FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1531

FusionGeneSummary for ALG14_JAK1

check button Fusion gene summary
Fusion gene informationFusion gene name: ALG14_JAK1
Fusion gene ID: 1531
HgeneTgene
Gene symbol

ALG14

JAK1

Gene ID

199857

3716

Gene nameALG14, UDP-N-acetylglucosaminyltransferase subunitJanus kinase 1
SynonymsCMS15JAK1A|JAK1B|JTK3
Cytomap

1p21.3

1p31.3

Type of geneprotein-codingprotein-coding
DescriptionUDP-N-acetylglucosamine transferase subunit ALG14 homologtyrosine-protein kinase JAK1
Modification date2018051920180527
UniProtAcc

Q96F25

P23458

Ensembl transtripts involved in fusion geneENST00000370205, ENST00000495856, 
ENST00000342505, ENST00000465376, 
Fusion gene scores* DoF score3 X 2 X 2=129 X 8 X 4=288
# samples 310
** MAII scorelog2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(10/288*10)=-1.52606881166759
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ALG14 [Title/Abstract] AND JAK1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneJAK1

GO:0038110

interleukin-2-mediated signaling pathway

11909529

TgeneJAK1

GO:0046677

response to antibiotic

16280321


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-DK-AA6R-01AALG14chr1

95492685

-JAK1chr1

65313358

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000370205ENST00000342505ALG14chr1

95492685

-JAK1chr1

65313358

-
5CDS-5UTRENST00000370205ENST00000465376ALG14chr1

95492685

-JAK1chr1

65313358

-
intron-3CDSENST00000495856ENST00000342505ALG14chr1

95492685

-JAK1chr1

65313358

-
intron-5UTRENST00000495856ENST00000465376ALG14chr1

95492685

-JAK1chr1

65313358

-

Top

FusionProtFeatures for ALG14_JAK1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ALG14

Q96F25

JAK1

P23458

May be involved in protein N-glycosylation. May play arole in the second step of the dolichol-linked oligosaccharidepathway. May anchor the catalytic subunit ALG13 to the ER.{ECO:0000269|PubMed:16100110}. Tyrosine kinase of the non-receptor type, involved inthe IFN-alpha/beta/gamma signal pathway (PubMed:7615558). Kinasepartner for the interleukin (IL)-2 receptor (PubMed:11909529).{ECO:0000269|PubMed:11909529, ECO:0000269|PubMed:7615558}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneALG14chr1:95492685chr1:65313358ENST00000370205-341_3140217Topological domainLumenal
HgeneALG14chr1:95492685chr1:65313358ENST00000370205-344_24140217TransmembraneHelical
TgeneJAK1chr1:95492685chr1:65313358ENST00000342505-1125583_8555851155DomainProtein kinase 1
TgeneJAK1chr1:95492685chr1:65313358ENST00000342505-1125875_11535851155DomainProtein kinase 2
TgeneJAK1chr1:95492685chr1:65313358ENST00000342505-1125881_8895851155Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneALG14chr1:95492685chr1:65313358ENST00000370205-3425_216140217Topological domainCytoplasmic
TgeneJAK1chr1:95492685chr1:65313358ENST00000342505-112534_4205851155DomainFERM
TgeneJAK1chr1:95492685chr1:65313358ENST00000342505-1125439_5445851155DomainSH2


