FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15312

FusionGeneSummary for GPSM1_NUP214

check button Fusion gene summary
Fusion gene informationFusion gene name: GPSM1_NUP214
Fusion gene ID: 15312
HgeneTgene
Gene symbol

GPSM1

NUP214

Gene ID

26086

8021

Gene nameG protein signaling modulator 1nucleoporin 214
SynonymsAGS3CAIN|CAN
Cytomap

9q34.3

9q34.13

Type of geneprotein-codingprotein-coding
DescriptionG-protein-signaling modulator 1G-protein signalling modulator 1 (AGS3-like, C. elegans)activator of G-protein signaling 3nuclear pore complex protein Nup214CAN protein, putative oncogenenucleoporin 214kDa
Modification date2018051920180523
UniProtAcc

Q86YR5

P35658

Ensembl transtripts involved in fusion geneENST00000392945, ENST00000440944, 
ENST00000429455, ENST00000392944, 
ENST00000359428, ENST00000411637, 
ENST00000451030, ENST00000483497, 
ENST00000465486, 
Fusion gene scores* DoF score1 X 2 X 1=26 X 7 X 4=168
# samples 17
** MAII scorelog2(1/2*10)=2.32192809488736log2(7/168*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: GPSM1 [Title/Abstract] AND NUP214 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneGPSM1

GO:0016239

positive regulation of macroautophagy

12642577

HgeneGPSM1

GO:0034260

negative regulation of GTPase activity

11024022

HgeneGPSM1

GO:1905098

negative regulation of guanyl-nucleotide exchange factor activity

11024022


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-HT-7873-01BGPSM1chr9

139251002

+NUP214chr9

134002911

+
TCGALDLGGTCGA-HT-7873-01BGPSM1chr9

139252661

+NUP214chr9

134002911

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000392945ENST00000359428GPSM1chr9

139251002

+NUP214chr9

134002911

+
intron-3CDSENST00000392945ENST00000411637GPSM1chr9

139251002

+NUP214chr9

134002911

+
intron-3CDSENST00000392945ENST00000451030GPSM1chr9

139251002

+NUP214chr9

134002911

+
intron-intronENST00000392945ENST00000483497GPSM1chr9

139251002

+NUP214chr9

134002911

+
intron-intronENST00000392945ENST00000465486GPSM1chr9

139251002

+NUP214chr9

134002911

+
In-frameENST00000440944ENST00000359428GPSM1chr9

139251002

+NUP214chr9

134002911

+
In-frameENST00000440944ENST00000411637GPSM1chr9

139251002

+NUP214chr9

134002911

+
In-frameENST00000440944ENST00000451030GPSM1chr9

139251002

+NUP214chr9

134002911

+
5CDS-intronENST00000440944ENST00000483497GPSM1chr9

139251002

+NUP214chr9

134002911

+
5CDS-intronENST00000440944ENST00000465486GPSM1chr9

139251002

+NUP214chr9

134002911

+
In-frameENST00000429455ENST00000359428GPSM1chr9

139251002

+NUP214chr9

134002911

+
In-frameENST00000429455ENST00000411637GPSM1chr9

139251002

+NUP214chr9

134002911

+
In-frameENST00000429455ENST00000451030GPSM1chr9

139251002

+NUP214chr9

134002911

+
5CDS-intronENST00000429455ENST00000483497GPSM1chr9

139251002

+NUP214chr9

134002911

+
5CDS-intronENST00000429455ENST00000465486GPSM1chr9

139251002

+NUP214chr9

134002911

+
In-frameENST00000392944ENST00000359428GPSM1chr9

139251002

+NUP214chr9

134002911

+
In-frameENST00000392944ENST00000411637GPSM1chr9

139251002

+NUP214chr9

134002911

+
In-frameENST00000392944ENST00000451030GPSM1chr9

139251002

+NUP214chr9

134002911

+
5CDS-intronENST00000392944ENST00000483497GPSM1chr9

139251002

+NUP214chr9

134002911

+
5CDS-intronENST00000392944ENST00000465486GPSM1chr9

139251002

+NUP214chr9

134002911

+
intron-3CDSENST00000392945ENST00000359428GPSM1chr9

139252661

+NUP214chr9

134002911

+
intron-3CDSENST00000392945ENST00000411637GPSM1chr9

139252661

+NUP214chr9

134002911

+
intron-3CDSENST00000392945ENST00000451030GPSM1chr9

139252661

+NUP214chr9

134002911

+
intron-intronENST00000392945ENST00000483497GPSM1chr9

139252661

+NUP214chr9

134002911

+
intron-intronENST00000392945ENST00000465486GPSM1chr9

139252661

+NUP214chr9

134002911

+
Frame-shitENST00000440944ENST00000359428GPSM1chr9

139252661

+NUP214chr9

134002911

+
Frame-shitENST00000440944ENST00000411637GPSM1chr9

139252661

+NUP214chr9

134002911

+
Frame-shitENST00000440944ENST00000451030GPSM1chr9

139252661

+NUP214chr9

134002911

+
5CDS-intronENST00000440944ENST00000483497GPSM1chr9

139252661

+NUP214chr9

134002911

+
5CDS-intronENST00000440944ENST00000465486GPSM1chr9

139252661

+NUP214chr9

134002911

+
Frame-shitENST00000429455ENST00000359428GPSM1chr9

139252661

+NUP214chr9

134002911

+
Frame-shitENST00000429455ENST00000411637GPSM1chr9

139252661

+NUP214chr9

134002911

+
Frame-shitENST00000429455ENST00000451030GPSM1chr9

139252661

+NUP214chr9

134002911

+
5CDS-intronENST00000429455ENST00000483497GPSM1chr9

139252661

+NUP214chr9

134002911

+
5CDS-intronENST00000429455ENST00000465486GPSM1chr9

139252661

+NUP214chr9

134002911

+
Frame-shitENST00000392944ENST00000359428GPSM1chr9

139252661

+NUP214chr9

134002911

+
Frame-shitENST00000392944ENST00000411637GPSM1chr9

139252661

+NUP214chr9

134002911

+
Frame-shitENST00000392944ENST00000451030GPSM1chr9

139252661

+NUP214chr9

134002911

+
5CDS-intronENST00000392944ENST00000483497GPSM1chr9

139252661

+NUP214chr9

134002911

+
5CDS-intronENST00000392944ENST00000465486GPSM1chr9

139252661

+NUP214chr9

134002911

+

Top

FusionProtFeatures for GPSM1_NUP214


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GPSM1

Q86YR5

NUP214

P35658

Guanine nucleotide dissociation inhibitor (GDI) whichfunctions as a receptor-independent activator of heterotrimeric G-protein signaling. Keeps G(i/o) alpha subunit in its GDP-boundform thus uncoupling heterotrimeric G-proteins signaling from Gprotein-coupled receptors. Controls spindle orientation andasymmetric cell fate of cerebral cortical progenitors. May also beinvolved in macroautophagy in intestinal cells. May play a role indrug addiction. {ECO:0000269|PubMed:11024022,ECO:0000269|PubMed:12642577}. May serve as a docking site in the receptor-mediatedimport of substrates across the nuclear pore complex.{ECO:0000303|PubMed:8108440}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for GPSM1_NUP214


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GPSM1_ENST00000440944_chr9_139251002_+_NUP214_ENST00000359428_chr9_134002911_+_2683aa
MAGPAPPVADELPGPAARRLYSRMEASCLELALEGERLCKAGDFKTGVAFFEAAVQVGTEDLKTLSAIYSQLGNAYFYLKEHGRALEYHK
HDLLLARTIGDRMGEAKASGNLGNTLKVLGRFDEAAVCCQRHLSIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAANATQDPGHLPPD
VRETLCKASEFYERNLSLVKELGDRAAQGRAYGNLGNTHTLLGNFTEATTFHKERLAIAKEFGDKAAERRAYSNLGNAHVFLGRFDVAAE
YYKKTLQLSRQLRDQAVEAQACYSLGNTYTLLQDYERAAEYHLRHLLIAQELADRVGEGRACWSLGNAYVSMGRPAQALTFAKKHLQISQ
EIGDRHGELTARMNVAQLQLVLGRLTSPAASEKPDLAGTEAQGARPKRTQRLSAETWDLLRLPLEREQNGDSHHSGDWRGPSRDSLPLPV
RSRKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSSDEECFFDLLTKFQSSRMDDQRCPLDDGQAGAAEATAAPTLEDRIAQP
SMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQDFQFRALKKVRIFDSPEELPKER
SSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTF
SNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVTETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQ
TLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPDVVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLS
YIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDSLPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVL
CPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDASAAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSS
LKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVAPSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPP
STSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKSSVLPSPSGRSAQGSSSPVPSMVQKSPR
ITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETT
ESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRH
LLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAK
LSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSL
LPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKN
VPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASG
QFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAP
SGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPV
TSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLS
SATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEAT
PATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFN
QLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQP
GFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQ
ASGFGSSNTGSVFGQAASTGGIVFGQQSSSSSGSVFGSGNTGRGGGFFSGLGGKPSQDAANKNPFSSASGGFGSTATSNTSNLFGNSGAK
TFGGFASSSFGEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSPGFGGVPAFGSAPAFTSPLGSTGGKVFGEGTAA

>In-frame_GPSM1_ENST00000440944_chr9_139251002_+_NUP214_ENST00000411637_chr9_134002911_+_2673aa
MAGPAPPVADELPGPAARRLYSRMEASCLELALEGERLCKAGDFKTGVAFFEAAVQVGTEDLKTLSAIYSQLGNAYFYLKEHGRALEYHK
HDLLLARTIGDRMGEAKASGNLGNTLKVLGRFDEAAVCCQRHLSIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAANATQDPGHLPPD
VRETLCKASEFYERNLSLVKELGDRAAQGRAYGNLGNTHTLLGNFTEATTFHKERLAIAKEFGDKAAERRAYSNLGNAHVFLGRFDVAAE
YYKKTLQLSRQLRDQAVEAQACYSLGNTYTLLQDYERAAEYHLRHLLIAQELADRVGEGRACWSLGNAYVSMGRPAQALTFAKKHLQISQ
EIGDRHGELTARMNVAQLQLVLGRLTSPAASEKPDLAGTEAQGARPKRTQRLSAETWDLLRLPLEREQNGDSHHSGDWRGPSRDSLPLPV
RSRKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSSDEECFFDLLTKFQSSRMDDQRCPLDDGQAGAAEATAAPTLEDRIAQP
SMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQDFQFRALKKVRIFDSPEELPKER
SSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTF
SNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVTETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQ
TLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPDVVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLS
YIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDSLPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVL
CPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDASAAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSS
LKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVAPSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPP
STSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGS
PQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSL
KTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLF
NTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLR
NFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKS
HLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQEL
KNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSP
SGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSS
KLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVA
PPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMS
AGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDAR
TEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAP
SATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQ
PASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASGFGSSNTG
SVFGQAASTGGIVFGQQSSSSSGSVFGSGNTGRGGGFFSGLGGKPSQDAANKNPFSSASGGFGSTATSNTSNLFGNSGAKTFGGFASSSF
GEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSPGFGGVPAFGSAPAFTSPLGSTGGKVFGEGTAAASAGGFGFGS

>In-frame_GPSM1_ENST00000440944_chr9_139251002_+_NUP214_ENST00000451030_chr9_134002911_+_2684aa
MAGPAPPVADELPGPAARRLYSRMEASCLELALEGERLCKAGDFKTGVAFFEAAVQVGTEDLKTLSAIYSQLGNAYFYLKEHGRALEYHK
HDLLLARTIGDRMGEAKASGNLGNTLKVLGRFDEAAVCCQRHLSIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAANATQDPGHLPPD
VRETLCKASEFYERNLSLVKELGDRAAQGRAYGNLGNTHTLLGNFTEATTFHKERLAIAKEFGDKAAERRAYSNLGNAHVFLGRFDVAAE
YYKKTLQLSRQLRDQAVEAQACYSLGNTYTLLQDYERAAEYHLRHLLIAQELADRVGEGRACWSLGNAYVSMGRPAQALTFAKKHLQISQ
EIGDRHGELTARMNVAQLQLVLGRLTSPAASEKPDLAGTEAQGARPKRTQRLSAETWDLLRLPLEREQNGDSHHSGDWRGPSRDSLPLPV
RSRKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSSDEECFFDLLTKFQSSRMDDQRCPLDDGQAGAAEATAAPTLEDRIAQP
SMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQDFQFRALKKVRIFDSPEELPKER
SSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSETGSIIAFFDVRTF
SNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVTETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQ
TLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPDVVMALLPKKEEKHPEIFVNFMEPCTGSCTERQHHYYLS
YIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDSLPMGVVVDTTNQVEITISDEKTLPPAPVLMLLSTDGVL
CPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDASAAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSS
LKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVAPSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPP
STSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSP
RITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKET
TESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQTVKFAVQDVNDVLDLEWDQHLEQKKKQR
HLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPA
KLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPS
LLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLK
NVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSAS
GQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEAIPESSPPSGITSASNTTPGEPAASSSRPVA
PSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPP
VTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLL
SSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEA
TPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAF
NQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQ
PGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFC
QASGFGSSNTGSVFGQAASTGGIVFGQQSSSSSGSVFGSGNTGRGGGFFSGLGGKPSQDAANKNPFSSASGGFGSTATSNTSNLFGNSGA
KTFGGFASSSFGEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSPGFGGVPAFGSAPAFTSPLGSTGGKVFGEGTA

