241398447ENST00000413795+117516_518381247RegionGlutamate binding
HgeneGRIK2chr6:101847268chr2:241398447ENST00000413795+117689_690381247RegionGlutamate binding
HgeneGRIK2chr6:101847268chr2:241398447ENST00000421544+116516_51838909RegionGlutamate binding
HgeneGRIK2chr6:101847268chr2:241398447ENST00000421544+116689_69038909RegionGlutamate binding
HgeneGRIK2chr6:101847268chr2:241398447ENST00000318991+11632_56138870Topological domainExtracellular
HgeneGRIK2chr6:101847268chr2:241398447ENST00000318991+116583_63538870Topological domainCytoplasmic
HgeneGRIK2chr6:101847268chr2:241398447ENST00000318991+116657_81938870Topological domainExtracellular
HgeneGRIK2chr6:101847268chr2:241398447ENST00000318991+116841_90838870Topological domainCytoplasmic
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369137+11532_56138833Topological domainExtracellular
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369137+115583_63538833Topological domainCytoplasmic
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369137+115657_81938833Topological domainExtracellular
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369137+115841_90838833Topological domainCytoplasmic
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369138+11732_561381270Topological domainExtracellular
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369138+117583_635381270Topological domainCytoplasmic
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369138+117657_819381270Topological domainExtracellular
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369138+117841_908381270Topological domainCytoplasmic
HgeneGRIK2chr6:101847268chr2:241398447ENST00000413795+11732_561381247Topological domainExtracellular
HgeneGRIK2chr6:101847268chr2:241398447ENST00000413795+117583_635381247Topological domainCytoplasmic
HgeneGRIK2chr6:101847268chr2:241398447ENST00000413795+117657_819381247Topological domainExtracellular
HgeneGRIK2chr6:101847268chr2:241398447ENST00000413795+117841_908381247Topological domainCytoplasmic
HgeneGRIK2chr6:101847268chr2:241398447ENST00000421544+11632_56138909Topological domainExtracellular
HgeneGRIK2chr6:101847268chr2:241398447ENST00000421544+116583_63538909Topological domainCytoplasmic
HgeneGRIK2chr6:101847268chr2:241398447ENST00000421544+116657_81938909Topological domainExtracellular
HgeneGRIK2chr6:101847268chr2:241398447ENST00000421544+116841_90838909Topological domainCytoplasmic
HgeneGRIK2chr6:101847268chr2:241398447ENST00000318991+116562_58238870TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000318991+116636_65638870TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000318991+116820_84038870TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369137+115562_58238833TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369137+115636_65638833TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369137+115820_84038833TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369138+117562_582381270TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369138+117636_656381270TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000369138+117820_840381270TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000413795+117562_582381247TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000413795+117636_656381247TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000413795+117820_840381247TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000421544+116562_58238909TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000421544+116636_65638909TransmembraneHelical
HgeneGRIK2chr6:101847268chr2:241398447ENST00000421544+116820_84038909TransmembraneHelical


Top

FusionGeneSequence for GRIK2_GPC1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GRIK2_ENST00000413795_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_542aa
MKIIFPILSNPVFRRTVKLLLCLLWIGTSQGTTHVLRFGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSF
DDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAE
ALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDTCRNVLKGCLANQADLD
AEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTLEK
LVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRL
RSAYNGNDVDFQDASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRW

>In-frame_GRIK2_ENST00000369138_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_542aa
MKIIFPILSNPVFRRTVKLLLCLLWIGTSQGTTHVLRFGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSF
DDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAE
ALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDTCRNVLKGCLANQADLD
AEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTLEK
LVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRL
RSAYNGNDVDFQDASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRW

>In-frame_GRIK2_ENST00000421544_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_542aa
MKIIFPILSNPVFRRTVKLLLCLLWIGTSQGTTHVLRFGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSF
DDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAE
ALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDTCRNVLKGCLANQADLD
AEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTLEK
LVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRL
RSAYNGNDVDFQDASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRW

>In-frame_GRIK2_ENST00000358361_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_542aa
MKIIFPILSNPVFRRTVKLLLCLLWIGTSQGTTHVLRFGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSF
DDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAE
ALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDTCRNVLKGCLANQADLD
AEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTLEK
LVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRL
RSAYNGNDVDFQDASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRW

>In-frame_GRIK2_ENST00000318991_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_542aa
MKIIFPILSNPVFRRTVKLLLCLLWIGTSQGTTHVLRFGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSF
DDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAE
ALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDTCRNVLKGCLANQADLD
AEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTLEK
LVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRL
RSAYNGNDVDFQDASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRW

>In-frame_GRIK2_ENST00000369137_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_542aa
MKIIFPILSNPVFRRTVKLLLCLLWIGTSQGTTHVLRFGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSF
DDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAE
ALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDTCRNVLKGCLANQADLD
AEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTLEK
LVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRL
RSAYNGNDVDFQDASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GRIK2_ENST00000413795_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_1626nt
ATGAAGATTATTTTCCCGATTCTAAGTAATCCAGTCTTCAGGCGCACCGTTAAACTCCTGCTCTGTTTACTGTGGATTGGATATTCTCAA
GGAACCACACATGTATTAAGATTTGGTGAGCACCTGCGGATCTGTCCCCAGGGCTACACCTGCTGCACCAGCGAGATGGAGGAGAACCTG
GCCAACCGCAGCCATGCCGAGCTGGAGACCGCGCTCCGGGACAGCAGCCGCGTCCTGCAGGCCATGCTTGCCACCCAGCTGCGCAGCTTC
GATGACCACTTCCAGCACCTGCTGAACGACTCGGAGCGGACGCTGCAGGCCACCTTCCCCGGCGCCTTCGGAGAGCTGTACACGCAGAAC
GCGAGGGCCTTCCGGGACCTGTACTCAGAGCTGCGCCTGTACTACCGCGGTGCCAACCTGCACCTGGAGGAGACGCTGGCCGAGTTCTGG
GCCCGCCTGCTCGAGCGCCTCTTCAAGCAGCTGCACCCCCAGCTGCTGCTGCCTGATGACTACCTGGACTGCCTGGGCAAGCAGGCCGAG
GCGCTGCGGCCCTTCGGGGAGGCCCCGAGAGAGCTGCGCCTGCGGGCCACCCGTGCCTTCGTGGCTGCTCGCTCCTTTGTGCAGGGCCTG
GGCGTGGCCAGCGACGTGGTCCGGAAAGTGGCTCAGGTCCCCCTGGGCCCGGAGTGCTCGAGAGCTGTCATGAAGCTGGTCTACTGTGCT
CACTGCCTGGGAGTCCCCGGCGCCAGGCCCTGCCCTGACTATTGCCGAAATGTGCTCAAGGGCTGCCTTGCCAACCAGGCCGACCTGGAC
GCCGAGTGGAGGAACCTCCTGGACTCCATGGTGCTCATCACCGACAAGTTCTGGGGTACATCGGGTGTGGAGAGTGTCATCGGCAGCGTG
CACACGTGGCTGGCGGAGGCCATCAACGCCCTCCAGGACAACAGGGACACGCTCACGGCCAAGGTCATCCAGGGCTGCGGGAACCCCAAG
GTCAACCCCCAGGGCCCCGGGCCTGAGGAGAAGCGGCGCCGGGGCAAGCTGGCCCCGCGGGAGAGGCCACCTTCAGGCACGCTGGAGAAG
CTGGTCTCCGAAGCCAAGGCCCAGCTCCGCGACGTCCAGGACTTCTGGATCAGCCTCCCAGGGACACTGTGCAGTGAGAAGATGGCCCTG
AGCACTGCCAGTGATGACCGCTGCTGGAACGGGATGGCCAGAGGCCGGTACCTCCCCGAGGTCATGGGTGACGGCCTGGCCAACCAGATC
AACAACCCCGAGGTGGAGGTGGACATCACCAAGCCGGACATGACCATCCGGCAGCAGATCATGCAGCTGAAGATCATGACCAACCGGCTG
CGCAGCGCCTACAACGGCAACGACGTGGACTTCCAGGACGCCAGTGACGACGGCAGCGGCTCGGGCAGCGGTGATGGCTGTCTGGATGAC
CTCTGCAGCCGGAAGGTCAGCAGGAAGAGCTCCAGCTCCCGGACGCCCTTGACCCATGCCCTCCCAGGCCTGTCAGAGCAGGAAGGACAG
AAGACCTCGGCTGCCAGCTGCCCCCAGCCCCCGACCTTCCTCCTGCCCCTCCTCCTCTTCCTGGCCCTTACAGTAGCCAGGCCCCGGTGG