Top

FusionGeneSequence for ALG14_JAK1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ALG14_ENST00000370205_chr1_95492685_-_JAK1_ENST00000342505_chr1_65313358_-_710aa
MVCVLVLAAAAGAVAVFLILRIWVVLRSMDVTPRESLSILVVAGSGGHTTEILRLLGSLSNAYSPRHTVIADTDEMSANKINSFELDRAD
RDPSNMTTKYYIHRIPRSREVQQSWPSTVFTTLHSMWLSFPLIHRVKPDLGEHLGRGTRTHITSGTLMDYKDDEGTSEEKKIKVILKVLD
PSHRDISLAFFEAASMMRQVSHKHIVYLTGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNV
CTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERF
TESRCRPVTPSCKELADLMTRCMNTDPNQRPFFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRTD
PEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLTHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKETLPKNKNKINLKQQLKTAV
QICKGMDTLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKETYTVKDDRDSPVFWTAPECLMQSKFTIASDVWSFGVTLHELL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ALG14_ENST00000370205_chr1_95492685_-_JAK1_ENST00000342505_chr1_65313358_-_2130nt
ATGGTGTGCGTTCTCGTTCTAGCTGCGGCCGCAGGAGCTGTGGCGGTTTTCCTAATCCTGCGAATATGGGTAGTGCTTCGTTCCATGGAC
GTTACGCCCCGGGAGTCTCTCAGTATCTTGGTAGTGGCTGGGTCCGGTGGGCATACCACTGAGATCCTGAGGCTGCTTGGGAGCTTGTCC
AATGCCTACTCACCTAGACATTATGTCATTGCTGACACTGATGAAATGAGTGCCAATAAAATAAATTCTTTTGAACTAGATCGAGCTGAT
AGAGACCCTAGTAACATGTATACCAAATACTACATTCACCGAATTCCAAGAAGCCGGGAGGTTCAGCAGTCCTGGCCCTCCACCGTTTTC
ACCACCTTGCACTCCATGTGGCTCTCCTTTCCCCTAATTCACAGGGTGAAGCCAGATTTGGGCGAGCACCTTGGGAGAGGCACGAGAACA
CACATCTATTCTGGGACCCTGATGGATTACAAGGATGACGAAGGAACTTCTGAAGAGAAGAAGATAAAAGTGATCCTCAAAGTCTTAGAC
CCCAGCCACAGGGATATTTCCCTGGCCTTCTTCGAGGCAGCCAGCATGATGAGACAGGTCTCCCACAAACACATCGTGTACCTCTATGGC
GTCTGTGTCCGCGACGTGGAGAATATCATGGTGGAAGAGTTTGTGGAAGGGGGTCCTCTGGATCTCTTCATGCACCGGAAAAGCGATGTC
CTTACCACACCATGGAAATTCAAAGTTGCCAAACAGCTGGCCAGTGCCCTGAGCTACTTGGAGGATAAAGACCTGGTCCATGGAAATGTG
TGTACTAAAAACCTCCTCCTGGCCCGTGAGGGCATCGACAGTGAGTGTGGCCCATTCATCAAGCTCAGTGACCCCGGCATCCCCATTACG
GTGCTGTCTAGGCAAGAATGCATTGAACGAATCCCATGGATTGCTCCTGAGTGTGTTGAGGACTCCAAGAACCTGAGTGTGGCTGCTGAC
AAGTGGAGCTTTGGAACCACGCTCTGGGAAATCTGCTACAATGGCGAGATCCCCTTGAAAGACAAGACGCTGATTGAGAAAGAGAGATTC
TATGAAAGCCGGTGCAGGCCAGTGACACCATCATGTAAGGAGCTGGCTGACCTCATGACCCGCTGCATGAACTATGACCCCAATCAGAGG
CCTTTCTTCCGAGCCATCATGAGAGACATTAATAAGCTTGAAGAGCAGAATCCAGATATTGTTTCAGAAAAAAAACCAGCAACTGAAGTG
GACCCCACACATTTTGAAAAGCGCTTCCTAAAGAGGATCCGTGACTTGGGAGAGGGCCACTTTGGGAAGGTTGAGCTCTGCAGGTATGAC
CCCGAAGGGGACAATACAGGGGAGCAGGTGGCTGTTAAATCTCTGAAGCCTGAGAGTGGAGGTAACCACATAGCTGATCTGAAAAAGGAA
ATCGAGATCTTAAGGAACCTCTATCATGAGAACATTGTGAAGTACAAAGGAATCTGCACAGAAGACGGAGGAAATGGTATTAAGCTCATC
ATGGAATTTCTGCCTTCGGGAAGCCTTAAGGAATATCTTCCAAAGAATAAGAACAAAATAAACCTCAAACAGCAGCTAAAATATGCCGTT
CAGATTTGTAAGGGGATGGACTATTTGGGTTCTCGGCAATACGTTCACCGGGACTTGGCAGCAAGAAATGTCCTTGTTGAGAGTGAACAC
CAAGTGAAAATTGGAGACTTCGGTTTAACCAAAGCAATTGAAACCGATAAGGAGTATTACACCGTCAAGGATGACCGGGACAGCCCTGTG
TTTTGGTATGCTCCAGAATGTTTAATGCAATCTAAATTTTATATTGCCTCTGACGTCTGGTCTTTTGGAGTCACTCTGCATGAGCTGCTG
ACTTACTGTGATTCAGATTCTAGTCCCATGGCTTTGTTCCTGAAAATGATAGGCCCAACCCATGGCCAGATGACAGTCACAAGACTTGTG
AATACGTTAAAAGAAGGAAAACGCCTGCCGTGCCCACCTAACTGTCCAGATGAGGTTTATCAACTTATGAGGAAATGCTGGGAATTCCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ALG14_ENST00000370205_chr1_95492685_-_JAK1_ENST00000342505_chr1_65313358_-_3510nt
GACAGCGGCTGGTCCCCGGAAGTTGGACGCATGCGCCGTTTCTCTGCATGGTGTGCGTTCTCGTTCTAGCTGCGGCCGCAGGAGCTGTGG
CGGTTTTCCTAATCCTGCGAATATGGGTAGTGCTTCGTTCCATGGACGTTACGCCCCGGGAGTCTCTCAGTATCTTGGTAGTGGCTGGGT