>In-frame_GPSM1_ENST00000429455_chr9_139251002_+_NUP214_ENST00000359428_chr9_134002911_+_2174aa
MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDF
FNMLIKYQDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHH
LALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVTETVKVCA
TLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPDVVMALLP
KKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDSLPMGVVV
DTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDASAAAAPAS
LPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVAPSAASFS
FGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSV
PLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKA
CFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRL
HQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIH
SFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESE
DARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPIS
APQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGP
TPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEA
IPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSL
TSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTN
STVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSV
KKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPG
PSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTA
PGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFG
QSPGFGQGGSVFGGTSAATTTAATSGFSFCQASGFGSSNTGSVFGQAASTGGIVFGQQSSSSSGSVFGSGNTGRGGGFFSGLGGKPSQDA
ANKNPFSSASGGFGSTATSNTSNLFGNSGAKTFGGFASSSFGEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSPG
FGGVPAFGSAPAFTSPLGSTGGKVFGEGTAAASAGGFGFGSSSNTTSFGTLASQNAPTFGSLSQQTSGFGTQSSGFSGFGSGTGGFSFGS

>In-frame_GPSM1_ENST00000429455_chr9_139251002_+_NUP214_ENST00000411637_chr9_134002911_+_2164aa
MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDF
FNMLIKYQDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHH
LALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVTETVKVCA
TLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPDVVMALLP
KKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDSLPMGVVV
DTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDASAAAAPAS
LPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVAPSAASFS
FGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKSSVLPSPS
AGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQVGTSEEM
KMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQTVKFAVQD
VNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFDSDLESLC
NALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESEDARTSCKDDE
AVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPISAPQAAAAAAL
RRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPASGQLSSG
DKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEAIPESSPPSGI
TSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTSTQPTKTSG
VPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTNSTVPPSAPPP
TTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKEPVLAQPA
VSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPGPSAEAAAFGT
VTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGVFGQTTFG
QASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSPGFGQGGS
VFGGTSAATTTAATSGFSFCQASGFGSSNTGSVFGQAASTGGIVFGQQSSSSSGSVFGSGNTGRGGGFFSGLGGKPSQDAANKNPFSSAS
GGFGSTATSNTSNLFGNSGAKTFGGFASSSFGEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSPGFGGVPAFGSA
PAFTSPLGSTGGKVFGEGTAAASAGGFGFGSSSNTTSFGTLASQNAPTFGSLSQQTSGFGTQSSGFSGFGSGTGGFSFGSNNSSVQGFGG

>In-frame_GPSM1_ENST00000429455_chr9_139251002_+_NUP214_ENST00000451030_chr9_134002911_+_2175aa
MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDF
FNMLIKYQDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHH
LALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVTETVKVCA
TLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPDVVMALLP
KKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDSLPMGVVV
DTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDASAAAAPAS
LPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVAPSAASFS
FGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSV
PLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSK
ACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRR
LHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSI
HSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLES
EDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPI
SAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSG
PTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTE
AIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTS
LTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQT
NSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDS
VKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAP
GPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTT
APGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAF
GQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASGFGSSNTGSVFGQAASTGGIVFGQQSSSSSGSVFGSGNTGRGGGFFSGLGGKPSQD
AANKNPFSSASGGFGSTATSNTSNLFGNSGAKTFGGFASSSFGEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSP
GFGGVPAFGSAPAFTSPLGSTGGKVFGEGTAAASAGGFGFGSSSNTTSFGTLASQNAPTFGSLSQQTSGFGTQSSGFSGFGSGTGGFSFG

>In-frame_GPSM1_ENST00000392944_chr9_139251002_+_NUP214_ENST00000359428_chr9_134002911_+_2174aa
MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDF
FNMLIKYQDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHH
LALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVTETVKVCA
TLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPDVVMALLP
KKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDSLPMGVVV
DTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDASAAAAPAS
LPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVAPSAASFS
FGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSV
PLKSSVLPSPSGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKA
CFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRL
HQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIH
SFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESE
DARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPIS
APQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGP
TPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEA
IPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSL
TSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTN
STVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSV
KKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPG
PSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTA
PGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFG
QSPGFGQGGSVFGGTSAATTTAATSGFSFCQASGFGSSNTGSVFGQAASTGGIVFGQQSSSSSGSVFGSGNTGRGGGFFSGLGGKPSQDA
ANKNPFSSASGGFGSTATSNTSNLFGNSGAKTFGGFASSSFGEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSPG
FGGVPAFGSAPAFTSPLGSTGGKVFGEGTAAASAGGFGFGSSSNTTSFGTLASQNAPTFGSLSQQTSGFGTQSSGFSGFGSGTGGFSFGS

>In-frame_GPSM1_ENST00000392944_chr9_139251002_+_NUP214_ENST00000411637_chr9_134002911_+_2164aa
MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDF
FNMLIKYQDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHH
LALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVTETVKVCA
TLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPDVVMALLP
KKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDSLPMGVVV
DTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDASAAAAPAS
LPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVAPSAASFS
FGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSENSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKSSVLPSPS
AGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQVGTSEEM
KMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRRLHQTVKFAVQD
VNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFDSDLESLC
NALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLESEDARTSCKDDE
AVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPISAPQAAAAAAL
RRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPASGQLSSG
DKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTEAIPESSPPSGI
TSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTSTQPTKTSG
VPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTNSTVPPSAPPP
TTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKEPVLAQPA
VSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPGPSAEAAAFGT
VTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGVFGQTTFG
QASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSPGFGQGGS
VFGGTSAATTTAATSGFSFCQASGFGSSNTGSVFGQAASTGGIVFGQQSSSSSGSVFGSGNTGRGGGFFSGLGGKPSQDAANKNPFSSAS
GGFGSTATSNTSNLFGNSGAKTFGGFASSSFGEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSPGFGGVPAFGSA
PAFTSPLGSTGGKVFGEGTAAASAGGFGFGSSSNTTSFGTLASQNAPTFGSLSQQTSGFGTQSSGFSGFGSGTGGFSFGSNNSSVQGFGG

>In-frame_GPSM1_ENST00000392944_chr9_139251002_+_NUP214_ENST00000451030_chr9_134002911_+_2175aa
MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDF
FNMLIKYQDFQFRALKKVRIFDSPEELPKERSSLLAVSNKTGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHH
LALSCDNLTLSACMMSSETGSIIAFFDVRTFSNEAKQQKRPFATHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVTETVKVCA
TLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQTLPTLQEKKVIPCPPFTESDHPVRVLDVLWIGTYVFAIVTAAADGTLETSPDVVMALLP
KKEEKHPEIFVNFMEPCTGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDSLPMGVVV
DTTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFTMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPTSSQAPQKLDASAAAAPAS
LPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEPPSTSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVAPSAASFS
FGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSV
PLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSK
ACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGTLHLLTKRPLDPKSEAQLQEIRR
LHQTVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSI
HSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRTTEDLDEVSSTSSVSQSLES
EDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPI
SAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSG
PTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSTE
AIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTS
LTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQT
NSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDS
VKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAP
GPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTT
APGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAF
GQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASGFGSSNTGSVFGQAASTGGIVFGQQSSSSSGSVFGSGNTGRGGGFFSGLGGKPSQD
AANKNPFSSASGGFGSTATSNTSNLFGNSGAKTFGGFASSSFGEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSP
GFGGVPAFGSAPAFTSPLGSTGGKVFGEGTAAASAGGFGFGSSSNTTSFGTLASQNAPTFGSLSQQTSGFGTQSSGFSGFGSGTGGFSFG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GPSM1_ENST00000440944_chr9_139251002_+_NUP214_ENST00000359428_chr9_134002911_+_8049nt
ATGGCGGGCCCGGCCCCGCCCGTGGCCGACGAGCTCCCGGGCCCGGCCGCCAGGCGCCTCTACTCCAGGATGGAGGCGTCCTGCCTAGAG
CTGGCGCTGGAGGGCGAGCGTCTGTGCAAGGCGGGCGACTTCAAGACAGGCGTGGCCTTCTTTGAGGCTGCTGTGCAGGTGGGCACCGAG
GACCTGAAGACACTGAGTGCCATCTACAGCCAGCTGGGCAACGCCTACTTCTACCTGAAGGAGCACGGCCGGGCGCTGGAATACCACAAG
CATGACCTCCTGCTGGCGCGGACCATCGGTGACCGCATGGGGGAGGCCAAGGCCAGTGGAAACCTGGGAAACACACTCAAGGTCCTGGGG
CGCTTCGACGAGGCTGCCGTCTGCTGCCAGCGGCATCTGAGCATCGCCCAAGAGCAGGGAGACAAGGTTGGGGAGGCGAGGGCCCTCTAC
AACATCGGGAACGTGTACCACGCCAAAGGCAAGCAACTGTCCTGGAACGCCGCAAACGCCACGCAGGACCCCGGGCACCTGCCGCCCGAT
GTCCGAGAGACCCTGTGCAAGGCCTCCGAGTTCTACGAGAGGAACCTGTCCCTGGTGAAGGAGCTGGGCGACCGTGCGGCGCAGGGCAGG
GCCTACGGCAACCTGGGCAACACCCACTATTTGTTGGGGAACTTCACAGAGGCCACGACCTTCCACAAGGAGCGCCTGGCCATTGCTAAG
GAGTTTGGAGACAAGGCAGCCGAGAGGAGGGCCTACAGCAACCTGGGGAACGCCCACGTCTTCCTGGGGCGCTTTGACGTGGCCGCCGAG
TACTACAAGAAGACGCTGCAACTGTCTCGGCAGCTCAGGGACCAGGCAGTGGAGGCGCAGGCCTGCTACAGTCTGGGCAACACCTACACG
CTGCTGCAGGACTACGAGCGCGCGGCCGAGTACCACCTGCGGCACCTGCTCATTGCCCAGGAGCTGGCCGACAGAGTGGGCGAGGGCCGG
GCGTGCTGGAGCCTGGGAAATGCCTACGTGTCCATGGGGCGCCCAGCGCAGGCCCTGACCTTCGCCAAGAAGCACCTGCAGATCTCCCAG
GAGATCGGGGACCGCCATGGGGAGCTCACGGCCCGCATGAACGTGGCGCAGCTGCAGCTGGTGCTCGGCCGCCTGACCAGCCCGGCAGCC
TCAGAGAAGCCTGACCTGGCCGGCTATGAGGCCCAGGGGGCCAGACCCAAGAGGACGCAGAGGCTGAGCGCGGAGACCTGGGACCTGCTG
AGACTCCCCCTGGAGCGGGAGCAGAATGGAGACAGCCACCATTCAGGGGACTGGCGGGGGCCCAGCAGGGACTCGCTACCCCTCCCCGTG
AGGAGCAGGAAGTACCAGGAAGGCCCGGACGCTGAGAGGAGGCCCCGGGAGGGCAGCCACTCCCCGCTGGACAGCGCCGACGTCCGGGTG
CACGTGCCACGCACGAGCATCCCGAGGGCCCCGTCTTCGGACGAGGAGTGCTTCTTTGACCTGTTGACCAAGTTCCAGAGCAGCCGCATG
GACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAGCCC
TCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGCGTG
GGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTCTTC
AACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGC
TCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTT
ATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTG
GCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTC
TCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAAC
CCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACT
CTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAG
TATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGG
ATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAA
AAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGT
TACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGG
GAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGAC
TATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTT
TGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCC
AAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTG
CCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCT
TTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCA
ACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTT
GGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCC
TCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCG
ATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCA
TTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGG
ATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGAT
TCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGT
TTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACA
GAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGA
AATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCAT
CAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCAC
CTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTG
GTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGT
TTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAA
CTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCT
CGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGAT
GCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTC
TTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGC
AAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCC
CCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAAT
GTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCC
AAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACA
CCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGG
CAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCT
GCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATT
CCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCT
TCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGA
GAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACT
AGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTG
ACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGT
GCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGC
ACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGT
TCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGT
GAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAA
AAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACC
CCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCA
GCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCA
TCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAAC
CAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAG
CAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCA
GGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCT
GGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACC
AGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAG
AGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAA
GCTTCAGGTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCCTCT
TCCAGTGGTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGATGCAGCC
AACAAAAACCCATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCCAAG
ACATTTGGTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCCCAAGGC
TTTGGGTTTTCCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGGTTT
GGAGGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACTGCAGCT
GCCAGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGATCA
CTGTCCCAACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGGTCAAAT

>In-frame_GPSM1_ENST00000440944_chr9_139251002_+_NUP214_ENST00000411637_chr9_134002911_+_8019nt
ATGGCGGGCCCGGCCCCGCCCGTGGCCGACGAGCTCCCGGGCCCGGCCGCCAGGCGCCTCTACTCCAGGATGGAGGCGTCCTGCCTAGAG
CTGGCGCTGGAGGGCGAGCGTCTGTGCAAGGCGGGCGACTTCAAGACAGGCGTGGCCTTCTTTGAGGCTGCTGTGCAGGTGGGCACCGAG
GACCTGAAGACACTGAGTGCCATCTACAGCCAGCTGGGCAACGCCTACTTCTACCTGAAGGAGCACGGCCGGGCGCTGGAATACCACAAG
CATGACCTCCTGCTGGCGCGGACCATCGGTGACCGCATGGGGGAGGCCAAGGCCAGTGGAAACCTGGGAAACACACTCAAGGTCCTGGGG
CGCTTCGACGAGGCTGCCGTCTGCTGCCAGCGGCATCTGAGCATCGCCCAAGAGCAGGGAGACAAGGTTGGGGAGGCGAGGGCCCTCTAC
AACATCGGGAACGTGTACCACGCCAAAGGCAAGCAACTGTCCTGGAACGCCGCAAACGCCACGCAGGACCCCGGGCACCTGCCGCCCGAT
GTCCGAGAGACCCTGTGCAAGGCCTCCGAGTTCTACGAGAGGAACCTGTCCCTGGTGAAGGAGCTGGGCGACCGTGCGGCGCAGGGCAGG
GCCTACGGCAACCTGGGCAACACCCACTATTTGTTGGGGAACTTCACAGAGGCCACGACCTTCCACAAGGAGCGCCTGGCCATTGCTAAG
GAGTTTGGAGACAAGGCAGCCGAGAGGAGGGCCTACAGCAACCTGGGGAACGCCCACGTCTTCCTGGGGCGCTTTGACGTGGCCGCCGAG
TACTACAAGAAGACGCTGCAACTGTCTCGGCAGCTCAGGGACCAGGCAGTGGAGGCGCAGGCCTGCTACAGTCTGGGCAACACCTACACG
CTGCTGCAGGACTACGAGCGCGCGGCCGAGTACCACCTGCGGCACCTGCTCATTGCCCAGGAGCTGGCCGACAGAGTGGGCGAGGGCCGG
GCGTGCTGGAGCCTGGGAAATGCCTACGTGTCCATGGGGCGCCCAGCGCAGGCCCTGACCTTCGCCAAGAAGCACCTGCAGATCTCCCAG
GAGATCGGGGACCGCCATGGGGAGCTCACGGCCCGCATGAACGTGGCGCAGCTGCAGCTGGTGCTCGGCCGCCTGACCAGCCCGGCAGCC
TCAGAGAAGCCTGACCTGGCCGGCTATGAGGCCCAGGGGGCCAGACCCAAGAGGACGCAGAGGCTGAGCGCGGAGACCTGGGACCTGCTG
AGACTCCCCCTGGAGCGGGAGCAGAATGGAGACAGCCACCATTCAGGGGACTGGCGGGGGCCCAGCAGGGACTCGCTACCCCTCCCCGTG
AGGAGCAGGAAGTACCAGGAAGGCCCGGACGCTGAGAGGAGGCCCCGGGAGGGCAGCCACTCCCCGCTGGACAGCGCCGACGTCCGGGTG
CACGTGCCACGCACGAGCATCCCGAGGGCCCCGTCTTCGGACGAGGAGTGCTTCTTTGACCTGTTGACCAAGTTCCAGAGCAGCCGCATG
GACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAGCCC
TCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGCGTG
GGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTCTTC
AACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGC
TCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTT
ATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTG
GCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTC
TCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAAC
CCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACT
CTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAG
TATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGG
ATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAA
AAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGT
TACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGG
GAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGAC
TATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTT
TGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCC
AAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTG
CCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCT
TTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCA
ACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTT
GGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCC
TCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCT
GCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCA
GGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCT
CCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAG
GAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAG
ATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTG
AAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTT
TATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTG
AATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTT
AACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTAC
AAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAAT
GCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGA
AACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTAT
GAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCA
GTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCT
CACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACA
ATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGG
CGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTG
AAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTG
GCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGAC
AAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCA
TCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAG
TCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACA
TCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGT
AAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGG
GTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTG
CCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCA
CCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGT
GGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACT
ACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCC
GCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTA
GAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTC
AGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGG
ACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCC
GTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTC
ACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCC
TCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCT
GCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAG
GCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAG
CCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAG
TCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTC
TTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGGTTTTGGGTCTAGTAATACTGGT
TCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCCTCTTCCAGTGGTAGCGTGTTTGGGTCTGGAAAC
ACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGATGCAGCCAACAAAAACCCATTCAGCTCGGCCAGTGGG
GGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCCAAGACATTTGGTGGATTTGCCAGCTCGTCGTTT
GGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCCCAAGGCTTTGGGTTTTCCTCTCCAAACAAAACAGGT
GGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGGTTTGGAGGGGTGCCAGCATTCGGTTCAGCCCCA
GCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACTGCAGCTGCCAGCGCAGGAGGATTCGGGTTTGGGAGC
AGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGATCACTGTCCCAACAGACTTCTGGTTTTGGGACC
CAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGGTCAAATAACTCGTCTGTCCAGGGTTTTGGTGGCTGG

>In-frame_GPSM1_ENST00000440944_chr9_139251002_+_NUP214_ENST00000451030_chr9_134002911_+_8052nt
ATGGCGGGCCCGGCCCCGCCCGTGGCCGACGAGCTCCCGGGCCCGGCCGCCAGGCGCCTCTACTCCAGGATGGAGGCGTCCTGCCTAGAG
CTGGCGCTGGAGGGCGAGCGTCTGTGCAAGGCGGGCGACTTCAAGACAGGCGTGGCCTTCTTTGAGGCTGCTGTGCAGGTGGGCACCGAG
GACCTGAAGACACTGAGTGCCATCTACAGCCAGCTGGGCAACGCCTACTTCTACCTGAAGGAGCACGGCCGGGCGCTGGAATACCACAAG
CATGACCTCCTGCTGGCGCGGACCATCGGTGACCGCATGGGGGAGGCCAAGGCCAGTGGAAACCTGGGAAACACACTCAAGGTCCTGGGG
CGCTTCGACGAGGCTGCCGTCTGCTGCCAGCGGCATCTGAGCATCGCCCAAGAGCAGGGAGACAAGGTTGGGGAGGCGAGGGCCCTCTAC
AACATCGGGAACGTGTACCACGCCAAAGGCAAGCAACTGTCCTGGAACGCCGCAAACGCCACGCAGGACCCCGGGCACCTGCCGCCCGAT
GTCCGAGAGACCCTGTGCAAGGCCTCCGAGTTCTACGAGAGGAACCTGTCCCTGGTGAAGGAGCTGGGCGACCGTGCGGCGCAGGGCAGG
GCCTACGGCAACCTGGGCAACACCCACTATTTGTTGGGGAACTTCACAGAGGCCACGACCTTCCACAAGGAGCGCCTGGCCATTGCTAAG
GAGTTTGGAGACAAGGCAGCCGAGAGGAGGGCCTACAGCAACCTGGGGAACGCCCACGTCTTCCTGGGGCGCTTTGACGTGGCCGCCGAG
TACTACAAGAAGACGCTGCAACTGTCTCGGCAGCTCAGGGACCAGGCAGTGGAGGCGCAGGCCTGCTACAGTCTGGGCAACACCTACACG
CTGCTGCAGGACTACGAGCGCGCGGCCGAGTACCACCTGCGGCACCTGCTCATTGCCCAGGAGCTGGCCGACAGAGTGGGCGAGGGCCGG
GCGTGCTGGAGCCTGGGAAATGCCTACGTGTCCATGGGGCGCCCAGCGCAGGCCCTGACCTTCGCCAAGAAGCACCTGCAGATCTCCCAG
GAGATCGGGGACCGCCATGGGGAGCTCACGGCCCGCATGAACGTGGCGCAGCTGCAGCTGGTGCTCGGCCGCCTGACCAGCCCGGCAGCC
TCAGAGAAGCCTGACCTGGCCGGCTATGAGGCCCAGGGGGCCAGACCCAAGAGGACGCAGAGGCTGAGCGCGGAGACCTGGGACCTGCTG
AGACTCCCCCTGGAGCGGGAGCAGAATGGAGACAGCCACCATTCAGGGGACTGGCGGGGGCCCAGCAGGGACTCGCTACCCCTCCCCGTG
AGGAGCAGGAAGTACCAGGAAGGCCCGGACGCTGAGAGGAGGCCCCGGGAGGGCAGCCACTCCCCGCTGGACAGCGCCGACGTCCGGGTG
CACGTGCCACGCACGAGCATCCCGAGGGCCCCGTCTTCGGACGAGGAGTGCTTCTTTGACCTGTTGACCAAGTTCCAGAGCAGCCGCATG
GACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAGCCC
TCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGCGTG
GGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTCTTC
AACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGC
TCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTT
ATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTG
GCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTC
TCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAAC
CCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACT
CTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAG
TATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGG
ATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAA
AAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGT
TACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGG
GAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGAC
TATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTT
TGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCC
AAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTG
CCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCT
TTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCA
ACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTT
GGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCC
TCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCG
ATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCA
TTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCC
AGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAA
GATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCC
TGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACC
ACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAA
AGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTT
CATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGG
CACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCAC
CTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCAC
AGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCC
AAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTG
TCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAA
GATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGT
CTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCT
AGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCA
GCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAG
AATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACA
GCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCT
ACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCT
GGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACT
GCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCC
ATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCA
CCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCT
GGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTA
ACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCT
GTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACC
AGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAAT
AGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTG
AGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGAC
AGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTT
AAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCT
ACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACA
GCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGC
CCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTC
AACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGG
CAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCC
CCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAG
CCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGT
ACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGG
CAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGC
CAAGCTTCAGGTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCC
TCTTCCAGTGGTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGATGCA
GCCAACAAAAACCCATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCC
AAGACATTTGGTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCCCAA
GGCTTTGGGTTTTCCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGG
TTTGGAGGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACTGCA
GCTGCCAGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGA
TCACTGTCCCAACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGGTCA

>In-frame_GPSM1_ENST00000429455_chr9_139251002_+_NUP214_ENST00000359428_chr9_134002911_+_6522nt
ATGGACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAG
CCCTCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGC
GTGGGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTC
TTCAACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAA
CGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTT
CTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCAC
CTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACA
TTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGG
AACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCA
ACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTC
CAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTG
TGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCG
AAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTC
AGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAAT
TGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTA
GACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTG
CTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAG
CCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCT
CTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCA
TCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCA
TCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCC
TTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCA
CCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCC
CCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTG
CCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCC
AGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAA
GATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCC
TGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACC
ACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAA
AGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTT
CATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGG
CACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCAC
CTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCAC
AGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCC
AAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTG
TCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAA
GATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGT
CTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCT
AGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCA
GCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAG
AATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACA
GCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCT
ACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCT
GGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACT
GCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCC
ATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCA
CCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCT
GGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTA
ACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCT
GTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACC
AGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAAT
AGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTG
AGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGAC
AGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTT
AAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCT
ACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACA
GCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGC
CCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTC
AACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGG
CAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCC
CCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAG
CCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGT
ACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGG
CAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGC
CAAGCTTCAGGTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCC
TCTTCCAGTGGTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGATGCA
GCCAACAAAAACCCATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCC
AAGACATTTGGTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCCCAA
GGCTTTGGGTTTTCCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGG
TTTGGAGGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACTGCA
GCTGCCAGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGA
TCACTGTCCCAACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGGTCA

>In-frame_GPSM1_ENST00000429455_chr9_139251002_+_NUP214_ENST00000411637_chr9_134002911_+_6492nt
ATGGACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAG
CCCTCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGC
GTGGGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTC
TTCAACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAA
CGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTT
CTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCAC
CTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACA
TTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGG
AACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCA
ACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTC
CAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTG
TGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCG
AAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTC
AGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAAT
TGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTA
GACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTG
CTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAG
CCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCT
CTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCA
TCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCA
TCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCC
TTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCA
CCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCA
GCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCA
GCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGC
TCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGG
GAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATG
AAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGC
CTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTG
CTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGAT
GTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTG
TTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTT
TACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGC
AATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTG
AGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATAT
TATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAG
GCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAA
TCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGC
ACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTC
AGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAA
TTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCA
GTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGT
GACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCT
CCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAA
GAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATC
ACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCT
AGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTG
CGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGC
GTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTA
GCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTT
GGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCA
ACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATG
TCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTT
CTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCA
GTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCC
AGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTG
GCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACC
GTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCC
CCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCA
GCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGG
CAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGT
CAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGA
CAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCT
GTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGGTTTTGGGTCTAGTAATACT
GGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCCTCTTCCAGTGGTAGCGTGTTTGGGTCTGGA
AACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGATGCAGCCAACAAAAACCCATTCAGCTCGGCCAGT
GGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCCAAGACATTTGGTGGATTTGCCAGCTCGTCG
TTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCCCAAGGCTTTGGGTTTTCCTCTCCAAACAAAACA
GGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGGTTTGGAGGGGTGCCAGCATTCGGTTCAGCC
CCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACTGCAGCTGCCAGCGCAGGAGGATTCGGGTTTGGG
AGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGATCACTGTCCCAACAGACTTCTGGTTTTGGG
ACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGGTCAAATAACTCGTCTGTCCAGGGTTTTGGTGGC

>In-frame_GPSM1_ENST00000429455_chr9_139251002_+_NUP214_ENST00000451030_chr9_134002911_+_6525nt
ATGGACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAG
CCCTCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGC
GTGGGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTC
TTCAACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAA
CGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTT
CTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCAC
CTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACA
TTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGG
AACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCA
ACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTC
CAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTG
TGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCG
AAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTC
AGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAAT
TGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTA
GACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTG
CTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAG
CCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCT
CTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCA
TCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCA
TCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCC
TTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCA
CCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCC
CCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTG
CCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCA
CCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGG
AAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAA
GCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAG
ACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAAT
GAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGC
CTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAA
AGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAAT
CACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATT
CACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCA
GCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGC
CTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGT
GAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCC
AGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCT
GCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATC
TCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTG
AAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCC
ACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGG
CCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCT
TCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTC
ACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAG
GCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTG
GCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTG
GCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGC
CTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCC
CCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTC
ACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACC
AATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTC
CTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGT
GACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCT
GTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAG
GCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTC
ACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCC
GGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCT
TTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTT
GGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACA
GCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGT
CAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCA
AGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTT
GGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTT
TGCCAAGCTTCAGGTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCA
TCCTCTTCCAGTGGTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGAT
GCAGCCAACAAAAACCCATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGG
GCCAAGACATTTGGTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCC
CAAGGCTTTGGGTTTTCCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCT
GGGTTTGGAGGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACT
GCAGCTGCCAGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTC
GGATCACTGTCCCAACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGG

>In-frame_GPSM1_ENST00000392944_chr9_139251002_+_NUP214_ENST00000359428_chr9_134002911_+_6522nt
ATGGACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAG
CCCTCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGC
GTGGGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTC
TTCAACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAA
CGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTT
CTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCAC
CTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACA
TTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGG
AACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCA
ACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTC
CAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTG
TGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCG
AAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTC
AGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAAT
TGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTA
GACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTG
CTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAG
CCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCT
CTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCA
TCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCA
TCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCC
TTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCA
CCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCC
CCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTG
CCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCC
AGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAA
GATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCC
TGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACC
ACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAA
AGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTT
CATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGG
CACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCAC
CTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCAC
AGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCC
AAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTG
TCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAA
GATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGT
CTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCT
AGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCA
GCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAG
AATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACA
GCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCT
ACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCT
GGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACT
GCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCC
ATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCA
CCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCT
GGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTA
ACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCT
GTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACC
AGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAAT
AGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTG
AGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGAC
AGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTT
AAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCT
ACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACA
GCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGC
CCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTC
AACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGG
CAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCC
CCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAG
CCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGT
ACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGG
CAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGC
CAAGCTTCAGGTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCC
TCTTCCAGTGGTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGATGCA
GCCAACAAAAACCCATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCC
AAGACATTTGGTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCCCAA
GGCTTTGGGTTTTCCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGG
TTTGGAGGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACTGCA
GCTGCCAGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGA
TCACTGTCCCAACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGGTCA

>In-frame_GPSM1_ENST00000392944_chr9_139251002_+_NUP214_ENST00000411637_chr9_134002911_+_6492nt
ATGGACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAG
CCCTCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGC
GTGGGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTC
TTCAACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAA
CGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTT
CTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCAC
CTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACA
TTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGG
AACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCA
ACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTC
CAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTG
TGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCG
AAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTC
AGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAAT
TGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTA
GACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTG
CTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAG
CCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCT
CTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCA
TCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCA
TCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCC
TTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCA
CCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCA
GCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCA
GCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGC
TCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGG
GAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATG
AAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGC
CTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTG
CTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGAT
GTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTG
TTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTT
TACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGC
AATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTG
AGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATAT
TATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAG
GCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAA
TCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGC
ACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTC
AGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAA
TTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCA
GTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGT
GACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCT
CCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAA
GAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATC
ACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCT
AGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTG
CGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGC
GTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTA
GCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTT
GGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCA
ACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATG
TCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTT
CTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCA
GTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCC
AGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTG
GCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACC
GTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCC
CCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCA
GCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGG
CAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGT
CAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGA
CAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCT
GTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGGTTTTGGGTCTAGTAATACT
GGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCCTCTTCCAGTGGTAGCGTGTTTGGGTCTGGA
AACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGATGCAGCCAACAAAAACCCATTCAGCTCGGCCAGT
GGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCCAAGACATTTGGTGGATTTGCCAGCTCGTCG
TTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCCCAAGGCTTTGGGTTTTCCTCTCCAAACAAAACA
GGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGGTTTGGAGGGGTGCCAGCATTCGGTTCAGCC
CCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACTGCAGCTGCCAGCGCAGGAGGATTCGGGTTTGGG
AGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGATCACTGTCCCAACAGACTTCTGGTTTTGGG
ACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGGTCAAATAACTCGTCTGTCCAGGGTTTTGGTGGC

>In-frame_GPSM1_ENST00000392944_chr9_139251002_+_NUP214_ENST00000451030_chr9_134002911_+_6525nt
ATGGACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAG
CCCTCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGC
GTGGGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTC
TTCAACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAA
CGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTT
CTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCAC
CTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACA
TTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGG
AACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCA
ACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTC
CAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTG
TGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCG
AAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTC
AGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAAT
TGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTA
GACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTG
CTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAG
CCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCT
CTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCA
TCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCA
TCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCC
TTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCA
CCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCC
CCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTG
CCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCA
CCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGG
AAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAA
GCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAG
ACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAAT
GAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGC
CTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAA
AGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAAT
CACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATT
CACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCA
GCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGC
CTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGT
GAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCC
AGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCT
GCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATC
TCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTG
AAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCC
ACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGG
CCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCT
TCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTC
ACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAG
GCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTG
GCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTG
GCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGC
CTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCC
CCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTC
ACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACC
AATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTC
CTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGT
GACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCT
GTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAG
GCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTC
ACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCC
GGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCT
TTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTT
GGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACA
GCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGT
CAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCA
AGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTT
GGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTT
TGCCAAGCTTCAGGTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCA
TCCTCTTCCAGTGGTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGAT
GCAGCCAACAAAAACCCATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGG
GCCAAGACATTTGGTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCC
CAAGGCTTTGGGTTTTCCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCT
GGGTTTGGAGGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACT
GCAGCTGCCAGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTC
GGATCACTGTCCCAACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_GPSM1_ENST00000440944_chr9_139251002_+_NUP214_ENST00000359428_chr9_134002911_+_9452nt
GCGCGGGCGGCGGTGACATCACGGCCACGGCGGCGGGAGGGGCGGCGGCGCCCCGCGCACATCACTTCCTCGGCGCCTCCCCGGGGGAGG
ACGGGCGAACGAGGCGCGGACGGACAGGCGGACAGCAGGGCGGACAGCAGGGAGGACAGCAGGGCGGGCAGGGGGCGGACGGCCACGGCG
CGGGGGGCGCTCCCGGCTCCCGCTCCCGCGTCCCCGACCCATGGCGGGCCCGGCCCCGCCCGTGGCCGACGAGCTCCCGGGCCCGGCCGC
CAGGCGCCTCTACTCCAGGATGGAGGCGTCCTGCCTAGAGCTGGCGCTGGAGGGCGAGCGTCTGTGCAAGGCGGGCGACTTCAAGACAGG
CGTGGCCTTCTTTGAGGCTGCTGTGCAGGTGGGCACCGAGGACCTGAAGACACTGAGTGCCATCTACAGCCAGCTGGGCAACGCCTACTT
CTACCTGAAGGAGCACGGCCGGGCGCTGGAATACCACAAGCATGACCTCCTGCTGGCGCGGACCATCGGTGACCGCATGGGGGAGGCCAA
GGCCAGTGGAAACCTGGGAAACACACTCAAGGTCCTGGGGCGCTTCGACGAGGCTGCCGTCTGCTGCCAGCGGCATCTGAGCATCGCCCA
AGAGCAGGGAGACAAGGTTGGGGAGGCGAGGGCCCTCTACAACATCGGGAACGTGTACCACGCCAAAGGCAAGCAACTGTCCTGGAACGC
CGCAAACGCCACGCAGGACCCCGGGCACCTGCCGCCCGATGTCCGAGAGACCCTGTGCAAGGCCTCCGAGTTCTACGAGAGGAACCTGTC
CCTGGTGAAGGAGCTGGGCGACCGTGCGGCGCAGGGCAGGGCCTACGGCAACCTGGGCAACACCCACTATTTGTTGGGGAACTTCACAGA
GGCCACGACCTTCCACAAGGAGCGCCTGGCCATTGCTAAGGAGTTTGGAGACAAGGCAGCCGAGAGGAGGGCCTACAGCAACCTGGGGAA
CGCCCACGTCTTCCTGGGGCGCTTTGACGTGGCCGCCGAGTACTACAAGAAGACGCTGCAACTGTCTCGGCAGCTCAGGGACCAGGCAGT
GGAGGCGCAGGCCTGCTACAGTCTGGGCAACACCTACACGCTGCTGCAGGACTACGAGCGCGCGGCCGAGTACCACCTGCGGCACCTGCT
CATTGCCCAGGAGCTGGCCGACAGAGTGGGCGAGGGCCGGGCGTGCTGGAGCCTGGGAAATGCCTACGTGTCCATGGGGCGCCCAGCGCA
GGCCCTGACCTTCGCCAAGAAGCACCTGCAGATCTCCCAGGAGATCGGGGACCGCCATGGGGAGCTCACGGCCCGCATGAACGTGGCGCA
GCTGCAGCTGGTGCTCGGCCGCCTGACCAGCCCGGCAGCCTCAGAGAAGCCTGACCTGGCCGGCTATGAGGCCCAGGGGGCCAGACCCAA
GAGGACGCAGAGGCTGAGCGCGGAGACCTGGGACCTGCTGAGACTCCCCCTGGAGCGGGAGCAGAATGGAGACAGCCACCATTCAGGGGA
CTGGCGGGGGCCCAGCAGGGACTCGCTACCCCTCCCCGTGAGGAGCAGGAAGTACCAGGAAGGCCCGGACGCTGAGAGGAGGCCCCGGGA
GGGCAGCCACTCCCCGCTGGACAGCGCCGACGTCCGGGTGCACGTGCCACGCACGAGCATCCCGAGGGCCCCGTCTTCGGACGAGGAGTG
CTTCTTTGACCTGTTGACCAAGTTCCAGAGCAGCCGCATGGACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGC
CACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAGCCCTCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAG
CTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGCGTGGGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCG
AGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTCTTCAACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGT
GAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGG
AGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCA
AGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGA
ATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTT
GAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGC
TGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAA
GCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTA
TGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCT
GGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTA
TGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGA
AGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGA
CAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCC
TGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAA
AACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACA
GAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGC
TGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGG
CTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGC
AGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGT
GTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGC
TACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAG
CCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAG
TTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCA
GCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAA
GGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGA
TGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGG
CTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCC
CAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGA
GTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCG
GGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAG
CCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCAT
AGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAA
GACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAG
CTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCA
CGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTC
ACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGT
GAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGC
ACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCC
TTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCA
GGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAA
GATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTT
TGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATT
CTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCC
AGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTC
CAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTC
TACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTAC
TGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCAC
TTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGG
CAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCC
AACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGA
GGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCA
GCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGC
ATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGC
TTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCC
CATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTT
TGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGG
GCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAG
CTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTC
GGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCAC
ATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGG
GGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGC
CACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGGTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGCAGC
CAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCCTCTTCCAGTGGTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTT
CTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGATGCAGCCAACAAAAACCCATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGCTAC
CTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCCAAGACATTTGGTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGG
CACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCCCAAGGCTTTGGGTTTTCCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCCAGT
GTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGGTTTGGAGGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGG
CTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACTGCAGCTGCCAGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATCCTT
CGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGATCACTGTCCCAACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGG
TTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGGTCAAATAACTCGTCTGTCCAGGGTTTTGGTGGCTGGCGAAGCTGAGGGCGTGTCAG
CAGGCCTTTCGATCCCTGGGACCAACCGCATCCTCAGCTTCTTCCCCGAGAAATGCTGGAGCAGGCTGTTCAGACCGACGTTGCCATCAA
AACACATACACCCAGAAAGAAACAACAGAAACCAAAACTCACAAGGCGCATGATTACTTGTTTTATATTTCATGTTGGGTTTTCCCTCCC
ACTATTAAACAGTCTGTTTCCGTACAGAACGTATGTGGGTTTTTTCAGATCACAGCCAAGAAGATTGCCCCGTTTCTGTGGCTCTGAGAA
GCCAGCAGAGCCTCCATCAGCCAGAACACTGTGTCTTCAAGGATGGCATCAGAAGTCACCAGCGTCGGGTGTTGATAAACAGCATCGAAT
GTGCCGTGGTCTCACTTGGACCTAGCGCCCTCCACATAGGGAAGAGGTTGAATGCTGGTGGGTCATCTTTTTGAGGCTGAAACTTGGTTA
TCTCCTCTCCTTGTTCTTTTAGCCATTGTGTATCAGGACCATCCAAGGACGCACTCTGCGATTGAGTGGAGGCAGAGGAAGCCACTCATG
CCAGCAGCAGTTGAGTTTCAGAAGCAGCCATAGCGCTTTTCAGTACAGTACAATAGTAGCCAGCGTGAGGCAGGACAGTGCTGCGCCTTA
GCCGGCCTTGGCTCTCATCTCCATGTGGCTCTTGGGTGCCATGTGTCCTACTCCAGAGAGGAGGGGGCCGGTCACTTGAGAAGACAGCCT
TTATATTCTGTATGTGGCAGTGACATTGGTAGCCACACCTACCCAGTGTCTACTAACCACAGTGCAGATAGCCCTTGGGTAGACCCAGGA
AGTGTGAAGACAGACACTGCTGTTGCCAGACAACACTAGCAGAACGATGCTGGATTTGACAACAGTGTTTGCTAGGACGGCCCAGAGCTC
ATCACTGCAGTTTTATTAGAGTGCTTCTTTATCTTTAATGCAGTATCTTTGAGGCCTGTAACATCCTAGATAGTTGCCATCAAACAAGGA
CCGTCTCGCATTGAAAACAGATGTAAGAATTTCTCTTTCAGGCCCAGAATCTGACAGTGCTTTGGCTTGGGTCATGAGCAGCGGGGAGTT
GGGAAGAGATTTTTTTTTTTAGAGTTTTACATATTGGCAGGTTGTATTTTTTTAATGTTTTAATAAAAGTTTGACATGACATTAATTCAT