>In-frame_GRIK2_ENST00000369138_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_1626nt
ATGAAGATTATTTTCCCGATTCTAAGTAATCCAGTCTTCAGGCGCACCGTTAAACTCCTGCTCTGTTTACTGTGGATTGGATATTCTCAA
GGAACCACACATGTATTAAGATTTGGTGAGCACCTGCGGATCTGTCCCCAGGGCTACACCTGCTGCACCAGCGAGATGGAGGAGAACCTG
GCCAACCGCAGCCATGCCGAGCTGGAGACCGCGCTCCGGGACAGCAGCCGCGTCCTGCAGGCCATGCTTGCCACCCAGCTGCGCAGCTTC
GATGACCACTTCCAGCACCTGCTGAACGACTCGGAGCGGACGCTGCAGGCCACCTTCCCCGGCGCCTTCGGAGAGCTGTACACGCAGAAC
GCGAGGGCCTTCCGGGACCTGTACTCAGAGCTGCGCCTGTACTACCGCGGTGCCAACCTGCACCTGGAGGAGACGCTGGCCGAGTTCTGG
GCCCGCCTGCTCGAGCGCCTCTTCAAGCAGCTGCACCCCCAGCTGCTGCTGCCTGATGACTACCTGGACTGCCTGGGCAAGCAGGCCGAG
GCGCTGCGGCCCTTCGGGGAGGCCCCGAGAGAGCTGCGCCTGCGGGCCACCCGTGCCTTCGTGGCTGCTCGCTCCTTTGTGCAGGGCCTG
GGCGTGGCCAGCGACGTGGTCCGGAAAGTGGCTCAGGTCCCCCTGGGCCCGGAGTGCTCGAGAGCTGTCATGAAGCTGGTCTACTGTGCT
CACTGCCTGGGAGTCCCCGGCGCCAGGCCCTGCCCTGACTATTGCCGAAATGTGCTCAAGGGCTGCCTTGCCAACCAGGCCGACCTGGAC
GCCGAGTGGAGGAACCTCCTGGACTCCATGGTGCTCATCACCGACAAGTTCTGGGGTACATCGGGTGTGGAGAGTGTCATCGGCAGCGTG
CACACGTGGCTGGCGGAGGCCATCAACGCCCTCCAGGACAACAGGGACACGCTCACGGCCAAGGTCATCCAGGGCTGCGGGAACCCCAAG
GTCAACCCCCAGGGCCCCGGGCCTGAGGAGAAGCGGCGCCGGGGCAAGCTGGCCCCGCGGGAGAGGCCACCTTCAGGCACGCTGGAGAAG
CTGGTCTCCGAAGCCAAGGCCCAGCTCCGCGACGTCCAGGACTTCTGGATCAGCCTCCCAGGGACACTGTGCAGTGAGAAGATGGCCCTG
AGCACTGCCAGTGATGACCGCTGCTGGAACGGGATGGCCAGAGGCCGGTACCTCCCCGAGGTCATGGGTGACGGCCTGGCCAACCAGATC
AACAACCCCGAGGTGGAGGTGGACATCACCAAGCCGGACATGACCATCCGGCAGCAGATCATGCAGCTGAAGATCATGACCAACCGGCTG
CGCAGCGCCTACAACGGCAACGACGTGGACTTCCAGGACGCCAGTGACGACGGCAGCGGCTCGGGCAGCGGTGATGGCTGTCTGGATGAC
CTCTGCAGCCGGAAGGTCAGCAGGAAGAGCTCCAGCTCCCGGACGCCCTTGACCCATGCCCTCCCAGGCCTGTCAGAGCAGGAAGGACAG
AAGACCTCGGCTGCCAGCTGCCCCCAGCCCCCGACCTTCCTCCTGCCCCTCCTCCTCTTCCTGGCCCTTACAGTAGCCAGGCCCCGGTGG

>In-frame_GRIK2_ENST00000421544_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_1626nt
ATGAAGATTATTTTCCCGATTCTAAGTAATCCAGTCTTCAGGCGCACCGTTAAACTCCTGCTCTGTTTACTGTGGATTGGATATTCTCAA
GGAACCACACATGTATTAAGATTTGGTGAGCACCTGCGGATCTGTCCCCAGGGCTACACCTGCTGCACCAGCGAGATGGAGGAGAACCTG
GCCAACCGCAGCCATGCCGAGCTGGAGACCGCGCTCCGGGACAGCAGCCGCGTCCTGCAGGCCATGCTTGCCACCCAGCTGCGCAGCTTC
GATGACCACTTCCAGCACCTGCTGAACGACTCGGAGCGGACGCTGCAGGCCACCTTCCCCGGCGCCTTCGGAGAGCTGTACACGCAGAAC
GCGAGGGCCTTCCGGGACCTGTACTCAGAGCTGCGCCTGTACTACCGCGGTGCCAACCTGCACCTGGAGGAGACGCTGGCCGAGTTCTGG
GCCCGCCTGCTCGAGCGCCTCTTCAAGCAGCTGCACCCCCAGCTGCTGCTGCCTGATGACTACCTGGACTGCCTGGGCAAGCAGGCCGAG
GCGCTGCGGCCCTTCGGGGAGGCCCCGAGAGAGCTGCGCCTGCGGGCCACCCGTGCCTTCGTGGCTGCTCGCTCCTTTGTGCAGGGCCTG
GGCGTGGCCAGCGACGTGGTCCGGAAAGTGGCTCAGGTCCCCCTGGGCCCGGAGTGCTCGAGAGCTGTCATGAAGCTGGTCTACTGTGCT
CACTGCCTGGGAGTCCCCGGCGCCAGGCCCTGCCCTGACTATTGCCGAAATGTGCTCAAGGGCTGCCTTGCCAACCAGGCCGACCTGGAC
GCCGAGTGGAGGAACCTCCTGGACTCCATGGTGCTCATCACCGACAAGTTCTGGGGTACATCGGGTGTGGAGAGTGTCATCGGCAGCGTG
CACACGTGGCTGGCGGAGGCCATCAACGCCCTCCAGGACAACAGGGACACGCTCACGGCCAAGGTCATCCAGGGCTGCGGGAACCCCAAG
GTCAACCCCCAGGGCCCCGGGCCTGAGGAGAAGCGGCGCCGGGGCAAGCTGGCCCCGCGGGAGAGGCCACCTTCAGGCACGCTGGAGAAG
CTGGTCTCCGAAGCCAAGGCCCAGCTCCGCGACGTCCAGGACTTCTGGATCAGCCTCCCAGGGACACTGTGCAGTGAGAAGATGGCCCTG
AGCACTGCCAGTGATGACCGCTGCTGGAACGGGATGGCCAGAGGCCGGTACCTCCCCGAGGTCATGGGTGACGGCCTGGCCAACCAGATC
AACAACCCCGAGGTGGAGGTGGACATCACCAAGCCGGACATGACCATCCGGCAGCAGATCATGCAGCTGAAGATCATGACCAACCGGCTG
CGCAGCGCCTACAACGGCAACGACGTGGACTTCCAGGACGCCAGTGACGACGGCAGCGGCTCGGGCAGCGGTGATGGCTGTCTGGATGAC
CTCTGCAGCCGGAAGGTCAGCAGGAAGAGCTCCAGCTCCCGGACGCCCTTGACCCATGCCCTCCCAGGCCTGTCAGAGCAGGAAGGACAG
AAGACCTCGGCTGCCAGCTGCCCCCAGCCCCCGACCTTCCTCCTGCCCCTCCTCCTCTTCCTGGCCCTTACAGTAGCCAGGCCCCGGTGG

>In-frame_GRIK2_ENST00000358361_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_1626nt
ATGAAGATTATTTTCCCGATTCTAAGTAATCCAGTCTTCAGGCGCACCGTTAAACTCCTGCTCTGTTTACTGTGGATTGGATATTCTCAA
GGAACCACACATGTATTAAGATTTGGTGAGCACCTGCGGATCTGTCCCCAGGGCTACACCTGCTGCACCAGCGAGATGGAGGAGAACCTG
GCCAACCGCAGCCATGCCGAGCTGGAGACCGCGCTCCGGGACAGCAGCCGCGTCCTGCAGGCCATGCTTGCCACCCAGCTGCGCAGCTTC
GATGACCACTTCCAGCACCTGCTGAACGACTCGGAGCGGACGCTGCAGGCCACCTTCCCCGGCGCCTTCGGAGAGCTGTACACGCAGAAC
GCGAGGGCCTTCCGGGACCTGTACTCAGAGCTGCGCCTGTACTACCGCGGTGCCAACCTGCACCTGGAGGAGACGCTGGCCGAGTTCTGG
GCCCGCCTGCTCGAGCGCCTCTTCAAGCAGCTGCACCCCCAGCTGCTGCTGCCTGATGACTACCTGGACTGCCTGGGCAAGCAGGCCGAG
GCGCTGCGGCCCTTCGGGGAGGCCCCGAGAGAGCTGCGCCTGCGGGCCACCCGTGCCTTCGTGGCTGCTCGCTCCTTTGTGCAGGGCCTG
GGCGTGGCCAGCGACGTGGTCCGGAAAGTGGCTCAGGTCCCCCTGGGCCCGGAGTGCTCGAGAGCTGTCATGAAGCTGGTCTACTGTGCT
CACTGCCTGGGAGTCCCCGGCGCCAGGCCCTGCCCTGACTATTGCCGAAATGTGCTCAAGGGCTGCCTTGCCAACCAGGCCGACCTGGAC
GCCGAGTGGAGGAACCTCCTGGACTCCATGGTGCTCATCACCGACAAGTTCTGGGGTACATCGGGTGTGGAGAGTGTCATCGGCAGCGTG
CACACGTGGCTGGCGGAGGCCATCAACGCCCTCCAGGACAACAGGGACACGCTCACGGCCAAGGTCATCCAGGGCTGCGGGAACCCCAAG
GTCAACCCCCAGGGCCCCGGGCCTGAGGAGAAGCGGCGCCGGGGCAAGCTGGCCCCGCGGGAGAGGCCACCTTCAGGCACGCTGGAGAAG
CTGGTCTCCGAAGCCAAGGCCCAGCTCCGCGACGTCCAGGACTTCTGGATCAGCCTCCCAGGGACACTGTGCAGTGAGAAGATGGCCCTG
AGCACTGCCAGTGATGACCGCTGCTGGAACGGGATGGCCAGAGGCCGGTACCTCCCCGAGGTCATGGGTGACGGCCTGGCCAACCAGATC
AACAACCCCGAGGTGGAGGTGGACATCACCAAGCCGGACATGACCATCCGGCAGCAGATCATGCAGCTGAAGATCATGACCAACCGGCTG
CGCAGCGCCTACAACGGCAACGACGTGGACTTCCAGGACGCCAGTGACGACGGCAGCGGCTCGGGCAGCGGTGATGGCTGTCTGGATGAC
CTCTGCAGCCGGAAGGTCAGCAGGAAGAGCTCCAGCTCCCGGACGCCCTTGACCCATGCCCTCCCAGGCCTGTCAGAGCAGGAAGGACAG
AAGACCTCGGCTGCCAGCTGCCCCCAGCCCCCGACCTTCCTCCTGCCCCTCCTCCTCTTCCTGGCCCTTACAGTAGCCAGGCCCCGGTGG