CCGGTGGGCATACCACTGAGATCCTGAGGCTGCTTGGGAGCTTGTCCAATGCCTACTCACCTAGACATTATGTCATTGCTGACACTGATG
AAATGAGTGCCAATAAAATAAATTCTTTTGAACTAGATCGAGCTGATAGAGACCCTAGTAACATGTATACCAAATACTACATTCACCGAA
TTCCAAGAAGCCGGGAGGTTCAGCAGTCCTGGCCCTCCACCGTTTTCACCACCTTGCACTCCATGTGGCTCTCCTTTCCCCTAATTCACA
GGGTGAAGCCAGATTTGGGCGAGCACCTTGGGAGAGGCACGAGAACACACATCTATTCTGGGACCCTGATGGATTACAAGGATGACGAAG
GAACTTCTGAAGAGAAGAAGATAAAAGTGATCCTCAAAGTCTTAGACCCCAGCCACAGGGATATTTCCCTGGCCTTCTTCGAGGCAGCCA
GCATGATGAGACAGGTCTCCCACAAACACATCGTGTACCTCTATGGCGTCTGTGTCCGCGACGTGGAGAATATCATGGTGGAAGAGTTTG
TGGAAGGGGGTCCTCTGGATCTCTTCATGCACCGGAAAAGCGATGTCCTTACCACACCATGGAAATTCAAAGTTGCCAAACAGCTGGCCA
GTGCCCTGAGCTACTTGGAGGATAAAGACCTGGTCCATGGAAATGTGTGTACTAAAAACCTCCTCCTGGCCCGTGAGGGCATCGACAGTG
AGTGTGGCCCATTCATCAAGCTCAGTGACCCCGGCATCCCCATTACGGTGCTGTCTAGGCAAGAATGCATTGAACGAATCCCATGGATTG
CTCCTGAGTGTGTTGAGGACTCCAAGAACCTGAGTGTGGCTGCTGACAAGTGGAGCTTTGGAACCACGCTCTGGGAAATCTGCTACAATG
GCGAGATCCCCTTGAAAGACAAGACGCTGATTGAGAAAGAGAGATTCTATGAAAGCCGGTGCAGGCCAGTGACACCATCATGTAAGGAGC
TGGCTGACCTCATGACCCGCTGCATGAACTATGACCCCAATCAGAGGCCTTTCTTCCGAGCCATCATGAGAGACATTAATAAGCTTGAAG
AGCAGAATCCAGATATTGTTTCAGAAAAAAAACCAGCAACTGAAGTGGACCCCACACATTTTGAAAAGCGCTTCCTAAAGAGGATCCGTG
ACTTGGGAGAGGGCCACTTTGGGAAGGTTGAGCTCTGCAGGTATGACCCCGAAGGGGACAATACAGGGGAGCAGGTGGCTGTTAAATCTC
TGAAGCCTGAGAGTGGAGGTAACCACATAGCTGATCTGAAAAAGGAAATCGAGATCTTAAGGAACCTCTATCATGAGAACATTGTGAAGT
ACAAAGGAATCTGCACAGAAGACGGAGGAAATGGTATTAAGCTCATCATGGAATTTCTGCCTTCGGGAAGCCTTAAGGAATATCTTCCAA
AGAATAAGAACAAAATAAACCTCAAACAGCAGCTAAAATATGCCGTTCAGATTTGTAAGGGGATGGACTATTTGGGTTCTCGGCAATACG
TTCACCGGGACTTGGCAGCAAGAAATGTCCTTGTTGAGAGTGAACACCAAGTGAAAATTGGAGACTTCGGTTTAACCAAAGCAATTGAAA
CCGATAAGGAGTATTACACCGTCAAGGATGACCGGGACAGCCCTGTGTTTTGGTATGCTCCAGAATGTTTAATGCAATCTAAATTTTATA
TTGCCTCTGACGTCTGGTCTTTTGGAGTCACTCTGCATGAGCTGCTGACTTACTGTGATTCAGATTCTAGTCCCATGGCTTTGTTCCTGA
AAATGATAGGCCCAACCCATGGCCAGATGACAGTCACAAGACTTGTGAATACGTTAAAAGAAGGAAAACGCCTGCCGTGCCCACCTAACT
GTCCAGATGAGGTTTATCAACTTATGAGGAAATGCTGGGAATTCCAACCATCCAATCGGACAAGCTTTCAGAACCTTATTGAAGGATTTG
AAGCACTTTTAAAATAAGAAGCATGAATAACATTTAAATTCCACAGATTATCAAGTCCTTCTCCTGCAACAAATGCCCAAGTCATTTTTT
AAAAATTTCTAATGAAAGAAGTTTGTGTTCTGTCCAAAAAGTCACTGAACTCATACTTCAGTACATATACATGTATAAGGCACACTGTAG
TGCTTAATATGTGTAAGGACTTCCTCTTTAAATTTGGTACCAGTAACTTAGTGACACATAATGACAACCAAAATATTTGAAAGCACTTAA
GCACTCCTCCTTGTGGAAAGAATATACCACCATTTCATCTGGCTAGTTCACCATCACAACTGCATTACCAAAAGGGGATTTTTGAAAACG
AGGAGTTGACCAAAATAATATCTGAAGATGATTGCTTTTCCCTGCTGCCAGCTGATCTGAAATGTTTTGCTGGCACATTAATCATAGATA
AAGAAAGATTGATGGACTTAGCCCTCAAATTTCAGTATCTATACAGTACTAGACCATGCATTCTTAAAATATTAGATACCAGGTAGTATA
TATTGTTTCTGTACAAAAATGACTGTATTCTCTCACCAGTAGGACTTAAACTTTGTTTCTCCAGTGGCTTAGCTCCTGTTCCTTTGGGTG
ATCACTAGCACCCATTTTTGAGAAAGCTGGTTCTACATGGGGGGATAGCTGTGGAATAGATAATTTGCTGCATGTTAATTCTCAAGAACT
AAGCCTGTGCCAGTGCTTTCCTAAGCAGTATACCTTTAATCAGAACTCATTCCCAGAACCTGGATGCTATTACACATGCTTTTAAGAAAC
GTCAATGTATATCCTTTTATAACTCTACCACTTTGGGGCAAGCTATTCCAGCACTGGTTTTGAATGCTGTATGCAACCAGTCTGAATACC
ACATACGCTGCACTGTTCTTAGAGGGTTTCCATACTTACCACCGATCTACAAGGGTTGATCCCTGTTTTTACCATCAATCATCACCCTGT
GGTGCAACACTTGAAAGACCCGGCTAGAGGCACTATGGACTTCAGGATCCACTAGACAGTTTTCAGTTTGCTTGGAGGTAGCTGGGTAAT
CAAAAATGTTTAGTCATTGATTCAATGTGAACGATTACGGTCTTTATGACCAAGAGTCTGAAAATCTTTTTGTTATGCTGTTTAGTATTC
GTTTGATATTGTTACTTTTCACCTGTTGAGCCCAAATTCAGGATTGGTTCAGTGGCAGCAATGAAGTTGCCATTTAAATTTGTTCATAGC
CTACATCACCAAGGTCTCTGTGTCAAACCTGTGGCCACTCTATATGCACTTTGTTTACTCTTTATACAAATAAATATACTAAAGACTTTA