>In-frame_GPSM1_ENST00000440944_chr9_139251002_+_NUP214_ENST00000411637_chr9_134002911_+_9415nt
GCGCGGGCGGCGGTGACATCACGGCCACGGCGGCGGGAGGGGCGGCGGCGCCCCGCGCACATCACTTCCTCGGCGCCTCCCCGGGGGAGG
ACGGGCGAACGAGGCGCGGACGGACAGGCGGACAGCAGGGCGGACAGCAGGGAGGACAGCAGGGCGGGCAGGGGGCGGACGGCCACGGCG
CGGGGGGCGCTCCCGGCTCCCGCTCCCGCGTCCCCGACCCATGGCGGGCCCGGCCCCGCCCGTGGCCGACGAGCTCCCGGGCCCGGCCGC
CAGGCGCCTCTACTCCAGGATGGAGGCGTCCTGCCTAGAGCTGGCGCTGGAGGGCGAGCGTCTGTGCAAGGCGGGCGACTTCAAGACAGG
CGTGGCCTTCTTTGAGGCTGCTGTGCAGGTGGGCACCGAGGACCTGAAGACACTGAGTGCCATCTACAGCCAGCTGGGCAACGCCTACTT
CTACCTGAAGGAGCACGGCCGGGCGCTGGAATACCACAAGCATGACCTCCTGCTGGCGCGGACCATCGGTGACCGCATGGGGGAGGCCAA
GGCCAGTGGAAACCTGGGAAACACACTCAAGGTCCTGGGGCGCTTCGACGAGGCTGCCGTCTGCTGCCAGCGGCATCTGAGCATCGCCCA
AGAGCAGGGAGACAAGGTTGGGGAGGCGAGGGCCCTCTACAACATCGGGAACGTGTACCACGCCAAAGGCAAGCAACTGTCCTGGAACGC
CGCAAACGCCACGCAGGACCCCGGGCACCTGCCGCCCGATGTCCGAGAGACCCTGTGCAAGGCCTCCGAGTTCTACGAGAGGAACCTGTC
CCTGGTGAAGGAGCTGGGCGACCGTGCGGCGCAGGGCAGGGCCTACGGCAACCTGGGCAACACCCACTATTTGTTGGGGAACTTCACAGA
GGCCACGACCTTCCACAAGGAGCGCCTGGCCATTGCTAAGGAGTTTGGAGACAAGGCAGCCGAGAGGAGGGCCTACAGCAACCTGGGGAA
CGCCCACGTCTTCCTGGGGCGCTTTGACGTGGCCGCCGAGTACTACAAGAAGACGCTGCAACTGTCTCGGCAGCTCAGGGACCAGGCAGT
GGAGGCGCAGGCCTGCTACAGTCTGGGCAACACCTACACGCTGCTGCAGGACTACGAGCGCGCGGCCGAGTACCACCTGCGGCACCTGCT
CATTGCCCAGGAGCTGGCCGACAGAGTGGGCGAGGGCCGGGCGTGCTGGAGCCTGGGAAATGCCTACGTGTCCATGGGGCGCCCAGCGCA
GGCCCTGACCTTCGCCAAGAAGCACCTGCAGATCTCCCAGGAGATCGGGGACCGCCATGGGGAGCTCACGGCCCGCATGAACGTGGCGCA
GCTGCAGCTGGTGCTCGGCCGCCTGACCAGCCCGGCAGCCTCAGAGAAGCCTGACCTGGCCGGCTATGAGGCCCAGGGGGCCAGACCCAA
GAGGACGCAGAGGCTGAGCGCGGAGACCTGGGACCTGCTGAGACTCCCCCTGGAGCGGGAGCAGAATGGAGACAGCCACCATTCAGGGGA
CTGGCGGGGGCCCAGCAGGGACTCGCTACCCCTCCCCGTGAGGAGCAGGAAGTACCAGGAAGGCCCGGACGCTGAGAGGAGGCCCCGGGA
GGGCAGCCACTCCCCGCTGGACAGCGCCGACGTCCGGGTGCACGTGCCACGCACGAGCATCCCGAGGGCCCCGTCTTCGGACGAGGAGTG
CTTCTTTGACCTGTTGACCAAGTTCCAGAGCAGCCGCATGGACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGC
CACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAGCCCTCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAG
CTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGCGTGGGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCG
AGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTCTTCAACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGT
GAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGG
AGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCA
AGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGA
ATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTT
GAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGC
TGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAA
GCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTA
TGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCT
GGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTA
TGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGA
AGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGA
CAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCC
TGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAA
AACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACA
GAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGC
TGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGG
CTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGC
AGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGT
GTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGC
ACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTC
CGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAA
ATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCA
GTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTC
CAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAA
AGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACA
AAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCG
GCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAA
ACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCT
GAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAG
CATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGT
ACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGC
CAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGA
GAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCA
GCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTAC
ATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCC
CATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAAC
GTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTA
CTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATC
TGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATC
TGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAA
TTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTA
TGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACC
TGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTC
TTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCAC
AAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGA
GCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCC
AGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACA
GACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAG
CCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCC
AGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGA
CTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGC
AGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGC
TGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGC
TCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTC
AGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCT
GTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTAC
CACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTT
CAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGC
CTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGC
TTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAG
CTTTTGCCAAGCTTCAGGTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCA
ATCATCCTCTTCCAGTGGTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCA
GGATGCAGCCAACAAAAACCCATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAG
TGGGGCCAAGACATTTGGTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGC
ATCCCAAGGCTTTGGGTTTTCCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATC
CCCTGGGTTTGGAGGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGG
CACTGCAGCTGCCAGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCAC
TTTCGGATCACTGTCCCAACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTT
TGGGTCAAATAACTCGTCTGTCCAGGGTTTTGGTGGCTGGCGAAGCTGAGGGCGTGTCAGCAGGCCTTTCGATCCCTGGGACCAACCGCA
TCCTCAGCTTCTTCCCCGAGAAATGCTGGAGCAGGCTGTTCAGACCGACGTTGCCATCAAAACACATACACCCAGAAAGAAACAACAGAA
ACCAAAACTCACAAGGCGCATGATTACTTGTTTTATATTTCATGTTGGGTTTTCCCTCCCACTATTAAACAGTCTGTTTCCGTACAGAAC
GTATGTGGGTTTTTTCAGATCACAGCCAAGAAGATTGCCCCGTTTCTGTGGCTCTGAGAAGCCAGCAGAGCCTCCATCAGCCAGAACACT
GTGTCTTCAAGGATGGCATCAGAAGTCACCAGCGTCGGGTGTTGATAAACAGCATCGAATGTGCCGTGGTCTCACTTGGACCTAGCGCCC
TCCACATAGGGAAGAGGTTGAATGCTGGTGGGTCATCTTTTTGAGGCTGAAACTTGGTTATCTCCTCTCCTTGTTCTTTTAGCCATTGTG
TATCAGGACCATCCAAGGACGCACTCTGCGATTGAGTGGAGGCAGAGGAAGCCACTCATGCCAGCAGCAGTTGAGTTTCAGAAGCAGCCA
TAGCGCTTTTCAGTACAGTACAATAGTAGCCAGCGTGAGGCAGGACAGTGCTGCGCCTTAGCCGGCCTTGGCTCTCATCTCCATGTGGCT
CTTGGGTGCCATGTGTCCTACTCCAGAGAGGAGGGGGCCGGTCACTTGAGAAGACAGCCTTTATATTCTGTATGTGGCAGTGACATTGGT
AGCCACACCTACCCAGTGTCTACTAACCACAGTGCAGATAGCCCTTGGGTAGACCCAGGAAGTGTGAAGACAGACACTGCTGTTGCCAGA
CAACACTAGCAGAACGATGCTGGATTTGACAACAGTGTTTGCTAGGACGGCCCAGAGCTCATCACTGCAGTTTTATTAGAGTGCTTCTTT
ATCTTTAATGCAGTATCTTTGAGGCCTGTAACATCCTAGATAGTTGCCATCAAACAAGGACCGTCTCGCATTGAAAACAGATGTAAGAAT
TTCTCTTTCAGGCCCAGAATCTGACAGTGCTTTGGCTTGGGTCATGAGCAGCGGGGAGTTGGGAAGAGATTTTTTTTTTTAGAGTTTTAC