>In-frame_GRIK2_ENST00000318991_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_1626nt
ATGAAGATTATTTTCCCGATTCTAAGTAATCCAGTCTTCAGGCGCACCGTTAAACTCCTGCTCTGTTTACTGTGGATTGGATATTCTCAA
GGAACCACACATGTATTAAGATTTGGTGAGCACCTGCGGATCTGTCCCCAGGGCTACACCTGCTGCACCAGCGAGATGGAGGAGAACCTG
GCCAACCGCAGCCATGCCGAGCTGGAGACCGCGCTCCGGGACAGCAGCCGCGTCCTGCAGGCCATGCTTGCCACCCAGCTGCGCAGCTTC
GATGACCACTTCCAGCACCTGCTGAACGACTCGGAGCGGACGCTGCAGGCCACCTTCCCCGGCGCCTTCGGAGAGCTGTACACGCAGAAC
GCGAGGGCCTTCCGGGACCTGTACTCAGAGCTGCGCCTGTACTACCGCGGTGCCAACCTGCACCTGGAGGAGACGCTGGCCGAGTTCTGG
GCCCGCCTGCTCGAGCGCCTCTTCAAGCAGCTGCACCCCCAGCTGCTGCTGCCTGATGACTACCTGGACTGCCTGGGCAAGCAGGCCGAG
GCGCTGCGGCCCTTCGGGGAGGCCCCGAGAGAGCTGCGCCTGCGGGCCACCCGTGCCTTCGTGGCTGCTCGCTCCTTTGTGCAGGGCCTG
GGCGTGGCCAGCGACGTGGTCCGGAAAGTGGCTCAGGTCCCCCTGGGCCCGGAGTGCTCGAGAGCTGTCATGAAGCTGGTCTACTGTGCT
CACTGCCTGGGAGTCCCCGGCGCCAGGCCCTGCCCTGACTATTGCCGAAATGTGCTCAAGGGCTGCCTTGCCAACCAGGCCGACCTGGAC
GCCGAGTGGAGGAACCTCCTGGACTCCATGGTGCTCATCACCGACAAGTTCTGGGGTACATCGGGTGTGGAGAGTGTCATCGGCAGCGTG
CACACGTGGCTGGCGGAGGCCATCAACGCCCTCCAGGACAACAGGGACACGCTCACGGCCAAGGTCATCCAGGGCTGCGGGAACCCCAAG
GTCAACCCCCAGGGCCCCGGGCCTGAGGAGAAGCGGCGCCGGGGCAAGCTGGCCCCGCGGGAGAGGCCACCTTCAGGCACGCTGGAGAAG
CTGGTCTCCGAAGCCAAGGCCCAGCTCCGCGACGTCCAGGACTTCTGGATCAGCCTCCCAGGGACACTGTGCAGTGAGAAGATGGCCCTG
AGCACTGCCAGTGATGACCGCTGCTGGAACGGGATGGCCAGAGGCCGGTACCTCCCCGAGGTCATGGGTGACGGCCTGGCCAACCAGATC
AACAACCCCGAGGTGGAGGTGGACATCACCAAGCCGGACATGACCATCCGGCAGCAGATCATGCAGCTGAAGATCATGACCAACCGGCTG
CGCAGCGCCTACAACGGCAACGACGTGGACTTCCAGGACGCCAGTGACGACGGCAGCGGCTCGGGCAGCGGTGATGGCTGTCTGGATGAC
CTCTGCAGCCGGAAGGTCAGCAGGAAGAGCTCCAGCTCCCGGACGCCCTTGACCCATGCCCTCCCAGGCCTGTCAGAGCAGGAAGGACAG
AAGACCTCGGCTGCCAGCTGCCCCCAGCCCCCGACCTTCCTCCTGCCCCTCCTCCTCTTCCTGGCCCTTACAGTAGCCAGGCCCCGGTGG

>In-frame_GRIK2_ENST00000369137_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_1626nt
ATGAAGATTATTTTCCCGATTCTAAGTAATCCAGTCTTCAGGCGCACCGTTAAACTCCTGCTCTGTTTACTGTGGATTGGATATTCTCAA
GGAACCACACATGTATTAAGATTTGGTGAGCACCTGCGGATCTGTCCCCAGGGCTACACCTGCTGCACCAGCGAGATGGAGGAGAACCTG
GCCAACCGCAGCCATGCCGAGCTGGAGACCGCGCTCCGGGACAGCAGCCGCGTCCTGCAGGCCATGCTTGCCACCCAGCTGCGCAGCTTC
GATGACCACTTCCAGCACCTGCTGAACGACTCGGAGCGGACGCTGCAGGCCACCTTCCCCGGCGCCTTCGGAGAGCTGTACACGCAGAAC
GCGAGGGCCTTCCGGGACCTGTACTCAGAGCTGCGCCTGTACTACCGCGGTGCCAACCTGCACCTGGAGGAGACGCTGGCCGAGTTCTGG
GCCCGCCTGCTCGAGCGCCTCTTCAAGCAGCTGCACCCCCAGCTGCTGCTGCCTGATGACTACCTGGACTGCCTGGGCAAGCAGGCCGAG
GCGCTGCGGCCCTTCGGGGAGGCCCCGAGAGAGCTGCGCCTGCGGGCCACCCGTGCCTTCGTGGCTGCTCGCTCCTTTGTGCAGGGCCTG
GGCGTGGCCAGCGACGTGGTCCGGAAAGTGGCTCAGGTCCCCCTGGGCCCGGAGTGCTCGAGAGCTGTCATGAAGCTGGTCTACTGTGCT
CACTGCCTGGGAGTCCCCGGCGCCAGGCCCTGCCCTGACTATTGCCGAAATGTGCTCAAGGGCTGCCTTGCCAACCAGGCCGACCTGGAC
GCCGAGTGGAGGAACCTCCTGGACTCCATGGTGCTCATCACCGACAAGTTCTGGGGTACATCGGGTGTGGAGAGTGTCATCGGCAGCGTG
CACACGTGGCTGGCGGAGGCCATCAACGCCCTCCAGGACAACAGGGACACGCTCACGGCCAAGGTCATCCAGGGCTGCGGGAACCCCAAG
GTCAACCCCCAGGGCCCCGGGCCTGAGGAGAAGCGGCGCCGGGGCAAGCTGGCCCCGCGGGAGAGGCCACCTTCAGGCACGCTGGAGAAG
CTGGTCTCCGAAGCCAAGGCCCAGCTCCGCGACGTCCAGGACTTCTGGATCAGCCTCCCAGGGACACTGTGCAGTGAGAAGATGGCCCTG
AGCACTGCCAGTGATGACCGCTGCTGGAACGGGATGGCCAGAGGCCGGTACCTCCCCGAGGTCATGGGTGACGGCCTGGCCAACCAGATC
AACAACCCCGAGGTGGAGGTGGACATCACCAAGCCGGACATGACCATCCGGCAGCAGATCATGCAGCTGAAGATCATGACCAACCGGCTG
CGCAGCGCCTACAACGGCAACGACGTGGACTTCCAGGACGCCAGTGACGACGGCAGCGGCTCGGGCAGCGGTGATGGCTGTCTGGATGAC
CTCTGCAGCCGGAAGGTCAGCAGGAAGAGCTCCAGCTCCCGGACGCCCTTGACCCATGCCCTCCCAGGCCTGTCAGAGCAGGAAGGACAG
AAGACCTCGGCTGCCAGCTGCCCCCAGCCCCCGACCTTCCTCCTGCCCCTCCTCCTCTTCCTGGCCCTTACAGTAGCCAGGCCCCGGTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_GRIK2_ENST00000413795_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_3902nt
GGAGAGCAGCTATCTCAGTCTTTCTCACTTAATCTTGGCTTCACGTCAGAAGCTGTGCAGCAGTGCAGTAGAATAGGGCCTGGCAAAACC
TTTGCTAGCAAAGCGCCTTTTGTGCCGGGCTGTGGCTCGCTATCGACATCTCGTCCGTTACCAAGGCTGGGTTTCCTACTGATTTCCCTC
CTCCTCTGCTTTCACAGGCTCGCGCGGCCGGACATTGTGGGTGTGCGTGCTGGATTTCTCCCGGATGCTCTCCGACTAACATGGATGTCC
CACCATTCCTTGCAGTGGAAGGTTGTTCCTTGGCGCAGTGAGTGAAGAACATGCAGCGATTGCTAATGGGTTTGGGAAGCGGAGACTCCT
TCCTCTCTCTATGACCATGCCGTGATCGTGTCTGCGGTCACCACTCGACGCATCCTCATTTCTACCCGAACCCAGGAGCCGAACGCTAGA
TCGGGGAAGTGGGTGCCGTGCGTGTGGGCACAGAAACACCATGAAGATTATTTTCCCGATTCTAAGTAATCCAGTCTTCAGGCGCACCGT
TAAACTCCTGCTCTGTTTACTGTGGATTGGATATTCTCAAGGAACCACACATGTATTAAGATTTGGTGAGCACCTGCGGATCTGTCCCCA
GGGCTACACCTGCTGCACCAGCGAGATGGAGGAGAACCTGGCCAACCGCAGCCATGCCGAGCTGGAGACCGCGCTCCGGGACAGCAGCCG
CGTCCTGCAGGCCATGCTTGCCACCCAGCTGCGCAGCTTCGATGACCACTTCCAGCACCTGCTGAACGACTCGGAGCGGACGCTGCAGGC
CACCTTCCCCGGCGCCTTCGGAGAGCTGTACACGCAGAACGCGAGGGCCTTCCGGGACCTGTACTCAGAGCTGCGCCTGTACTACCGCGG
TGCCAACCTGCACCTGGAGGAGACGCTGGCCGAGTTCTGGGCCCGCCTGCTCGAGCGCCTCTTCAAGCAGCTGCACCCCCAGCTGCTGCT
GCCTGATGACTACCTGGACTGCCTGGGCAAGCAGGCCGAGGCGCTGCGGCCCTTCGGGGAGGCCCCGAGAGAGCTGCGCCTGCGGGCCAC
CCGTGCCTTCGTGGCTGCTCGCTCCTTTGTGCAGGGCCTGGGCGTGGCCAGCGACGTGGTCCGGAAAGTGGCTCAGGTCCCCCTGGGCCC
GGAGTGCTCGAGAGCTGTCATGAAGCTGGTCTACTGTGCTCACTGCCTGGGAGTCCCCGGCGCCAGGCCCTGCCCTGACTATTGCCGAAA
TGTGCTCAAGGGCTGCCTTGCCAACCAGGCCGACCTGGACGCCGAGTGGAGGAACCTCCTGGACTCCATGGTGCTCATCACCGACAAGTT
CTGGGGTACATCGGGTGTGGAGAGTGTCATCGGCAGCGTGCACACGTGGCTGGCGGAGGCCATCAACGCCCTCCAGGACAACAGGGACAC
GCTCACGGCCAAGGTCATCCAGGGCTGCGGGAACCCCAAGGTCAACCCCCAGGGCCCCGGGCCTGAGGAGAAGCGGCGCCGGGGCAAGCT
GGCCCCGCGGGAGAGGCCACCTTCAGGCACGCTGGAGAAGCTGGTCTCCGAAGCCAAGGCCCAGCTCCGCGACGTCCAGGACTTCTGGAT
CAGCCTCCCAGGGACACTGTGCAGTGAGAAGATGGCCCTGAGCACTGCCAGTGATGACCGCTGCTGGAACGGGATGGCCAGAGGCCGGTA
CCTCCCCGAGGTCATGGGTGACGGCCTGGCCAACCAGATCAACAACCCCGAGGTGGAGGTGGACATCACCAAGCCGGACATGACCATCCG
GCAGCAGATCATGCAGCTGAAGATCATGACCAACCGGCTGCGCAGCGCCTACAACGGCAACGACGTGGACTTCCAGGACGCCAGTGACGA
CGGCAGCGGCTCGGGCAGCGGTGATGGCTGTCTGGATGACCTCTGCAGCCGGAAGGTCAGCAGGAAGAGCTCCAGCTCCCGGACGCCCTT
GACCCATGCCCTCCCAGGCCTGTCAGAGCAGGAAGGACAGAAGACCTCGGCTGCCAGCTGCCCCCAGCCCCCGACCTTCCTCCTGCCCCT
CCTCCTCTTCCTGGCCCTTACAGTAGCCAGGCCCCGGTGGCGGTAACTGCCCCAAGGCCCCAGGGACAGAGGCCAAGGACTGACTTTGCC
AAAAATACAACACAGACGATATTTAATTCACCTCAGCCTGGAGAGGCCTGGGGTGGGACAGGGAGGGCCGGCGGCTCTGAGCAGGGGCAG
GCGCAGAGGTCCCAGCCCCAGGCCTGGCCTCGCCTGCCTTTCTGCCTTTTAATTTTGTATGAGGTCCTCAGGTCAGCTGGGAGCCAGTGT
GCCCAAAAGCCATGTATTTCAGGGACCTCAGGGGCACCTCCGGCTGCCTAGCCCTCCCCCCAGCTCCCTGCACCGCCGCAGAAGCAGCCC
CTCGAGGCCTACAGAGGAGGCCTCAAAGCAACCCGCTGGAGCCCACAGCGAGCCTGTGCCTTCCTCCCCGCCTCCTCCCACTGGGACTCC
CAGCAGAGCCCACCAGCCAGCCCTGGCCCACCCCCCAGCCTCCAGAGAAGCCCCGCACGGGCTGTCTGGGTGTCCGCCATCCAGGGTCTG
GCAGAGCCTCTGAGATGATGCATGATGCCCTCCCCTCAGCGCAGGCTGCAGAGCCCGGCCCCACCTCCCTGCGCCCTTGAGGGGCCCCAG
CGTCTGCAGGGTGACGCCTGAGACAGCACCACTGCTGAGGAGTCTGAGGACTGTCCTCCCACAGACCTGCAGTGAGGGGCCCTCCATGCG
CAGATGAGGGGCCACTGACCCACCTGCGCTTCTGCTGGAGGAGGGGAAGCTGGGCCCAAAGGCCCAGGGAGGCAGCGTGGGCTCTGCCAA
TGTGGGCTGCCCCTCGCACACAGGGCTCACAGGGCAGGCCTTGCTGGGGTCCAGGGCTGTTGGAGGACCCCGAGGGCTGAGGAGCAGCCA
GGACCCGCCTGCTCCCATCCTCACCCAGATCAGGAACCAGGGCCTCCCTGTTCACGGTGACACAGGTCAGGGCTCAGAGTGACCCTCAGC
TGTCACCTGCTCACAGGGATGCTGGTGGCTGGTGAGACCCCGCACTGCAGACGGGAATGCCTAGGTCCCTTCCCGACCCAGCCAGCTGCA
GGGCACGGGGACCTGGATAGTTAAGGGCTTTTCCAAACATGCATCCATTTACTGACACTTCCTGTCCTTGTTCATGGAGAGCTGTTCGCT
CCTCCCAGATGGCTTCGGAGGGCCGCAGGGCCCACCTTGGACCCTGGTGACCTCCTGTCACTCACTGAGGCCATCAGGGCCCTGCCCCAG
GCCTGGACGGGCCCTCCTTCCCTCCTGTGCCCCAGCTGCCAGGCGGCCCTGGGGAGGGGTGGTGTGGTGTTGGGAAGGGGTCCTGCAGGG
GGAGGAGGACTTGGAGGGTCTGGGGGCAGCTGTCCTGAACCGACTGACCCTGAGGAGGCCGCTTAGTGCTGCTTTGCTTTTCATCACCGT
CCCGCACAGTGGACGGAGGTCCCCGGTTGCTGGTCAGGTCCCCATGGCTTGTTCTCTGGAACCTGACTTTAGATGTTTTGGGATCAGGAG
CCCCCAACACAGGCAAGTCCACCCCATAATAACCCTGCCAGTGCCAGGGTGGGCTGGGGACTCTGGCACAGTGATGCCGGGCGCCAGGAC
AGCAGCACTCCCGCTGCACACAGACGGCCTAGGGGTGGCGCTCAGACCCCACCCTACGCTCATCTCTGGAAGGGGCAGCCCTGAGTGGTC
ACTGGTCAGGGCAGTGGCCAAGCCTGCTGTGTCCTTCCTCCACAAGGTCCCCCCACCGCTCAGTGTCAGCGGGTGACGTGTGTTCTTTTG

