FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15418

FusionGeneSummary for GRID1_CXCL12

check button Fusion gene summary
Fusion gene informationFusion gene name: GRID1_CXCL12
Fusion gene ID: 15418
HgeneTgene
Gene symbol

GRID1

CXCL12

Gene ID

2894

6387

Gene nameglutamate ionotropic receptor delta type subunit 1C-X-C motif chemokine ligand 12
SynonymsGluD1IRH|PBSF|SCYB12|SDF1|TLSF|TPAR1
Cytomap

10q23.1-q23.2

10q11.21

Type of geneprotein-codingprotein-coding
Descriptionglutamate receptor ionotropic, delta-1gluR delta-1 subunitglutamate receptor delta-1 subunitstromal cell-derived factor 1chemokine (C-X-C motif) ligand 12intercrine reduced in hepatomaspre-B cell growth-stimulating factor
Modification date2018052320180527
UniProtAcc

Q9ULK0

P48061

Ensembl transtripts involved in fusion geneENST00000327946, ENST00000536331, 
ENST00000552278, 
ENST00000395795, 
ENST00000374429, ENST00000395793, 
ENST00000374426, ENST00000343575, 
ENST00000395794, ENST00000496375, 
Fusion gene scores* DoF score6 X 4 X 5=1204 X 2 X 4=32
# samples 64
** MAII scorelog2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: GRID1 [Title/Abstract] AND CXCL12 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCXCL12

GO:0033622

integrin activation

29301984

TgeneCXCL12

GO:0045785

positive regulation of cell adhesion

23620790

TgeneCXCL12

GO:0060326

cell chemotaxis

18308860

TgeneCXCL12

GO:0070098

chemokine-mediated signaling pathway

20388803

TgeneCXCL12

GO:0090026

positive regulation of monocyte chemotaxis

18802065

TgeneCXCL12

GO:1902230

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

20388803

TgeneCXCL12

GO:1903237

negative regulation of leukocyte tethering or rolling

18308860

TgeneCXCL12

GO:2000406

positive regulation of T cell migration

23620790

TgeneCXCL12

GO:2000669

negative regulation of dendritic cell apoptotic process

15059845


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-ER-A19L-06AGRID1chr10

87675943

-CXCL12chr10

44793345

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000327946ENST00000395795GRID1chr10

87675943

-CXCL12chr10

44793345

-
5CDS-intronENST00000327946ENST00000374429GRID1chr10

87675943

-CXCL12chr10

44793345

-
5CDS-intronENST00000327946ENST00000395793GRID1chr10

87675943

-CXCL12chr10

44793345

-
5CDS-intronENST00000327946ENST00000374426GRID1chr10

87675943

-CXCL12chr10

44793345

-
5CDS-intronENST00000327946ENST00000343575GRID1chr10

87675943

-CXCL12chr10

44793345

-
5CDS-intronENST00000327946ENST00000395794GRID1chr10

87675943

-CXCL12chr10

44793345

-
5CDS-intronENST00000327946ENST00000496375GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-3CDSENST00000536331ENST00000395795GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-intronENST00000536331ENST00000374429GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-intronENST00000536331ENST00000395793GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-intronENST00000536331ENST00000374426GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-intronENST00000536331ENST00000343575GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-intronENST00000536331ENST00000395794GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-intronENST00000536331ENST00000496375GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-3CDSENST00000552278ENST00000395795GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-intronENST00000552278ENST00000374429GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-intronENST00000552278ENST00000395793GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-intronENST00000552278ENST00000374426GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-intronENST00000552278ENST00000343575GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-intronENST00000552278ENST00000395794GRID1chr10