>In-frame_GPSM1_ENST00000440944_chr9_139251002_+_NUP214_ENST00000451030_chr9_134002911_+_8486nt
GCGCGGGCGGCGGTGACATCACGGCCACGGCGGCGGGAGGGGCGGCGGCGCCCCGCGCACATCACTTCCTCGGCGCCTCCCCGGGGGAGG
ACGGGCGAACGAGGCGCGGACGGACAGGCGGACAGCAGGGCGGACAGCAGGGAGGACAGCAGGGCGGGCAGGGGGCGGACGGCCACGGCG
CGGGGGGCGCTCCCGGCTCCCGCTCCCGCGTCCCCGACCCATGGCGGGCCCGGCCCCGCCCGTGGCCGACGAGCTCCCGGGCCCGGCCGC
CAGGCGCCTCTACTCCAGGATGGAGGCGTCCTGCCTAGAGCTGGCGCTGGAGGGCGAGCGTCTGTGCAAGGCGGGCGACTTCAAGACAGG
CGTGGCCTTCTTTGAGGCTGCTGTGCAGGTGGGCACCGAGGACCTGAAGACACTGAGTGCCATCTACAGCCAGCTGGGCAACGCCTACTT
CTACCTGAAGGAGCACGGCCGGGCGCTGGAATACCACAAGCATGACCTCCTGCTGGCGCGGACCATCGGTGACCGCATGGGGGAGGCCAA
GGCCAGTGGAAACCTGGGAAACACACTCAAGGTCCTGGGGCGCTTCGACGAGGCTGCCGTCTGCTGCCAGCGGCATCTGAGCATCGCCCA
AGAGCAGGGAGACAAGGTTGGGGAGGCGAGGGCCCTCTACAACATCGGGAACGTGTACCACGCCAAAGGCAAGCAACTGTCCTGGAACGC
CGCAAACGCCACGCAGGACCCCGGGCACCTGCCGCCCGATGTCCGAGAGACCCTGTGCAAGGCCTCCGAGTTCTACGAGAGGAACCTGTC
CCTGGTGAAGGAGCTGGGCGACCGTGCGGCGCAGGGCAGGGCCTACGGCAACCTGGGCAACACCCACTATTTGTTGGGGAACTTCACAGA
GGCCACGACCTTCCACAAGGAGCGCCTGGCCATTGCTAAGGAGTTTGGAGACAAGGCAGCCGAGAGGAGGGCCTACAGCAACCTGGGGAA
CGCCCACGTCTTCCTGGGGCGCTTTGACGTGGCCGCCGAGTACTACAAGAAGACGCTGCAACTGTCTCGGCAGCTCAGGGACCAGGCAGT
GGAGGCGCAGGCCTGCTACAGTCTGGGCAACACCTACACGCTGCTGCAGGACTACGAGCGCGCGGCCGAGTACCACCTGCGGCACCTGCT
CATTGCCCAGGAGCTGGCCGACAGAGTGGGCGAGGGCCGGGCGTGCTGGAGCCTGGGAAATGCCTACGTGTCCATGGGGCGCCCAGCGCA
GGCCCTGACCTTCGCCAAGAAGCACCTGCAGATCTCCCAGGAGATCGGGGACCGCCATGGGGAGCTCACGGCCCGCATGAACGTGGCGCA
GCTGCAGCTGGTGCTCGGCCGCCTGACCAGCCCGGCAGCCTCAGAGAAGCCTGACCTGGCCGGCTATGAGGCCCAGGGGGCCAGACCCAA
GAGGACGCAGAGGCTGAGCGCGGAGACCTGGGACCTGCTGAGACTCCCCCTGGAGCGGGAGCAGAATGGAGACAGCCACCATTCAGGGGA
CTGGCGGGGGCCCAGCAGGGACTCGCTACCCCTCCCCGTGAGGAGCAGGAAGTACCAGGAAGGCCCGGACGCTGAGAGGAGGCCCCGGGA
GGGCAGCCACTCCCCGCTGGACAGCGCCGACGTCCGGGTGCACGTGCCACGCACGAGCATCCCGAGGGCCCCGTCTTCGGACGAGGAGTG
CTTCTTTGACCTGTTGACCAAGTTCCAGAGCAGCCGCATGGACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGC
CACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAGCCCTCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAG
CTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGCGTGGGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCG
AGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTCTTCAACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGT
GAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGG
AGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCA
AGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGA
ATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTT
GAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGC
TGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAA
GCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTA
TGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCT
GGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTA
TGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGA
AGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGA
CAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCC
TGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAA
AACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACA
GAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGC
TGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGG
CTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGC
AGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGT
GTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGC
TACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAG
CCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGG
CAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACT
TCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCA
GAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATC
AGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGA
GGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGA
TCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTT
GGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAA
TCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTG
GAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCAC
CATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAG
GAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGT
CAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCG
GCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTC
TTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAAC
CGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCA
GGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAAC
CCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAA
GCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGC
CAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAA
TTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGC
ATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCAC
CCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACC
GTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGA
TTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTT
TACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAG
CACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGC
TGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCT
TCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGA
AGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGC
CCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGC
AGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACC
TGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTAC
CCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGT
CTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTT
TGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAG
CAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCA
GTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCC
CACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGG
AGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGC
TGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGGTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGC
AGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCCTCTTCCAGTGGTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGG
TTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGATGCAGCCAACAAAAACCCATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGC
TACCTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCCAAGACATTTGGTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCAC
TGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCCCAAGGCTTTGGGTTTTCCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCC
AGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGGTTTGGAGGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCT
GGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACTGCAGCTGCCAGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATC
CTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGATCACTGTCCCAACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTC
TGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGGTCAAATAACTCGTCTGTCCAGGGTTTTGGTGGCTGGCGAAGCTGAGGGCGTGT
CAGCAGGCCTTTCGATCCCTGGGACCAACCGCATCCTCAGCTTCTTCCCCGAGAAATGCTGGAGCAGGCTGTTCAGACCGACGTTGCCAT
CAAAACACATACACCCAGAAAGAAACAACAGAAACCAAAACTCACAAGGCGCATGATTACTTGTTTTATATTTCATGTTGGGTTTTCCCT

>In-frame_GPSM1_ENST00000429455_chr9_139251002_+_NUP214_ENST00000359428_chr9_134002911_+_7876nt
GGCGGTGGTGGCCCTGGGCACCTTGTGTCCTGCCTGCGCTCTGTGTGGCCAAGCACCCAGCGTGGCTCCCTGCTGCTGTGGAGACAGCCT
GTGATCCGCAGCATCCCGAGGGCCCCGTCTTCGGACGAGGAGTGCTTCTTTGACCTGTTGACCAAGTTCCAGAGCAGCCGCATGGACGAC
CAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAGCCCTCGATG
ACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGCGTGGGCAGC
CTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTCTTCAACATG
CTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGT
CTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAA
AATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTG
AGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAAT
GAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACT
GTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCT
TCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTT
CCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGT
ACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAA
GAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATT
GAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCT
TGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACA
AACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCA
TTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCA
CCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCT
TCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAG
TCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTC
TCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCA
TCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACC
TCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCG
CCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAG
TCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACC
CCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGAT
CCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAA
GTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCG
CTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGT
GACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTAT
GTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTT
GTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGAT
AGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGAC
AGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCC
CCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCA
GCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGG
ACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCC
CATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATT
ATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAG
GCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCT
CAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACA
CCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCA
TCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTC
AGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAA
GGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAA
AGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGA
ACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACT
CTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACC
CAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCC
TCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGA
TCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTG
CCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCA
ACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTC
TCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAA
CCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCC
ACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCT
ATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCA
GAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTC
ACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACT
GGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTC
TTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTC
AGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGC
TCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCT
GGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCA
GGTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCCTCTTCCAGT
GGTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGATGCAGCCAACAAA
AACCCATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCCAAGACATTT
GGTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCCCAAGGCTTTGGG
TTTTCCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGGTTTGGAGGG
GTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACTGCAGCTGCCAGC
GCAGGAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGATCACTGTCC
CAACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGGTCAAATAACTCG
TCTGTCCAGGGTTTTGGTGGCTGGCGAAGCTGAGGGCGTGTCAGCAGGCCTTTCGATCCCTGGGACCAACCGCATCCTCAGCTTCTTCCC
CGAGAAATGCTGGAGCAGGCTGTTCAGACCGACGTTGCCATCAAAACACATACACCCAGAAAGAAACAACAGAAACCAAAACTCACAAGG
CGCATGATTACTTGTTTTATATTTCATGTTGGGTTTTCCCTCCCACTATTAAACAGTCTGTTTCCGTACAGAACGTATGTGGGTTTTTTC
AGATCACAGCCAAGAAGATTGCCCCGTTTCTGTGGCTCTGAGAAGCCAGCAGAGCCTCCATCAGCCAGAACACTGTGTCTTCAAGGATGG
CATCAGAAGTCACCAGCGTCGGGTGTTGATAAACAGCATCGAATGTGCCGTGGTCTCACTTGGACCTAGCGCCCTCCACATAGGGAAGAG
GTTGAATGCTGGTGGGTCATCTTTTTGAGGCTGAAACTTGGTTATCTCCTCTCCTTGTTCTTTTAGCCATTGTGTATCAGGACCATCCAA
GGACGCACTCTGCGATTGAGTGGAGGCAGAGGAAGCCACTCATGCCAGCAGCAGTTGAGTTTCAGAAGCAGCCATAGCGCTTTTCAGTAC
AGTACAATAGTAGCCAGCGTGAGGCAGGACAGTGCTGCGCCTTAGCCGGCCTTGGCTCTCATCTCCATGTGGCTCTTGGGTGCCATGTGT
CCTACTCCAGAGAGGAGGGGGCCGGTCACTTGAGAAGACAGCCTTTATATTCTGTATGTGGCAGTGACATTGGTAGCCACACCTACCCAG
TGTCTACTAACCACAGTGCAGATAGCCCTTGGGTAGACCCAGGAAGTGTGAAGACAGACACTGCTGTTGCCAGACAACACTAGCAGAACG
ATGCTGGATTTGACAACAGTGTTTGCTAGGACGGCCCAGAGCTCATCACTGCAGTTTTATTAGAGTGCTTCTTTATCTTTAATGCAGTAT
CTTTGAGGCCTGTAACATCCTAGATAGTTGCCATCAAACAAGGACCGTCTCGCATTGAAAACAGATGTAAGAATTTCTCTTTCAGGCCCA
GAATCTGACAGTGCTTTGGCTTGGGTCATGAGCAGCGGGGAGTTGGGAAGAGATTTTTTTTTTTAGAGTTTTACATATTGGCAGGTTGTA

>In-frame_GPSM1_ENST00000429455_chr9_139251002_+_NUP214_ENST00000411637_chr9_134002911_+_7839nt
GGCGGTGGTGGCCCTGGGCACCTTGTGTCCTGCCTGCGCTCTGTGTGGCCAAGCACCCAGCGTGGCTCCCTGCTGCTGTGGAGACAGCCT
GTGATCCGCAGCATCCCGAGGGCCCCGTCTTCGGACGAGGAGTGCTTCTTTGACCTGTTGACCAAGTTCCAGAGCAGCCGCATGGACGAC
CAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAGCCCTCGATG
ACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGCGTGGGCAGC
CTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTCTTCAACATG
CTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGT
CTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAA
AATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTG
AGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAAT
GAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACT
GTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCT
TCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTT
CCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGT
ACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAA
GAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATT
GAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCT
TGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACA
AACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCA
TTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCA
CCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCT
TCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAG
TCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTC
TCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCA
TCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACC
TCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCT
GGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGA
TCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAG
GCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATT
GCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTG
CGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACA
ACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAA
AGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGAT
GTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACC
CTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAG
ACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTG
TTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTC
TTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGAC
TTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTT
CAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTG
GTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTT
GCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAG
ATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAAT
AACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCT
AACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCT
TCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGG
ACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGC
CAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCA
TCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTG
GAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGC
CAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCA
GGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCA
GCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACA
TCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCT
GCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGC
AGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAG
CAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAAC
TCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAG
GCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAA
ACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCT
GGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCC
ACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACA
CCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCA
GTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCT
TCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCT
CCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGT
GGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGGTTTTGGGTCTAGTAATACTGGTTCTGTG
TTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCCTCTTCCAGTGGTAGCGTGTTTGGGTCTGGAAACACTGGA
AGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGATGCAGCCAACAAAAACCCATTCAGCTCGGCCAGTGGGGGCTTT
GGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCCAAGACATTTGGTGGATTTGCCAGCTCGTCGTTTGGAGAG
CAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCCCAAGGCTTTGGGTTTTCCTCTCCAAACAAAACAGGTGGCTTC
GGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGGTTTGGAGGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTT
ACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACTGCAGCTGCCAGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGC
AACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGATCACTGTCCCAACAGACTTCTGGTTTTGGGACCCAGAGT
AGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGGTCAAATAACTCGTCTGTCCAGGGTTTTGGTGGCTGGCGAAGC
TGAGGGCGTGTCAGCAGGCCTTTCGATCCCTGGGACCAACCGCATCCTCAGCTTCTTCCCCGAGAAATGCTGGAGCAGGCTGTTCAGACC
GACGTTGCCATCAAAACACATACACCCAGAAAGAAACAACAGAAACCAAAACTCACAAGGCGCATGATTACTTGTTTTATATTTCATGTT
GGGTTTTCCCTCCCACTATTAAACAGTCTGTTTCCGTACAGAACGTATGTGGGTTTTTTCAGATCACAGCCAAGAAGATTGCCCCGTTTC
TGTGGCTCTGAGAAGCCAGCAGAGCCTCCATCAGCCAGAACACTGTGTCTTCAAGGATGGCATCAGAAGTCACCAGCGTCGGGTGTTGAT
AAACAGCATCGAATGTGCCGTGGTCTCACTTGGACCTAGCGCCCTCCACATAGGGAAGAGGTTGAATGCTGGTGGGTCATCTTTTTGAGG
CTGAAACTTGGTTATCTCCTCTCCTTGTTCTTTTAGCCATTGTGTATCAGGACCATCCAAGGACGCACTCTGCGATTGAGTGGAGGCAGA
GGAAGCCACTCATGCCAGCAGCAGTTGAGTTTCAGAAGCAGCCATAGCGCTTTTCAGTACAGTACAATAGTAGCCAGCGTGAGGCAGGAC
AGTGCTGCGCCTTAGCCGGCCTTGGCTCTCATCTCCATGTGGCTCTTGGGTGCCATGTGTCCTACTCCAGAGAGGAGGGGGCCGGTCACT
TGAGAAGACAGCCTTTATATTCTGTATGTGGCAGTGACATTGGTAGCCACACCTACCCAGTGTCTACTAACCACAGTGCAGATAGCCCTT
GGGTAGACCCAGGAAGTGTGAAGACAGACACTGCTGTTGCCAGACAACACTAGCAGAACGATGCTGGATTTGACAACAGTGTTTGCTAGG
ACGGCCCAGAGCTCATCACTGCAGTTTTATTAGAGTGCTTCTTTATCTTTAATGCAGTATCTTTGAGGCCTGTAACATCCTAGATAGTTG
CCATCAAACAAGGACCGTCTCGCATTGAAAACAGATGTAAGAATTTCTCTTTCAGGCCCAGAATCTGACAGTGCTTTGGCTTGGGTCATG
AGCAGCGGGGAGTTGGGAAGAGATTTTTTTTTTTAGAGTTTTACATATTGGCAGGTTGTATTTTTTTAATGTTTTAATAAAAGTTTGACA