>In-frame_GRIK2_ENST00000369138_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_3902nt
GGAGAGCAGCTATCTCAGTCTTTCTCACTTAATCTTGGCTTCACGTCAGAAGCTGTGCAGCAGTGCAGTAGAATAGGGCCTGGCAAAACC
TTTGCTAGCAAAGCGCCTTTTGTGCCGGGCTGTGGCTCGCTATCGACATCTCGTCCGTTACCAAGGCTGGGTTTCCTACTGATTTCCCTC
CTCCTCTGCTTTCACAGGCTCGCGCGGCCGGACATTGTGGGTGTGCGTGCTGGATTTCTCCCGGATGCTCTCCGACTAACATGGATGTCC
CACCATTCCTTGCAGTGGAAGGTTGTTCCTTGGCGCAGTGAGTGAAGAACATGCAGCGATTGCTAATGGGTTTGGGAAGCGGAGACTCCT
TCCTCTCTCTATGACCATGCCGTGATCGTGTCTGCGGTCACCACTCGACGCATCCTCATTTCTACCCGAACCCAGGAGCCGAACGCTAGA
TCGGGGAAGTGGGTGCCGTGCGTGTGGGCACAGAAACACCATGAAGATTATTTTCCCGATTCTAAGTAATCCAGTCTTCAGGCGCACCGT
TAAACTCCTGCTCTGTTTACTGTGGATTGGATATTCTCAAGGAACCACACATGTATTAAGATTTGGTGAGCACCTGCGGATCTGTCCCCA
GGGCTACACCTGCTGCACCAGCGAGATGGAGGAGAACCTGGCCAACCGCAGCCATGCCGAGCTGGAGACCGCGCTCCGGGACAGCAGCCG
CGTCCTGCAGGCCATGCTTGCCACCCAGCTGCGCAGCTTCGATGACCACTTCCAGCACCTGCTGAACGACTCGGAGCGGACGCTGCAGGC
CACCTTCCCCGGCGCCTTCGGAGAGCTGTACACGCAGAACGCGAGGGCCTTCCGGGACCTGTACTCAGAGCTGCGCCTGTACTACCGCGG
TGCCAACCTGCACCTGGAGGAGACGCTGGCCGAGTTCTGGGCCCGCCTGCTCGAGCGCCTCTTCAAGCAGCTGCACCCCCAGCTGCTGCT
GCCTGATGACTACCTGGACTGCCTGGGCAAGCAGGCCGAGGCGCTGCGGCCCTTCGGGGAGGCCCCGAGAGAGCTGCGCCTGCGGGCCAC
CCGTGCCTTCGTGGCTGCTCGCTCCTTTGTGCAGGGCCTGGGCGTGGCCAGCGACGTGGTCCGGAAAGTGGCTCAGGTCCCCCTGGGCCC
GGAGTGCTCGAGAGCTGTCATGAAGCTGGTCTACTGTGCTCACTGCCTGGGAGTCCCCGGCGCCAGGCCCTGCCCTGACTATTGCCGAAA
TGTGCTCAAGGGCTGCCTTGCCAACCAGGCCGACCTGGACGCCGAGTGGAGGAACCTCCTGGACTCCATGGTGCTCATCACCGACAAGTT
CTGGGGTACATCGGGTGTGGAGAGTGTCATCGGCAGCGTGCACACGTGGCTGGCGGAGGCCATCAACGCCCTCCAGGACAACAGGGACAC
GCTCACGGCCAAGGTCATCCAGGGCTGCGGGAACCCCAAGGTCAACCCCCAGGGCCCCGGGCCTGAGGAGAAGCGGCGCCGGGGCAAGCT
GGCCCCGCGGGAGAGGCCACCTTCAGGCACGCTGGAGAAGCTGGTCTCCGAAGCCAAGGCCCAGCTCCGCGACGTCCAGGACTTCTGGAT
CAGCCTCCCAGGGACACTGTGCAGTGAGAAGATGGCCCTGAGCACTGCCAGTGATGACCGCTGCTGGAACGGGATGGCCAGAGGCCGGTA
CCTCCCCGAGGTCATGGGTGACGGCCTGGCCAACCAGATCAACAACCCCGAGGTGGAGGTGGACATCACCAAGCCGGACATGACCATCCG
GCAGCAGATCATGCAGCTGAAGATCATGACCAACCGGCTGCGCAGCGCCTACAACGGCAACGACGTGGACTTCCAGGACGCCAGTGACGA
CGGCAGCGGCTCGGGCAGCGGTGATGGCTGTCTGGATGACCTCTGCAGCCGGAAGGTCAGCAGGAAGAGCTCCAGCTCCCGGACGCCCTT
GACCCATGCCCTCCCAGGCCTGTCAGAGCAGGAAGGACAGAAGACCTCGGCTGCCAGCTGCCCCCAGCCCCCGACCTTCCTCCTGCCCCT
CCTCCTCTTCCTGGCCCTTACAGTAGCCAGGCCCCGGTGGCGGTAACTGCCCCAAGGCCCCAGGGACAGAGGCCAAGGACTGACTTTGCC
AAAAATACAACACAGACGATATTTAATTCACCTCAGCCTGGAGAGGCCTGGGGTGGGACAGGGAGGGCCGGCGGCTCTGAGCAGGGGCAG
GCGCAGAGGTCCCAGCCCCAGGCCTGGCCTCGCCTGCCTTTCTGCCTTTTAATTTTGTATGAGGTCCTCAGGTCAGCTGGGAGCCAGTGT
GCCCAAAAGCCATGTATTTCAGGGACCTCAGGGGCACCTCCGGCTGCCTAGCCCTCCCCCCAGCTCCCTGCACCGCCGCAGAAGCAGCCC
CTCGAGGCCTACAGAGGAGGCCTCAAAGCAACCCGCTGGAGCCCACAGCGAGCCTGTGCCTTCCTCCCCGCCTCCTCCCACTGGGACTCC
CAGCAGAGCCCACCAGCCAGCCCTGGCCCACCCCCCAGCCTCCAGAGAAGCCCCGCACGGGCTGTCTGGGTGTCCGCCATCCAGGGTCTG
GCAGAGCCTCTGAGATGATGCATGATGCCCTCCCCTCAGCGCAGGCTGCAGAGCCCGGCCCCACCTCCCTGCGCCCTTGAGGGGCCCCAG
CGTCTGCAGGGTGACGCCTGAGACAGCACCACTGCTGAGGAGTCTGAGGACTGTCCTCCCACAGACCTGCAGTGAGGGGCCCTCCATGCG
CAGATGAGGGGCCACTGACCCACCTGCGCTTCTGCTGGAGGAGGGGAAGCTGGGCCCAAAGGCCCAGGGAGGCAGCGTGGGCTCTGCCAA
TGTGGGCTGCCCCTCGCACACAGGGCTCACAGGGCAGGCCTTGCTGGGGTCCAGGGCTGTTGGAGGACCCCGAGGGCTGAGGAGCAGCCA
GGACCCGCCTGCTCCCATCCTCACCCAGATCAGGAACCAGGGCCTCCCTGTTCACGGTGACACAGGTCAGGGCTCAGAGTGACCCTCAGC
TGTCACCTGCTCACAGGGATGCTGGTGGCTGGTGAGACCCCGCACTGCAGACGGGAATGCCTAGGTCCCTTCCCGACCCAGCCAGCTGCA
GGGCACGGGGACCTGGATAGTTAAGGGCTTTTCCAAACATGCATCCATTTACTGACACTTCCTGTCCTTGTTCATGGAGAGCTGTTCGCT
CCTCCCAGATGGCTTCGGAGGGCCGCAGGGCCCACCTTGGACCCTGGTGACCTCCTGTCACTCACTGAGGCCATCAGGGCCCTGCCCCAG
GCCTGGACGGGCCCTCCTTCCCTCCTGTGCCCCAGCTGCCAGGCGGCCCTGGGGAGGGGTGGTGTGGTGTTGGGAAGGGGTCCTGCAGGG
GGAGGAGGACTTGGAGGGTCTGGGGGCAGCTGTCCTGAACCGACTGACCCTGAGGAGGCCGCTTAGTGCTGCTTTGCTTTTCATCACCGT
CCCGCACAGTGGACGGAGGTCCCCGGTTGCTGGTCAGGTCCCCATGGCTTGTTCTCTGGAACCTGACTTTAGATGTTTTGGGATCAGGAG
CCCCCAACACAGGCAAGTCCACCCCATAATAACCCTGCCAGTGCCAGGGTGGGCTGGGGACTCTGGCACAGTGATGCCGGGCGCCAGGAC
AGCAGCACTCCCGCTGCACACAGACGGCCTAGGGGTGGCGCTCAGACCCCACCCTACGCTCATCTCTGGAAGGGGCAGCCCTGAGTGGTC
ACTGGTCAGGGCAGTGGCCAAGCCTGCTGTGTCCTTCCTCCACAAGGTCCCCCCACCGCTCAGTGTCAGCGGGTGACGTGTGTTCTTTTG