87675943

-CXCL12chr10

44793345

-
intron-intronENST00000552278ENST00000496375GRID1chr10

87675943

-CXCL12chr10

44793345

-

Top

FusionProtFeatures for GRID1_CXCL12


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GRID1

Q9ULK0

CXCL12

P48061

Receptor for glutamate. L-glutamate acts as anexcitatory neurotransmitter at many synapses in the centralnervous system. The postsynaptic actions of Glu are mediated by avariety of receptors that are named according to their selectiveagonists.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCXCL12chr10:87675943chr10:44793345ENST00000343575-0329_33-2990RegionReceptor and heparin binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000343575-0339_41-2990RegionNote=Receptor binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000343575-0341_51-2990RegionNote=Heparin binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000343575-0348_50-2990RegionNote=Receptor binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000343575-0360_70-2990RegionNote=Receptor binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000374426-0429_33-13120RegionReceptor and heparin binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000374426-0439_41-13120RegionNote=Receptor binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000374426-0441_51-13120RegionNote=Heparin binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000374426-0448_50-13120RegionNote=Receptor binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000374426-0460_70-13120RegionNote=Receptor binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000374429-0429_33-2994RegionReceptor and heparin binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000374429-0439_41-2994RegionNote=Receptor binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000374429-0441_51-2994RegionNote=Heparin binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000374429-0448_50-2994RegionNote=Receptor binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000374429-0460_70-2994RegionNote=Receptor binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000395794-0429_33-15141RegionReceptor and heparin binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000395794-0439_41-15141RegionNote=Receptor binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000395794-0441_51-15141RegionNote=Heparin binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000395794-0448_50-15141RegionNote=Receptor binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000395794-0460_70-15141RegionNote=Receptor binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGRID1chr10:87675943chr10:44793345ENST00000327946-51621_5622601010Topological domainExtracellular
HgeneGRID1chr10:87675943chr10:44793345ENST00000327946-516584_6372601010Topological domainCytoplasmic
HgeneGRID1chr10:87675943chr10:44793345ENST00000327946-516659_8302601010Topological domainExtracellular
HgeneGRID1chr10:87675943chr10:44793345ENST00000327946-516852_10092601010Topological domainCytoplasmic
HgeneGRID1chr10:87675943chr10:44793345ENST00000327946-516563_5832601010TransmembraneHelical
HgeneGRID1chr10:87675943chr10:44793345ENST00000327946-516638_6582601010TransmembraneHelical
HgeneGRID1chr10:87675943chr10:44793345ENST00000327946-516831_8512601010TransmembraneHelical
TgeneCXCL12chr10:87675943chr10:44793345ENST00000395795-2429_338891RegionReceptor and heparin binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000395795-2439_418891RegionNote=Receptor binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000395795-2441_518891RegionNote=Heparin binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000395795-2448_508891RegionNote=Receptor binding
TgeneCXCL12chr10:87675943chr10:44793345ENST00000395795-2460_708891RegionNote=Receptor binding


Top

FusionGeneSequence for GRID1_CXCL12


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GRID1_ENST00000327946_chr10_87675943_-_CXCL12_ENST00000395795_chr10_44793345_-_262aa
MEALTLWLLPWICQCVSVRADSIIHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKITYSIKVIEANNPFQAVQEACDLMTQGILAL
VTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSETDIRGLQS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GRID1_ENST00000327946_chr10_87675943_-_CXCL12_ENST00000395795_chr10_44793345_-_787nt
ATGGAAGCGCTGACGCTGTGGCTTCTCCCCTGGATATGCCAGTGCGTGTCGGTGCGGGCCGACTCCATCATCCACATCGGTGCCATCTTC
GAGGAGAACGCGGCCAAGGACGACAGGGTGTTCCAGTTGGCGGTATCCGACCTGAGCCTCAACGATGACATCCTGCAGAGCGAGAAGATC
ACCTACTCCATCAAGGTCATCGAGGCCAACAACCCATTCCAGGCTGTGCAGGAAGCCTGTGACCTCATGACCCAGGGGATTTTGGCCTTG
GTCACGTCCACTGGCTGTGCATCTGCCAATGCCCTGCAGTCCCTCACGGATGCCATGCACATCCCACACCTCTTTGTCCAGCGCAACCCG
GGAGGGTCGCCACGCACCGCATGCCACCTGAACCCCAGCCCCGATGGTGAGGCCTACACACTGGCTTCGAGACCACCCGTCCGCCTCAAT
GATGTCATGCTCAGGCTGGTGACGGAGCTGCGCTGGCAGAAGTTCGTCATGTTCTACGACAGCGAGTATGATATCCGTGGGCTTCAAAGC
TTTCTGGACCAGGCCTCGCGGCTGGGCCTTGACGTCTCTTTACAAAAGGTGGACAAGAACATTAGCCACGTATTCACCAGCCTCTTCACC
ACGATGAAGACAGAGGAGCTGAATCGCTACCGGGACACGCTTCGCCGCGCCATCCTGCTGCTCAGCCCACAGGGAGCCCACTCCTTCATC