>In-frame_GPSM1_ENST00000429455_chr9_139251002_+_NUP214_ENST00000451030_chr9_134002911_+_6910nt
GGCGGTGGTGGCCCTGGGCACCTTGTGTCCTGCCTGCGCTCTGTGTGGCCAAGCACCCAGCGTGGCTCCCTGCTGCTGTGGAGACAGCCT
GTGATCCGCAGCATCCCGAGGGCCCCGTCTTCGGACGAGGAGTGCTTCTTTGACCTGTTGACCAAGTTCCAGAGCAGCCGCATGGACGAC
CAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGGAGGACAGGATCGCCCAGCCCTCGATG
ACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGGACGACCAGCGGGCCAGCGTGGGCAGC
CTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGGAGCCGGGGGACGACTTCTTCAACATG
CTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTGAGGAATTGCCCAAGGAACGCTCGAGT
CTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAA
AATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGAAATTCCCAATCCATCACCTGGCCTTG
AGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAAT
GAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGGTGATTGATATGAAGTGGAACCCCACT
GTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCT
TCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAACAGAATGGAACTGTGGTCCAGTATCTT
CCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGT
ACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGGTGATGGCTCTACTACCGAAAAAAGAA
GAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATT
GAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGACAAAGTGATCAGATTAATTGGGAATCT
TGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACA
AACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTACTTTCAACAGATGGTGTGCTTTGTCCA
TTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCA
CCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAGCTGCAGCCCCTGCCTCTCTGCCACCT
TCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAG
TCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAGCCCCAGGCCCTGGCCCATCAACCTTC
TCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCA
TCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAATGAAGCCCTCCTTCCCACCCTCAACC
TCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCG
CCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAG
TCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATA
ACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCA
GATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTC
CAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAG
TCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAAT
CGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAG
TATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTG
CTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTG
GATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTT
GACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTG
TCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGA
TCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCA
CGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTG
CCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAA
ATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCG
CAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTC
CCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAA
ACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCA
GCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAG
TTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCA
CAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCT
GAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCT
GGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAG
ACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGT
ACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACA
TCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCA
GGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACA
GTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCA
GCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAG
GTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAA
GAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCA
GCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCT
GCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCT
GCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAG
CTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAG
ACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGG
GTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGG
TTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGT
AGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGT
CCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCT
TCAGGTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCCTCTTCC
AGTGGTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGATGCAGCCAAC
AAAAACCCATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCCAAGACA
TTTGGTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCCCAAGGCTTT
GGGTTTTCCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGGTTTGGA
GGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACTGCAGCTGCC
AGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGATCACTG
TCCCAACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGGTCAAATAAC
TCGTCTGTCCAGGGTTTTGGTGGCTGGCGAAGCTGAGGGCGTGTCAGCAGGCCTTTCGATCCCTGGGACCAACCGCATCCTCAGCTTCTT
CCCCGAGAAATGCTGGAGCAGGCTGTTCAGACCGACGTTGCCATCAAAACACATACACCCAGAAAGAAACAACAGAAACCAAAACTCACA

>In-frame_GPSM1_ENST00000392944_chr9_139251002_+_NUP214_ENST00000359428_chr9_134002911_+_7992nt
CTGTGTAGGGCATGGACACAGGGAGCTCATGGCAGGGCTGACACAGGGTGTGGTGGGCACAGGGACAGGAGGCACGGGAGGCTTCCCGGG
ATGTCTGGGAAGTGTTCCAGGCCAAGGCTGGGGAGGCTGGCCCAGGGCAGGTGACGGACAGAGGCCTGGACTGGGGTAGCACCCATGAGA
GGGGAGAAGTCCGGGGCAGTCGGCGGGTGCCGAGGAGCATCCCGAGGGCCCCGTCTTCGGACGAGGAGTGCTTCTTTGACCTGTTGACCA
AGTTCCAGAGCAGCCGCATGGACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGG
AGGACAGGATCGCCCAGCCCTCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGG
ACGACCAGCGGGCCAGCGTGGGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGG
AGCCGGGGGACGACTTCTTCAACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTG
AGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTT
TTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGA
AATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTT
TTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGG
TGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAA
CAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAAC
AGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCA
GAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGG
TGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGAC
AGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGAC
AAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGC
CCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTAC
TTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCAT
TAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAG
CTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGT
TCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAG
CCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCAT
CAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAA
TGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTA
GCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAG
CACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAA
TGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGC
AGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAG
CCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTT
TGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAG
CCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTC
AGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAAC
AAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGA
GGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTT
CCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCT
TGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCA
CTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCC
AGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTC
CTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTT
CAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTC
CTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGA
CTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTT
CAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCC
TTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTT
CAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACAC
CGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCA
AACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTA
GCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGT
TTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGG
CTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGA
AGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTG
GCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTG
GAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGT
CATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGC
CTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGC
AAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAG
CACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTG
GGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGT
CCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCA
GTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCG
CACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAG
CTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTG
TCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCT
TTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCA
ACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCT
CTGGGTTCAGCTTTTGCCAAGCTTCAGGTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCT
TTGGCCAGCAATCATCCTCTTCCAGTGGTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAA
AACCCAGTCAGGATGCAGCCAACAAAAACCCATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTAT
TTGGAAACAGTGGGGCCAAGACATTTGGTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAG
GAAGTGTGGCATCCCAAGGCTTTGGGTTTTCCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTT
TTGGGGGATCCCCTGGGTTTGGAGGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGT
TCGGAGAGGGCACTGCAGCTGCCAGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGA
ATGCCCCCACTTTCGGATCACTGTCCCAACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAG
GGTTCAGCTTTGGGTCAAATAACTCGTCTGTCCAGGGTTTTGGTGGCTGGCGAAGCTGAGGGCGTGTCAGCAGGCCTTTCGATCCCTGGG
ACCAACCGCATCCTCAGCTTCTTCCCCGAGAAATGCTGGAGCAGGCTGTTCAGACCGACGTTGCCATCAAAACACATACACCCAGAAAGA
AACAACAGAAACCAAAACTCACAAGGCGCATGATTACTTGTTTTATATTTCATGTTGGGTTTTCCCTCCCACTATTAAACAGTCTGTTTC
CGTACAGAACGTATGTGGGTTTTTTCAGATCACAGCCAAGAAGATTGCCCCGTTTCTGTGGCTCTGAGAAGCCAGCAGAGCCTCCATCAG
CCAGAACACTGTGTCTTCAAGGATGGCATCAGAAGTCACCAGCGTCGGGTGTTGATAAACAGCATCGAATGTGCCGTGGTCTCACTTGGA
CCTAGCGCCCTCCACATAGGGAAGAGGTTGAATGCTGGTGGGTCATCTTTTTGAGGCTGAAACTTGGTTATCTCCTCTCCTTGTTCTTTT
AGCCATTGTGTATCAGGACCATCCAAGGACGCACTCTGCGATTGAGTGGAGGCAGAGGAAGCCACTCATGCCAGCAGCAGTTGAGTTTCA
GAAGCAGCCATAGCGCTTTTCAGTACAGTACAATAGTAGCCAGCGTGAGGCAGGACAGTGCTGCGCCTTAGCCGGCCTTGGCTCTCATCT
CCATGTGGCTCTTGGGTGCCATGTGTCCTACTCCAGAGAGGAGGGGGCCGGTCACTTGAGAAGACAGCCTTTATATTCTGTATGTGGCAG
TGACATTGGTAGCCACACCTACCCAGTGTCTACTAACCACAGTGCAGATAGCCCTTGGGTAGACCCAGGAAGTGTGAAGACAGACACTGC
TGTTGCCAGACAACACTAGCAGAACGATGCTGGATTTGACAACAGTGTTTGCTAGGACGGCCCAGAGCTCATCACTGCAGTTTTATTAGA
GTGCTTCTTTATCTTTAATGCAGTATCTTTGAGGCCTGTAACATCCTAGATAGTTGCCATCAAACAAGGACCGTCTCGCATTGAAAACAG
ATGTAAGAATTTCTCTTTCAGGCCCAGAATCTGACAGTGCTTTGGCTTGGGTCATGAGCAGCGGGGAGTTGGGAAGAGATTTTTTTTTTT