>In-frame_GRIK2_ENST00000421544_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_3902nt
GGAGAGCAGCTATCTCAGTCTTTCTCACTTAATCTTGGCTTCACGTCAGAAGCTGTGCAGCAGTGCAGTAGAATAGGGCCTGGCAAAACC
TTTGCTAGCAAAGCGCCTTTTGTGCCGGGCTGTGGCTCGCTATCGACATCTCGTCCGTTACCAAGGCTGGGTTTCCTACTGATTTCCCTC
CTCCTCTGCTTTCACAGGCTCGCGCGGCCGGACATTGTGGGTGTGCGTGCTGGATTTCTCCCGGATGCTCTCCGACTAACATGGATGTCC
CACCATTCCTTGCAGTGGAAGGTTGTTCCTTGGCGCAGTGAGTGAAGAACATGCAGCGATTGCTAATGGGTTTGGGAAGCGGAGACTCCT
TCCTCTCTCTATGACCATGCCGTGATCGTGTCTGCGGTCACCACTCGACGCATCCTCATTTCTACCCGAACCCAGGAGCCGAACGCTAGA
TCGGGGAAGTGGGTGCCGTGCGTGTGGGCACAGAAACACCATGAAGATTATTTTCCCGATTCTAAGTAATCCAGTCTTCAGGCGCACCGT
TAAACTCCTGCTCTGTTTACTGTGGATTGGATATTCTCAAGGAACCACACATGTATTAAGATTTGGTGAGCACCTGCGGATCTGTCCCCA
GGGCTACACCTGCTGCACCAGCGAGATGGAGGAGAACCTGGCCAACCGCAGCCATGCCGAGCTGGAGACCGCGCTCCGGGACAGCAGCCG
CGTCCTGCAGGCCATGCTTGCCACCCAGCTGCGCAGCTTCGATGACCACTTCCAGCACCTGCTGAACGACTCGGAGCGGACGCTGCAGGC
CACCTTCCCCGGCGCCTTCGGAGAGCTGTACACGCAGAACGCGAGGGCCTTCCGGGACCTGTACTCAGAGCTGCGCCTGTACTACCGCGG
TGCCAACCTGCACCTGGAGGAGACGCTGGCCGAGTTCTGGGCCCGCCTGCTCGAGCGCCTCTTCAAGCAGCTGCACCCCCAGCTGCTGCT
GCCTGATGACTACCTGGACTGCCTGGGCAAGCAGGCCGAGGCGCTGCGGCCCTTCGGGGAGGCCCCGAGAGAGCTGCGCCTGCGGGCCAC
CCGTGCCTTCGTGGCTGCTCGCTCCTTTGTGCAGGGCCTGGGCGTGGCCAGCGACGTGGTCCGGAAAGTGGCTCAGGTCCCCCTGGGCCC
GGAGTGCTCGAGAGCTGTCATGAAGCTGGTCTACTGTGCTCACTGCCTGGGAGTCCCCGGCGCCAGGCCCTGCCCTGACTATTGCCGAAA
TGTGCTCAAGGGCTGCCTTGCCAACCAGGCCGACCTGGACGCCGAGTGGAGGAACCTCCTGGACTCCATGGTGCTCATCACCGACAAGTT
CTGGGGTACATCGGGTGTGGAGAGTGTCATCGGCAGCGTGCACACGTGGCTGGCGGAGGCCATCAACGCCCTCCAGGACAACAGGGACAC
GCTCACGGCCAAGGTCATCCAGGGCTGCGGGAACCCCAAGGTCAACCCCCAGGGCCCCGGGCCTGAGGAGAAGCGGCGCCGGGGCAAGCT
GGCCCCGCGGGAGAGGCCACCTTCAGGCACGCTGGAGAAGCTGGTCTCCGAAGCCAAGGCCCAGCTCCGCGACGTCCAGGACTTCTGGAT
CAGCCTCCCAGGGACACTGTGCAGTGAGAAGATGGCCCTGAGCACTGCCAGTGATGACCGCTGCTGGAACGGGATGGCCAGAGGCCGGTA
CCTCCCCGAGGTCATGGGTGACGGCCTGGCCAACCAGATCAACAACCCCGAGGTGGAGGTGGACATCACCAAGCCGGACATGACCATCCG
GCAGCAGATCATGCAGCTGAAGATCATGACCAACCGGCTGCGCAGCGCCTACAACGGCAACGACGTGGACTTCCAGGACGCCAGTGACGA
CGGCAGCGGCTCGGGCAGCGGTGATGGCTGTCTGGATGACCTCTGCAGCCGGAAGGTCAGCAGGAAGAGCTCCAGCTCCCGGACGCCCTT
GACCCATGCCCTCCCAGGCCTGTCAGAGCAGGAAGGACAGAAGACCTCGGCTGCCAGCTGCCCCCAGCCCCCGACCTTCCTCCTGCCCCT
CCTCCTCTTCCTGGCCCTTACAGTAGCCAGGCCCCGGTGGCGGTAACTGCCCCAAGGCCCCAGGGACAGAGGCCAAGGACTGACTTTGCC
AAAAATACAACACAGACGATATTTAATTCACCTCAGCCTGGAGAGGCCTGGGGTGGGACAGGGAGGGCCGGCGGCTCTGAGCAGGGGCAG
GCGCAGAGGTCCCAGCCCCAGGCCTGGCCTCGCCTGCCTTTCTGCCTTTTAATTTTGTATGAGGTCCTCAGGTCAGCTGGGAGCCAGTGT
GCCCAAAAGCCATGTATTTCAGGGACCTCAGGGGCACCTCCGGCTGCCTAGCCCTCCCCCCAGCTCCCTGCACCGCCGCAGAAGCAGCCC
CTCGAGGCCTACAGAGGAGGCCTCAAAGCAACCCGCTGGAGCCCACAGCGAGCCTGTGCCTTCCTCCCCGCCTCCTCCCACTGGGACTCC
CAGCAGAGCCCACCAGCCAGCCCTGGCCCACCCCCCAGCCTCCAGAGAAGCCCCGCACGGGCTGTCTGGGTGTCCGCCATCCAGGGTCTG
GCAGAGCCTCTGAGATGATGCATGATGCCCTCCCCTCAGCGCAGGCTGCAGAGCCCGGCCCCACCTCCCTGCGCCCTTGAGGGGCCCCAG
CGTCTGCAGGGTGACGCCTGAGACAGCACCACTGCTGAGGAGTCTGAGGACTGTCCTCCCACAGACCTGCAGTGAGGGGCCCTCCATGCG
CAGATGAGGGGCCACTGACCCACCTGCGCTTCTGCTGGAGGAGGGGAAGCTGGGCCCAAAGGCCCAGGGAGGCAGCGTGGGCTCTGCCAA
TGTGGGCTGCCCCTCGCACACAGGGCTCACAGGGCAGGCCTTGCTGGGGTCCAGGGCTGTTGGAGGACCCCGAGGGCTGAGGAGCAGCCA
GGACCCGCCTGCTCCCATCCTCACCCAGATCAGGAACCAGGGCCTCCCTGTTCACGGTGACACAGGTCAGGGCTCAGAGTGACCCTCAGC
TGTCACCTGCTCACAGGGATGCTGGTGGCTGGTGAGACCCCGCACTGCAGACGGGAATGCCTAGGTCCCTTCCCGACCCAGCCAGCTGCA
GGGCACGGGGACCTGGATAGTTAAGGGCTTTTCCAAACATGCATCCATTTACTGACACTTCCTGTCCTTGTTCATGGAGAGCTGTTCGCT
CCTCCCAGATGGCTTCGGAGGGCCGCAGGGCCCACCTTGGACCCTGGTGACCTCCTGTCACTCACTGAGGCCATCAGGGCCCTGCCCCAG
GCCTGGACGGGCCCTCCTTCCCTCCTGTGCCCCAGCTGCCAGGCGGCCCTGGGGAGGGGTGGTGTGGTGTTGGGAAGGGGTCCTGCAGGG
GGAGGAGGACTTGGAGGGTCTGGGGGCAGCTGTCCTGAACCGACTGACCCTGAGGAGGCCGCTTAGTGCTGCTTTGCTTTTCATCACCGT
CCCGCACAGTGGACGGAGGTCCCCGGTTGCTGGTCAGGTCCCCATGGCTTGTTCTCTGGAACCTGACTTTAGATGTTTTGGGATCAGGAG
CCCCCAACACAGGCAAGTCCACCCCATAATAACCCTGCCAGTGCCAGGGTGGGCTGGGGACTCTGGCACAGTGATGCCGGGCGCCAGGAC
AGCAGCACTCCCGCTGCACACAGACGGCCTAGGGGTGGCGCTCAGACCCCACCCTACGCTCATCTCTGGAAGGGGCAGCCCTGAGTGGTC
ACTGGTCAGGGCAGTGGCCAAGCCTGCTGTGTCCTTCCTCCACAAGGTCCCCCCACCGCTCAGTGTCAGCGGGTGACGTGTGTTCTTTTG