* Fusion transcript sequences (Full-length transcript).
>In-frame_GRID1_ENST00000327946_chr10_87675943_-_CXCL12_ENST00000395795_chr10_44793345_-_1174nt
ACTGCACCGGGACCAGCGCCTCCCCGCTTCGCGCTGCCCTCGGCCTCGCCCCGGGCCCGGGTGGATGAGCCGCGCGCCCGGGGGACATGG
AAGCGCTGACGCTGTGGCTTCTCCCCTGGATATGCCAGTGCGTGTCGGTGCGGGCCGACTCCATCATCCACATCGGTGCCATCTTCGAGG
AGAACGCGGCCAAGGACGACAGGGTGTTCCAGTTGGCGGTATCCGACCTGAGCCTCAACGATGACATCCTGCAGAGCGAGAAGATCACCT
ACTCCATCAAGGTCATCGAGGCCAACAACCCATTCCAGGCTGTGCAGGAAGCCTGTGACCTCATGACCCAGGGGATTTTGGCCTTGGTCA
CGTCCACTGGCTGTGCATCTGCCAATGCCCTGCAGTCCCTCACGGATGCCATGCACATCCCACACCTCTTTGTCCAGCGCAACCCGGGAG
GGTCGCCACGCACCGCATGCCACCTGAACCCCAGCCCCGATGGTGAGGCCTACACACTGGCTTCGAGACCACCCGTCCGCCTCAATGATG
TCATGCTCAGGCTGGTGACGGAGCTGCGCTGGCAGAAGTTCGTCATGTTCTACGACAGCGAGTATGATATCCGTGGGCTTCAAAGCTTTC
TGGACCAGGCCTCGCGGCTGGGCCTTGACGTCTCTTTACAAAAGGTGGACAAGAACATTAGCCACGTATTCACCAGCCTCTTCACCACGA
TGAAGACAGAGGAGCTGAATCGCTACCGGGACACGCTTCGCCGCGCCATCCTGCTGCTCAGCCCACAGGGAGCCCACTCCTTCATCAACG
AGGCCGTGGAGACCAACCTGGCTTCCAAGGACAGCCACTGGGTCTTTGTGAATGAGTTGCTAGAATATGGCTGTACGGCAATGCTGAGAC
ATCACGCTGAGCGAGAGTGGACATCCTCATTTTATTCCTACCCTTACCGTGGATCTCTCCTGTGCTTCACCACTCAGTATAATGCTGGCT
GAGCTCTTCTGACAAATACCTTCCAAGATGTGAGGAAAACACACGTAGGTGCAGTTGTTGAATTGTATGATCTGCCACTGAAGTAATTAG
TGTGATAATTACTTGGATTTTCTCCTTTAACAAATTATTGTTATAAATTATATTAATATATGTCATGCTAATAAATTATTTCCATATTCC


Top

FusionGenePPI for GRID1_CXCL12


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GRID1DEF6, EGFR, TCTN2, HTR3A, HBBCXCL12FN1, CXCL12, PF4, VCAN, CXCR4, DAZAP2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneGRID1chr10:87675943chr10:44793345ENST00000327946-51621_4362601010CBLN1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GRID1_CXCL12


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneGRID1Q9ULK0DB00142Glutamic AcidGlutamate receptor ionotropic, delta-1small moleculeapproved|nutraceutical
TgeneCXCL12P48061DB06822TinzaparinStromal cell-derived factor 1small moleculeapproved

Top

RelatedDiseases for GRID1_CXCL12


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGRID1C0036341Schizophrenia5PSYGENET
HgeneGRID1C0011570Mental Depression3PSYGENET
HgeneGRID1C0011581Depressive disorder3PSYGENET
HgeneGRID1C0005586Bipolar Disorder1PSYGENET
HgeneGRID1C0009404Colorectal Neoplasms1CTD_human
TgeneCXCL12C0027626Neoplasm Invasiveness3CTD_human
TgeneCXCL12C0027627Neoplasm Metastasis2CTD_human
TgeneCXCL12C0022116Ischemia1CTD_human
TgeneCXCL12C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneCXCL12C0033578Prostatic Neoplasms1CTD_human
TgeneCXCL12C0266929Chronic Periodontitis1CTD_human
TgeneCXCL12C0345967Malignant mesothelioma1CTD_human
TgeneCXCL12C1458155Mammary Neoplasms1CTD_human
TgeneCXCL12C1956346Coronary Artery Disease1CTD_human
TgeneCXCL12C2239176Liver carcinoma1CTD_human