Top

FusionGenePPI for ALG14_JAK1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ALG14HAUS7, FADS3JAK1ATIC, ARRB1, ELF3, STAT3, ABL1, ABL2, GNB2L1, IL27RA, PRMT5, SHB, IL10RA, PTK2B, TEC, BTK, IRS1, IGF1R, BRCA1, IL2RB, IL6ST, STAM2, PTPN11, TYK2, TNFRSF1A, STAT5B, STAT5A, IRS2, ELP2, IL21R, GRB2, CSF3R, IL5RA, IL9R, PTPN6, PLAUR, IFNAR2, IL4R, IFNGR1, TSHR, GHR, RAF1, AGO4, CSF2RB, TIRAP, HIST3H3, SIRT1, SOCS1, SOCS3, EGFR, TOP1, STAT6, EIF4A3, MAGOH, SMURF1, IL2RG, JAK1, EIF2AK2, HSP90AA1, ERBB2, INSR, STAT1, UBL4A, JAK3, PLCG1, NPM1, PLA2G4A, MDM2, NOC2L, PML, TAGLN, DTX3L, DSP, FLG2, RNF125, TGFBR2, LPAR6, NTRK1, KRAS, CTDSPL2, FAM46A, KIF24, EID1, CFTR, OSMR, LAMP2, LAMP3, IL13RA2, MANSC1, APLNR, MAS1, HAVCR2, SLC15A1, LRRIQ1, CYLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ALG14_JAK1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneJAK1P23458DB08877RuxolitinibTyrosine-protein kinase JAK1small moleculeapproved
TgeneJAK1P23458DB08895TofacitinibTyrosine-protein kinase JAK1small moleculeapproved|investigational

Top

RelatedDiseases for ALG14_JAK1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneALG14C4015596MYASTHENIC SYNDROME, CONGENITAL, 151UNIPROT