>In-frame_GRIK2_ENST00000358361_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_3897nt
GCAGCTATCTCAGTCTTTCTCACTTAATCTTGGCTTCACGTCAGAAGCTGTGCAGCAGTGCAGTAGAATAGGGCCTGGCAAAACCTTTGC
TAGCAAAGCGCCTTTTGTGCCGGGCTGTGGCTCGCTATCGACATCTCGTCCGTTACCAAGGCTGGGTTTCCTACTGATTTCCCTCCTCCT
CTGCTTTCACAGGCTCGCGCGGCCGGACATTGTGGGTGTGCGTGCTGGATTTCTCCCGGATGCTCTCCGACTAACATGGATGTCCCACCA
TTCCTTGCAGTGGAAGGTTGTTCCTTGGCGCAGTGAGTGAAGAACATGCAGCGATTGCTAATGGGTTTGGGAAGCGGAGACTCCTTCCTC
TCTCTATGACCATGCCGTGATCGTGTCTGCGGTCACCACTCGACGCATCCTCATTTCTACCCGAACCCAGGAGCCGAACGCTAGATCGGG
GAAGTGGGTGCCGTGCGTGTGGGCACAGAAACACCATGAAGATTATTTTCCCGATTCTAAGTAATCCAGTCTTCAGGCGCACCGTTAAAC
TCCTGCTCTGTTTACTGTGGATTGGATATTCTCAAGGAACCACACATGTATTAAGATTTGGTGAGCACCTGCGGATCTGTCCCCAGGGCT
ACACCTGCTGCACCAGCGAGATGGAGGAGAACCTGGCCAACCGCAGCCATGCCGAGCTGGAGACCGCGCTCCGGGACAGCAGCCGCGTCC
TGCAGGCCATGCTTGCCACCCAGCTGCGCAGCTTCGATGACCACTTCCAGCACCTGCTGAACGACTCGGAGCGGACGCTGCAGGCCACCT
TCCCCGGCGCCTTCGGAGAGCTGTACACGCAGAACGCGAGGGCCTTCCGGGACCTGTACTCAGAGCTGCGCCTGTACTACCGCGGTGCCA
ACCTGCACCTGGAGGAGACGCTGGCCGAGTTCTGGGCCCGCCTGCTCGAGCGCCTCTTCAAGCAGCTGCACCCCCAGCTGCTGCTGCCTG
ATGACTACCTGGACTGCCTGGGCAAGCAGGCCGAGGCGCTGCGGCCCTTCGGGGAGGCCCCGAGAGAGCTGCGCCTGCGGGCCACCCGTG
CCTTCGTGGCTGCTCGCTCCTTTGTGCAGGGCCTGGGCGTGGCCAGCGACGTGGTCCGGAAAGTGGCTCAGGTCCCCCTGGGCCCGGAGT
GCTCGAGAGCTGTCATGAAGCTGGTCTACTGTGCTCACTGCCTGGGAGTCCCCGGCGCCAGGCCCTGCCCTGACTATTGCCGAAATGTGC
TCAAGGGCTGCCTTGCCAACCAGGCCGACCTGGACGCCGAGTGGAGGAACCTCCTGGACTCCATGGTGCTCATCACCGACAAGTTCTGGG
GTACATCGGGTGTGGAGAGTGTCATCGGCAGCGTGCACACGTGGCTGGCGGAGGCCATCAACGCCCTCCAGGACAACAGGGACACGCTCA
CGGCCAAGGTCATCCAGGGCTGCGGGAACCCCAAGGTCAACCCCCAGGGCCCCGGGCCTGAGGAGAAGCGGCGCCGGGGCAAGCTGGCCC
CGCGGGAGAGGCCACCTTCAGGCACGCTGGAGAAGCTGGTCTCCGAAGCCAAGGCCCAGCTCCGCGACGTCCAGGACTTCTGGATCAGCC
TCCCAGGGACACTGTGCAGTGAGAAGATGGCCCTGAGCACTGCCAGTGATGACCGCTGCTGGAACGGGATGGCCAGAGGCCGGTACCTCC
CCGAGGTCATGGGTGACGGCCTGGCCAACCAGATCAACAACCCCGAGGTGGAGGTGGACATCACCAAGCCGGACATGACCATCCGGCAGC
AGATCATGCAGCTGAAGATCATGACCAACCGGCTGCGCAGCGCCTACAACGGCAACGACGTGGACTTCCAGGACGCCAGTGACGACGGCA
GCGGCTCGGGCAGCGGTGATGGCTGTCTGGATGACCTCTGCAGCCGGAAGGTCAGCAGGAAGAGCTCCAGCTCCCGGACGCCCTTGACCC
ATGCCCTCCCAGGCCTGTCAGAGCAGGAAGGACAGAAGACCTCGGCTGCCAGCTGCCCCCAGCCCCCGACCTTCCTCCTGCCCCTCCTCC
TCTTCCTGGCCCTTACAGTAGCCAGGCCCCGGTGGCGGTAACTGCCCCAAGGCCCCAGGGACAGAGGCCAAGGACTGACTTTGCCAAAAA
TACAACACAGACGATATTTAATTCACCTCAGCCTGGAGAGGCCTGGGGTGGGACAGGGAGGGCCGGCGGCTCTGAGCAGGGGCAGGCGCA
GAGGTCCCAGCCCCAGGCCTGGCCTCGCCTGCCTTTCTGCCTTTTAATTTTGTATGAGGTCCTCAGGTCAGCTGGGAGCCAGTGTGCCCA
AAAGCCATGTATTTCAGGGACCTCAGGGGCACCTCCGGCTGCCTAGCCCTCCCCCCAGCTCCCTGCACCGCCGCAGAAGCAGCCCCTCGA
GGCCTACAGAGGAGGCCTCAAAGCAACCCGCTGGAGCCCACAGCGAGCCTGTGCCTTCCTCCCCGCCTCCTCCCACTGGGACTCCCAGCA
GAGCCCACCAGCCAGCCCTGGCCCACCCCCCAGCCTCCAGAGAAGCCCCGCACGGGCTGTCTGGGTGTCCGCCATCCAGGGTCTGGCAGA
GCCTCTGAGATGATGCATGATGCCCTCCCCTCAGCGCAGGCTGCAGAGCCCGGCCCCACCTCCCTGCGCCCTTGAGGGGCCCCAGCGTCT
GCAGGGTGACGCCTGAGACAGCACCACTGCTGAGGAGTCTGAGGACTGTCCTCCCACAGACCTGCAGTGAGGGGCCCTCCATGCGCAGAT
GAGGGGCCACTGACCCACCTGCGCTTCTGCTGGAGGAGGGGAAGCTGGGCCCAAAGGCCCAGGGAGGCAGCGTGGGCTCTGCCAATGTGG
GCTGCCCCTCGCACACAGGGCTCACAGGGCAGGCCTTGCTGGGGTCCAGGGCTGTTGGAGGACCCCGAGGGCTGAGGAGCAGCCAGGACC
CGCCTGCTCCCATCCTCACCCAGATCAGGAACCAGGGCCTCCCTGTTCACGGTGACACAGGTCAGGGCTCAGAGTGACCCTCAGCTGTCA
CCTGCTCACAGGGATGCTGGTGGCTGGTGAGACCCCGCACTGCAGACGGGAATGCCTAGGTCCCTTCCCGACCCAGCCAGCTGCAGGGCA
CGGGGACCTGGATAGTTAAGGGCTTTTCCAAACATGCATCCATTTACTGACACTTCCTGTCCTTGTTCATGGAGAGCTGTTCGCTCCTCC
CAGATGGCTTCGGAGGGCCGCAGGGCCCACCTTGGACCCTGGTGACCTCCTGTCACTCACTGAGGCCATCAGGGCCCTGCCCCAGGCCTG
GACGGGCCCTCCTTCCCTCCTGTGCCCCAGCTGCCAGGCGGCCCTGGGGAGGGGTGGTGTGGTGTTGGGAAGGGGTCCTGCAGGGGGAGG
AGGACTTGGAGGGTCTGGGGGCAGCTGTCCTGAACCGACTGACCCTGAGGAGGCCGCTTAGTGCTGCTTTGCTTTTCATCACCGTCCCGC
ACAGTGGACGGAGGTCCCCGGTTGCTGGTCAGGTCCCCATGGCTTGTTCTCTGGAACCTGACTTTAGATGTTTTGGGATCAGGAGCCCCC
AACACAGGCAAGTCCACCCCATAATAACCCTGCCAGTGCCAGGGTGGGCTGGGGACTCTGGCACAGTGATGCCGGGCGCCAGGACAGCAG
CACTCCCGCTGCACACAGACGGCCTAGGGGTGGCGCTCAGACCCCACCCTACGCTCATCTCTGGAAGGGGCAGCCCTGAGTGGTCACTGG
TCAGGGCAGTGGCCAAGCCTGCTGTGTCCTTCCTCCACAAGGTCCCCCCACCGCTCAGTGTCAGCGGGTGACGTGTGTTCTTTTGAGTCC