>In-frame_GPSM1_ENST00000392944_chr9_139251002_+_NUP214_ENST00000411637_chr9_134002911_+_7955nt
CTGTGTAGGGCATGGACACAGGGAGCTCATGGCAGGGCTGACACAGGGTGTGGTGGGCACAGGGACAGGAGGCACGGGAGGCTTCCCGGG
ATGTCTGGGAAGTGTTCCAGGCCAAGGCTGGGGAGGCTGGCCCAGGGCAGGTGACGGACAGAGGCCTGGACTGGGGTAGCACCCATGAGA
GGGGAGAAGTCCGGGGCAGTCGGCGGGTGCCGAGGAGCATCCCGAGGGCCCCGTCTTCGGACGAGGAGTGCTTCTTTGACCTGTTGACCA
AGTTCCAGAGCAGCCGCATGGACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGG
AGGACAGGATCGCCCAGCCCTCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGG
ACGACCAGCGGGCCAGCGTGGGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGG
AGCCGGGGGACGACTTCTTCAACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTG
AGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTT
TTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGA
AATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTT
TTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGG
TGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAA
CAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAAC
AGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCA
GAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGG
TGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGAC
AGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGAC
AAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGC
CCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTAC
TTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCAT
TAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAG
CTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGT
TCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAG
CCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCAT
CAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAA
TGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAATAGCTCCCAGAGCGCACCCCCGATGTCGCCATTCT
CTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAGCACCACCTAGTTCCGTGCCATTGAAGTCCTCAG
TCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCCCTC
CAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAAAGCAGGGACATCAGTGGAAAGATTCAGATCCTG
TAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGG
GCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTCTTTTGGAGATTAAAGAGACCACAGAGTCGCTTC
ATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTGACT
CTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGCTTCAGGAAATTCGGCGCCTTCATCAGTATGTGA
AATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTGTGC
CAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAACAGAGGAAGAGGCTGAATCACCTGGTGGATAGTC
TTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACAGTG
ACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAATCCTTGCCCAAAGTACCAGCCAAACTGTCCCCCA
TGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAGCCT
TTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCTCCCAGTCTCTGGAGAGTGAAGATGCACGGACGT
CCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCCATG
CAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAACTTCAGTGGCTACATCTGCTAGCAAAATTATTC
CTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGGCAG
CTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTTTGACTGAATCAACGTTGAAGAATGTCCCTCAAG
TGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACACCTC
ACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATTCCCTTAAGCCATCTGGGCCTACACCAGCATCCG
GTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCAGCA
AGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAACACCGTCTTCTAATTTCACTGCTGCACAAGGGG
CAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAAGCT
CACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCATCTAGCAGCAGACCTGTGGCACCTTCTGGAACTG
CTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGG
GAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATAAGGCTTCATCCACAAGCCTAACTAGTACCCAGC
CAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCTCTG
CAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTTTTGGCAGTCTGCCAGTCACCAGTGCAGGATCCT
CTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGCCCC
CATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACATTGTCATTTGGTAGCCTCCTGAGTTCAGCAACTA
CCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAG
CATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTCCGCAAACTTCTGACTCTGTTAAAAAAGAACCTG
TTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCACCA
CGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGCCTGGGCAGACTGCTGTCACAGCAGCTGCTATCT
CAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAGAGG
CAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTGCCAGTTCTAGCTCAGCTTTCAACCAGCTCACCA
ACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTGGTA
GCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCCCAGCTTTTGGTACCACAGCCCCAGGGGTCTTTG
GACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTT
CCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTGTCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCA
GTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCT
TTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAACCTCTGGGTTCAGCTTTTGCCAAGCTTCAGGTT
TTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCCTCTTCCAGTGGTA
GCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAGGAAAACCCAGTCAGGATGCAGCCAACAAAAACC
CATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCCAAGACATTTGGTG
GATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAGGAGGAAGTGTGGCATCCCAAGGCTTTGGGTTTT
CCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGGTTTGGAGGGGTGC
CAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGCACTGCAGCTGCCAGCGCAG
GAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGATCACTGTCCCAAC
AGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAGGAGGGTTCAGCTTTGGGTCAAATAACTCGTCTG
TCCAGGGTTTTGGTGGCTGGCGAAGCTGAGGGCGTGTCAGCAGGCCTTTCGATCCCTGGGACCAACCGCATCCTCAGCTTCTTCCCCGAG
AAATGCTGGAGCAGGCTGTTCAGACCGACGTTGCCATCAAAACACATACACCCAGAAAGAAACAACAGAAACCAAAACTCACAAGGCGCA
TGATTACTTGTTTTATATTTCATGTTGGGTTTTCCCTCCCACTATTAAACAGTCTGTTTCCGTACAGAACGTATGTGGGTTTTTTCAGAT
CACAGCCAAGAAGATTGCCCCGTTTCTGTGGCTCTGAGAAGCCAGCAGAGCCTCCATCAGCCAGAACACTGTGTCTTCAAGGATGGCATC
AGAAGTCACCAGCGTCGGGTGTTGATAAACAGCATCGAATGTGCCGTGGTCTCACTTGGACCTAGCGCCCTCCACATAGGGAAGAGGTTG
AATGCTGGTGGGTCATCTTTTTGAGGCTGAAACTTGGTTATCTCCTCTCCTTGTTCTTTTAGCCATTGTGTATCAGGACCATCCAAGGAC
GCACTCTGCGATTGAGTGGAGGCAGAGGAAGCCACTCATGCCAGCAGCAGTTGAGTTTCAGAAGCAGCCATAGCGCTTTTCAGTACAGTA
CAATAGTAGCCAGCGTGAGGCAGGACAGTGCTGCGCCTTAGCCGGCCTTGGCTCTCATCTCCATGTGGCTCTTGGGTGCCATGTGTCCTA
CTCCAGAGAGGAGGGGGCCGGTCACTTGAGAAGACAGCCTTTATATTCTGTATGTGGCAGTGACATTGGTAGCCACACCTACCCAGTGTC
TACTAACCACAGTGCAGATAGCCCTTGGGTAGACCCAGGAAGTGTGAAGACAGACACTGCTGTTGCCAGACAACACTAGCAGAACGATGC
TGGATTTGACAACAGTGTTTGCTAGGACGGCCCAGAGCTCATCACTGCAGTTTTATTAGAGTGCTTCTTTATCTTTAATGCAGTATCTTT
GAGGCCTGTAACATCCTAGATAGTTGCCATCAAACAAGGACCGTCTCGCATTGAAAACAGATGTAAGAATTTCTCTTTCAGGCCCAGAAT
CTGACAGTGCTTTGGCTTGGGTCATGAGCAGCGGGGAGTTGGGAAGAGATTTTTTTTTTTAGAGTTTTACATATTGGCAGGTTGTATTTT

>In-frame_GPSM1_ENST00000392944_chr9_139251002_+_NUP214_ENST00000451030_chr9_134002911_+_7026nt
CTGTGTAGGGCATGGACACAGGGAGCTCATGGCAGGGCTGACACAGGGTGTGGTGGGCACAGGGACAGGAGGCACGGGAGGCTTCCCGGG
ATGTCTGGGAAGTGTTCCAGGCCAAGGCTGGGGAGGCTGGCCCAGGGCAGGTGACGGACAGAGGCCTGGACTGGGGTAGCACCCATGAGA
GGGGAGAAGTCCGGGGCAGTCGGCGGGTGCCGAGGAGCATCCCGAGGGCCCCGTCTTCGGACGAGGAGTGCTTCTTTGACCTGTTGACCA
AGTTCCAGAGCAGCCGCATGGACGACCAGCGTTGTCCCCTGGACGATGGCCAGGCCGGGGCTGCCGAGGCCACGGCCGCCCCCACCCTGG
AGGACAGGATCGCCCAGCCCTCGATGACGGCCTCGCCCCAGACCGAGGAATTCTTCGACCTCATCGCCAGCTCCCAGAGCCGCCGGCTGG
ACGACCAGCGGGCCAGCGTGGGCAGCCTGCCGGGGCTGCGAATCACCCACAGCAATGCAGGGCACCTCCGAGGCCACGGCGAGCCCCAGG
AGCCGGGGGACGACTTCTTCAACATGCTCATCAAGTACCAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTG
AGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCTTCGCTGGTGGAGCCAGTGGCTTGCAGATTT
TTCCTACTAAAAATCTTCTTATTCAAAATAAACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGA
AATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGATGTCCAGTGAATATGGTTCCATTATTGCTT
TTTTTGATGTTCGCACATTCTCAAATGAGGCTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGG
TGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATGGTAGTATTGCTGTCCTGCAAGTCACGGAAA
CAGTGAAAGTATGTGCAACTCTTCCTTCCACGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAAC
AGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTCCTCCGTTTTATGAGTCAGATCATCCTGTCA
GAGTTCTGGATGTGCTGTGGATTGGTACCTACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGG
TGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGGAGCCCTGTTATGGCAGCTGCACGGAGAGAC
AGCATCATTACTACCTCAGTTACATTGAGGAATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGAC
AAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGCCTGTGACAGACAAGAGTGATGACTCCTTGC
CCATGGGAGTTGTCGTAGACTATACAAACCAAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTAC
TTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGTCTCTCATCAAAACACCAGAGCGACTTTCAT
TAGAAGGAGAGCGACAGCCCAAGTCACCAGGAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAG
CTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTTTGCTTCCTGCTGGTGGAGCCCCCACTGTGT
TCTCCTTTGGTTCTTCATCTTTGAAGTCATCTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAG
CCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCCCCACCCCTGCAGCGTCTCCTGTGGCTCCAT
CAGCTGCTTCATTCTCCTTTGGATCATCTGGTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAA
TGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTACTGCTGCAGCTACCTCTACTCCTGTTAGTA
GCTCCCAGAGCGCACCCCCGATGTCGCCATTCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAG
CACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGATCTGCTCAGGGCAGTTCAAGCCCAGTGCCCT
CAATGGTACAGAAATCACCCAGGATAACCCCTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAA
AGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTGCACACTTTCAGAAGGAGTTGGAAGAGTTAA
AAGCCCGAACTTCCAAAGCCTGTTTCCAAGTGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTC
TTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAACTTTACTTGAGGGCTTTGCTGGTGTTGAGG
AAGCCAGAGAACAAAATGAAAGAAATCGTGACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGC
TTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATGTTCTAGACTTGGAGTGGGATCAGCATCTGG
AACAAAAGAAAAAACAAAGGCACCTGCTTGTGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAAC
AGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGACTTCCCTGTGGAGCCTGTCCTCGGCTGTTC
CTTCCCAGAGCAGCATTCACAGTTTTGACAGTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAAT
CCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCTTGGCCAAGAGGAAGACCCCACCAGTGAGAT
CCACTGCTCCAGCCAGCCTGTCTCGATCAGCCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCT
CCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTCAGGCCCCTCGGCACGCCCCCGTGGTTCGCA
CTCCTTCCATCCAGCCCAGTCTCTTGCCCCATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAA
CTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTGCCACGAAAACCGTGAAACATGGTGCACCTA
GTCCTTCCCACCCCATCTCAGCCCCGCAGGCAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTT
TGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATAACCCTGCAACCCCTTCTACAGCCATGGGTT
CTTCAGTGCCCTACTCCACAGCCAAAACACCTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATT
CCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTTCAGGGACAGCCAAGATAGAAACAGCTGTGA
CTTCAACCCCATCTGCTTCTGGGCAGTTCAGCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAA
CACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCCAGCCGGACGCATTCTCATCTGGTGGGGGAA
GCAAACCTTCTTATGAGGCCATTCCTGAAAGCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCAT
CTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGGAAACCCCACCGTCCAAGCTGGGAGAGCTTC
TGTTTCCAAGTTCTTTGGCTGGAGAGACTCTGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATA
AGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAGGGTTTAATTTTACTGCCCCCCCGGTGTTAG
GGAAGCACACGGAGCCCCCTGTGACATCCTCTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTT
TTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACATCTCTAAGTGCTGGCAAGACTAGTTTTTCAT
TTGGAAGCCAACAGACCAATAGCACAGTGCCCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACAT
TGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCAGAAGCACAGAAGAGGCCACTTCATCAGCTT
TGCCTGAGAAGCCAGGTGACAGTGAGGTCTCAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTC
CGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACTCTGGCACTGCAGCATCTAGTACTAGTCTTG
TAGCACTTTCTGCAGAGGCTACCCCAGCCACCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGC
CTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAACATCAAGTACCCCCATAGCCTCCAGCACCA
CGTCCATTGTTGCTCCCGGCCCATCTGCAGAGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTG
CCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCACGCCCGTGTTTGGGCAAGTGGCAGCCAGCA
CCGCACCAAGTCTGTTTGGGCAGCAGACTGGTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCC
CAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAGTCTTTGGGCAGTCGGCGAGCAGTGCTGCAA
GTGTCTTTTCCTTCAGTCAGCCTGGGTTCAGTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTG
TCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTCCCAACACAGGAGGGGGGCTGTTTGGCCAAA
GCAACGCTCCTGCTTTTGGGCAGAGTCCTGGCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAA
CCTCTGGGTTCAGCTTTTGCCAAGCTTCAGGTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGTCAAGCAGCCAGTACTGGTGGAATAG
TCTTTGGCCAGCAATCATCCTCTTCCAGTGGTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAG
GAAAACCCAGTCAGGATGCAGCCAACAAAAACCCATTCAGCTCGGCCAGTGGGGGCTTTGGATCCACAGCTACCTCAAATACCTCTAACC
TATTTGGAAACAGTGGGGCCAAGACATTTGGTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAG
GAGGAAGTGTGGCATCCCAAGGCTTTGGGTTTTCCTCTCCAAACAAAACAGGTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTA
CTTTTGGGGGATCCCCTGGGTTTGGAGGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAG
TGTTCGGAGAGGGCACTGCAGCTGCCAGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGCAACACCACATCCTTCGGCACGCTCGCGAGTC
AGAATGCCCCCACTTTCGGATCACTGTCCCAACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAG
GAGGGTTCAGCTTTGGGTCAAATAACTCGTCTGTCCAGGGTTTTGGTGGCTGGCGAAGCTGAGGGCGTGTCAGCAGGCCTTTCGATCCCT
GGGACCAACCGCATCCTCAGCTTCTTCCCCGAGAAATGCTGGAGCAGGCTGTTCAGACCGACGTTGCCATCAAAACACATACACCCAGAA
AGAAACAACAGAAACCAAAACTCACAAGGCGCATGATTACTTGTTTTATATTTCATGTTGGGTTTTCCCTCCCACTATTAAACAGTCTGT


Top

FusionGenePPI for GPSM1_NUP214


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GPSM1CCDC158, TRIP13, USHBP1, ZBED1, DAZAP2, GNAI1, OSTM1, USP9X, CUL3, PPP6R3, RALBP1, TRIM23, CBS, KANK2, GPSM1, GNAI3, MAP1LC3A, WDR83, NUMA1, UGP2, BRD4, SAPCD2, KLHL18, NTRK1, XPO1, DACH1NUP214ZFP36, XPO1, NUP107, NXF2, NXF1, XPO5, IPO5, G3BP1, G3BP2, RAE1, APC, HDAC4, HDAC5, HDAC9, NUP88, SMAD1, CLEC4G, SMAD2, SMAD3, SMAD4, SIRT7, RANBP2, CUL3, CUL2, NUPL2, NUP214, ACOT13, PNPT1, HSPA1L, VPS4B, S100A6, EEF1A1, STRIP1, RPL19, NDUFA7, ITGA4, SOX2, LMNA, FBXO6, CUL7, OBSL1, NUP62, CLEC11A, DDX19A, KCMF1, CFL1, CSRP1, DYNC1LI1, TRIM28, TXNDC9, NTRK1, IFI16, NUP85, NUP35, KPNB1, UBE2I, NUPL1, NUP153, SEH1L, C11orf30, CDH1, RAN, FXR2, EMILIN1, SERPINB2, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GPSM1_NUP214


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GPSM1_NUP214


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGPSM1C0236736Cocaine-Related Disorders1CTD_human