>In-frame_GRIK2_ENST00000318991_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_3412nt
ATGAAGATTATTTTCCCGATTCTAAGTAATCCAGTCTTCAGGCGCACCGTTAAACTCCTGCTCTGTTTACTGTGGATTGGATATTCTCAA
GGAACCACACATGTATTAAGATTTGGTGAGCACCTGCGGATCTGTCCCCAGGGCTACACCTGCTGCACCAGCGAGATGGAGGAGAACCTG
GCCAACCGCAGCCATGCCGAGCTGGAGACCGCGCTCCGGGACAGCAGCCGCGTCCTGCAGGCCATGCTTGCCACCCAGCTGCGCAGCTTC
GATGACCACTTCCAGCACCTGCTGAACGACTCGGAGCGGACGCTGCAGGCCACCTTCCCCGGCGCCTTCGGAGAGCTGTACACGCAGAAC
GCGAGGGCCTTCCGGGACCTGTACTCAGAGCTGCGCCTGTACTACCGCGGTGCCAACCTGCACCTGGAGGAGACGCTGGCCGAGTTCTGG
GCCCGCCTGCTCGAGCGCCTCTTCAAGCAGCTGCACCCCCAGCTGCTGCTGCCTGATGACTACCTGGACTGCCTGGGCAAGCAGGCCGAG
GCGCTGCGGCCCTTCGGGGAGGCCCCGAGAGAGCTGCGCCTGCGGGCCACCCGTGCCTTCGTGGCTGCTCGCTCCTTTGTGCAGGGCCTG
GGCGTGGCCAGCGACGTGGTCCGGAAAGTGGCTCAGGTCCCCCTGGGCCCGGAGTGCTCGAGAGCTGTCATGAAGCTGGTCTACTGTGCT
CACTGCCTGGGAGTCCCCGGCGCCAGGCCCTGCCCTGACTATTGCCGAAATGTGCTCAAGGGCTGCCTTGCCAACCAGGCCGACCTGGAC
GCCGAGTGGAGGAACCTCCTGGACTCCATGGTGCTCATCACCGACAAGTTCTGGGGTACATCGGGTGTGGAGAGTGTCATCGGCAGCGTG
CACACGTGGCTGGCGGAGGCCATCAACGCCCTCCAGGACAACAGGGACACGCTCACGGCCAAGGTCATCCAGGGCTGCGGGAACCCCAAG
GTCAACCCCCAGGGCCCCGGGCCTGAGGAGAAGCGGCGCCGGGGCAAGCTGGCCCCGCGGGAGAGGCCACCTTCAGGCACGCTGGAGAAG
CTGGTCTCCGAAGCCAAGGCCCAGCTCCGCGACGTCCAGGACTTCTGGATCAGCCTCCCAGGGACACTGTGCAGTGAGAAGATGGCCCTG
AGCACTGCCAGTGATGACCGCTGCTGGAACGGGATGGCCAGAGGCCGGTACCTCCCCGAGGTCATGGGTGACGGCCTGGCCAACCAGATC
AACAACCCCGAGGTGGAGGTGGACATCACCAAGCCGGACATGACCATCCGGCAGCAGATCATGCAGCTGAAGATCATGACCAACCGGCTG
CGCAGCGCCTACAACGGCAACGACGTGGACTTCCAGGACGCCAGTGACGACGGCAGCGGCTCGGGCAGCGGTGATGGCTGTCTGGATGAC
CTCTGCAGCCGGAAGGTCAGCAGGAAGAGCTCCAGCTCCCGGACGCCCTTGACCCATGCCCTCCCAGGCCTGTCAGAGCAGGAAGGACAG
AAGACCTCGGCTGCCAGCTGCCCCCAGCCCCCGACCTTCCTCCTGCCCCTCCTCCTCTTCCTGGCCCTTACAGTAGCCAGGCCCCGGTGG
CGGTAACTGCCCCAAGGCCCCAGGGACAGAGGCCAAGGACTGACTTTGCCAAAAATACAACACAGACGATATTTAATTCACCTCAGCCTG
GAGAGGCCTGGGGTGGGACAGGGAGGGCCGGCGGCTCTGAGCAGGGGCAGGCGCAGAGGTCCCAGCCCCAGGCCTGGCCTCGCCTGCCTT
TCTGCCTTTTAATTTTGTATGAGGTCCTCAGGTCAGCTGGGAGCCAGTGTGCCCAAAAGCCATGTATTTCAGGGACCTCAGGGGCACCTC
CGGCTGCCTAGCCCTCCCCCCAGCTCCCTGCACCGCCGCAGAAGCAGCCCCTCGAGGCCTACAGAGGAGGCCTCAAAGCAACCCGCTGGA
GCCCACAGCGAGCCTGTGCCTTCCTCCCCGCCTCCTCCCACTGGGACTCCCAGCAGAGCCCACCAGCCAGCCCTGGCCCACCCCCCAGCC
TCCAGAGAAGCCCCGCACGGGCTGTCTGGGTGTCCGCCATCCAGGGTCTGGCAGAGCCTCTGAGATGATGCATGATGCCCTCCCCTCAGC
GCAGGCTGCAGAGCCCGGCCCCACCTCCCTGCGCCCTTGAGGGGCCCCAGCGTCTGCAGGGTGACGCCTGAGACAGCACCACTGCTGAGG
AGTCTGAGGACTGTCCTCCCACAGACCTGCAGTGAGGGGCCCTCCATGCGCAGATGAGGGGCCACTGACCCACCTGCGCTTCTGCTGGAG
GAGGGGAAGCTGGGCCCAAAGGCCCAGGGAGGCAGCGTGGGCTCTGCCAATGTGGGCTGCCCCTCGCACACAGGGCTCACAGGGCAGGCC
TTGCTGGGGTCCAGGGCTGTTGGAGGACCCCGAGGGCTGAGGAGCAGCCAGGACCCGCCTGCTCCCATCCTCACCCAGATCAGGAACCAG
GGCCTCCCTGTTCACGGTGACACAGGTCAGGGCTCAGAGTGACCCTCAGCTGTCACCTGCTCACAGGGATGCTGGTGGCTGGTGAGACCC
CGCACTGCAGACGGGAATGCCTAGGTCCCTTCCCGACCCAGCCAGCTGCAGGGCACGGGGACCTGGATAGTTAAGGGCTTTTCCAAACAT
GCATCCATTTACTGACACTTCCTGTCCTTGTTCATGGAGAGCTGTTCGCTCCTCCCAGATGGCTTCGGAGGGCCGCAGGGCCCACCTTGG
ACCCTGGTGACCTCCTGTCACTCACTGAGGCCATCAGGGCCCTGCCCCAGGCCTGGACGGGCCCTCCTTCCCTCCTGTGCCCCAGCTGCC
AGGCGGCCCTGGGGAGGGGTGGTGTGGTGTTGGGAAGGGGTCCTGCAGGGGGAGGAGGACTTGGAGGGTCTGGGGGCAGCTGTCCTGAAC
CGACTGACCCTGAGGAGGCCGCTTAGTGCTGCTTTGCTTTTCATCACCGTCCCGCACAGTGGACGGAGGTCCCCGGTTGCTGGTCAGGTC
CCCATGGCTTGTTCTCTGGAACCTGACTTTAGATGTTTTGGGATCAGGAGCCCCCAACACAGGCAAGTCCACCCCATAATAACCCTGCCA
GTGCCAGGGTGGGCTGGGGACTCTGGCACAGTGATGCCGGGCGCCAGGACAGCAGCACTCCCGCTGCACACAGACGGCCTAGGGGTGGCG
CTCAGACCCCACCCTACGCTCATCTCTGGAAGGGGCAGCCCTGAGTGGTCACTGGTCAGGGCAGTGGCCAAGCCTGCTGTGTCCTTCCTC

>In-frame_GRIK2_ENST00000369137_chr6_101847268_+_GPC1_ENST00000264039_chr2_241398447_+_3412nt
ATGAAGATTATTTTCCCGATTCTAAGTAATCCAGTCTTCAGGCGCACCGTTAAACTCCTGCTCTGTTTACTGTGGATTGGATATTCTCAA
GGAACCACACATGTATTAAGATTTGGTGAGCACCTGCGGATCTGTCCCCAGGGCTACACCTGCTGCACCAGCGAGATGGAGGAGAACCTG
GCCAACCGCAGCCATGCCGAGCTGGAGACCGCGCTCCGGGACAGCAGCCGCGTCCTGCAGGCCATGCTTGCCACCCAGCTGCGCAGCTTC
GATGACCACTTCCAGCACCTGCTGAACGACTCGGAGCGGACGCTGCAGGCCACCTTCCCCGGCGCCTTCGGAGAGCTGTACACGCAGAAC
GCGAGGGCCTTCCGGGACCTGTACTCAGAGCTGCGCCTGTACTACCGCGGTGCCAACCTGCACCTGGAGGAGACGCTGGCCGAGTTCTGG
GCCCGCCTGCTCGAGCGCCTCTTCAAGCAGCTGCACCCCCAGCTGCTGCTGCCTGATGACTACCTGGACTGCCTGGGCAAGCAGGCCGAG
GCGCTGCGGCCCTTCGGGGAGGCCCCGAGAGAGCTGCGCCTGCGGGCCACCCGTGCCTTCGTGGCTGCTCGCTCCTTTGTGCAGGGCCTG
GGCGTGGCCAGCGACGTGGTCCGGAAAGTGGCTCAGGTCCCCCTGGGCCCGGAGTGCTCGAGAGCTGTCATGAAGCTGGTCTACTGTGCT
CACTGCCTGGGAGTCCCCGGCGCCAGGCCCTGCCCTGACTATTGCCGAAATGTGCTCAAGGGCTGCCTTGCCAACCAGGCCGACCTGGAC
GCCGAGTGGAGGAACCTCCTGGACTCCATGGTGCTCATCACCGACAAGTTCTGGGGTACATCGGGTGTGGAGAGTGTCATCGGCAGCGTG
CACACGTGGCTGGCGGAGGCCATCAACGCCCTCCAGGACAACAGGGACACGCTCACGGCCAAGGTCATCCAGGGCTGCGGGAACCCCAAG
GTCAACCCCCAGGGCCCCGGGCCTGAGGAGAAGCGGCGCCGGGGCAAGCTGGCCCCGCGGGAGAGGCCACCTTCAGGCACGCTGGAGAAG
CTGGTCTCCGAAGCCAAGGCCCAGCTCCGCGACGTCCAGGACTTCTGGATCAGCCTCCCAGGGACACTGTGCAGTGAGAAGATGGCCCTG
AGCACTGCCAGTGATGACCGCTGCTGGAACGGGATGGCCAGAGGCCGGTACCTCCCCGAGGTCATGGGTGACGGCCTGGCCAACCAGATC
AACAACCCCGAGGTGGAGGTGGACATCACCAAGCCGGACATGACCATCCGGCAGCAGATCATGCAGCTGAAGATCATGACCAACCGGCTG
CGCAGCGCCTACAACGGCAACGACGTGGACTTCCAGGACGCCAGTGACGACGGCAGCGGCTCGGGCAGCGGTGATGGCTGTCTGGATGAC
CTCTGCAGCCGGAAGGTCAGCAGGAAGAGCTCCAGCTCCCGGACGCCCTTGACCCATGCCCTCCCAGGCCTGTCAGAGCAGGAAGGACAG
AAGACCTCGGCTGCCAGCTGCCCCCAGCCCCCGACCTTCCTCCTGCCCCTCCTCCTCTTCCTGGCCCTTACAGTAGCCAGGCCCCGGTGG
CGGTAACTGCCCCAAGGCCCCAGGGACAGAGGCCAAGGACTGACTTTGCCAAAAATACAACACAGACGATATTTAATTCACCTCAGCCTG
GAGAGGCCTGGGGTGGGACAGGGAGGGCCGGCGGCTCTGAGCAGGGGCAGGCGCAGAGGTCCCAGCCCCAGGCCTGGCCTCGCCTGCCTT
TCTGCCTTTTAATTTTGTATGAGGTCCTCAGGTCAGCTGGGAGCCAGTGTGCCCAAAAGCCATGTATTTCAGGGACCTCAGGGGCACCTC
CGGCTGCCTAGCCCTCCCCCCAGCTCCCTGCACCGCCGCAGAAGCAGCCCCTCGAGGCCTACAGAGGAGGCCTCAAAGCAACCCGCTGGA
GCCCACAGCGAGCCTGTGCCTTCCTCCCCGCCTCCTCCCACTGGGACTCCCAGCAGAGCCCACCAGCCAGCCCTGGCCCACCCCCCAGCC
TCCAGAGAAGCCCCGCACGGGCTGTCTGGGTGTCCGCCATCCAGGGTCTGGCAGAGCCTCTGAGATGATGCATGATGCCCTCCCCTCAGC
GCAGGCTGCAGAGCCCGGCCCCACCTCCCTGCGCCCTTGAGGGGCCCCAGCGTCTGCAGGGTGACGCCTGAGACAGCACCACTGCTGAGG
AGTCTGAGGACTGTCCTCCCACAGACCTGCAGTGAGGGGCCCTCCATGCGCAGATGAGGGGCCACTGACCCACCTGCGCTTCTGCTGGAG
GAGGGGAAGCTGGGCCCAAAGGCCCAGGGAGGCAGCGTGGGCTCTGCCAATGTGGGCTGCCCCTCGCACACAGGGCTCACAGGGCAGGCC
TTGCTGGGGTCCAGGGCTGTTGGAGGACCCCGAGGGCTGAGGAGCAGCCAGGACCCGCCTGCTCCCATCCTCACCCAGATCAGGAACCAG
GGCCTCCCTGTTCACGGTGACACAGGTCAGGGCTCAGAGTGACCCTCAGCTGTCACCTGCTCACAGGGATGCTGGTGGCTGGTGAGACCC
CGCACTGCAGACGGGAATGCCTAGGTCCCTTCCCGACCCAGCCAGCTGCAGGGCACGGGGACCTGGATAGTTAAGGGCTTTTCCAAACAT
GCATCCATTTACTGACACTTCCTGTCCTTGTTCATGGAGAGCTGTTCGCTCCTCCCAGATGGCTTCGGAGGGCCGCAGGGCCCACCTTGG
ACCCTGGTGACCTCCTGTCACTCACTGAGGCCATCAGGGCCCTGCCCCAGGCCTGGACGGGCCCTCCTTCCCTCCTGTGCCCCAGCTGCC
AGGCGGCCCTGGGGAGGGGTGGTGTGGTGTTGGGAAGGGGTCCTGCAGGGGGAGGAGGACTTGGAGGGTCTGGGGGCAGCTGTCCTGAAC
CGACTGACCCTGAGGAGGCCGCTTAGTGCTGCTTTGCTTTTCATCACCGTCCCGCACAGTGGACGGAGGTCCCCGGTTGCTGGTCAGGTC
CCCATGGCTTGTTCTCTGGAACCTGACTTTAGATGTTTTGGGATCAGGAGCCCCCAACACAGGCAAGTCCACCCCATAATAACCCTGCCA
GTGCCAGGGTGGGCTGGGGACTCTGGCACAGTGATGCCGGGCGCCAGGACAGCAGCACTCCCGCTGCACACAGACGGCCTAGGGGTGGCG
CTCAGACCCCACCCTACGCTCATCTCTGGAAGGGGCAGCCCTGAGTGGTCACTGGTCAGGGCAGTGGCCAAGCCTGCTGTGTCCTTCCTC


Top

FusionGenePPI for GRIK2_GPC1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GRIK2SDCBP, PICK1, DLG4, GRIP1, GRID2, DLG1, DLG3, GRIK5, GRIA1, GRIA2, CALCOCO1, TRIM25, PARK2GPC1VEGFA, SLIT2, PFDN5, FGF1, GPR183, PTEN, CAMKV, HADHB, USP3, FANCE, ATP2B4, TMEM245, XYLT2, TMEM214, SPCS2, C4orf26, SEC11A, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GRIK2_GPC1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneGRIK2Q13002DB00849MethylphenobarbitalGlutamate receptor ionotropic, kainate 2small moleculeapproved
HgeneGRIK2Q13002DB01354HeptabarbitalGlutamate receptor ionotropic, kainate 2small moleculeapproved
HgeneGRIK2Q13002DB01355HexobarbitalGlutamate receptor ionotropic, kainate 2small moleculeapproved
HgeneGRIK2Q13002DB00306TalbutalGlutamate receptor ionotropic, kainate 2small moleculeapproved|illicit
HgeneGRIK2Q13002DB01351AmobarbitalGlutamate receptor ionotropic, kainate 2small moleculeapproved|illicit
HgeneGRIK2Q13002DB01352AprobarbitalGlutamate receptor ionotropic, kainate 2small moleculeapproved|illicit
HgeneGRIK2Q13002DB01353ButethalGlutamate receptor ionotropic, kainate 2small moleculeapproved|illicit
HgeneGRIK2Q13002DB01174PhenobarbitalGlutamate receptor ionotropic, kainate 2small moleculeapproved|investigational
HgeneGRIK2Q13002DB00312PentobarbitalGlutamate receptor ionotropic, kainate 2small moleculeapproved|investigational|vet_approved
HgeneGRIK2Q13002DB00142Glutamic AcidGlutamate receptor ionotropic, kainate 2small moleculeapproved|nutraceutical
HgeneGRIK2Q13002DB00418SecobarbitalGlutamate receptor ionotropic, kainate 2small moleculeapproved|vet_approved
HgeneGRIK2Q13002DB00599ThiopentalGlutamate receptor ionotropic, kainate 2small moleculeapproved|vet_approved
HgeneGRIK2Q13002DB00794PrimidoneGlutamate receptor ionotropic, kainate 2small moleculeapproved|vet_approved

Top

RelatedDiseases for GRIK2_GPC1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGRIK2C0005586Bipolar Disorder3CTD_human;PSYGENET
HgeneGRIK2C0004352Autistic Disorder2CTD_human
HgeneGRIK2C0033953Psychosexual Disorders1CTD_human
HgeneGRIK2C0036341Schizophrenia1CTD_human
HgeneGRIK2C0236969Substance-Related Disorders1CTD_human
HgeneGRIK2C0525045Mood Disorders1PSYGENET