FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15269

FusionGeneSummary for GPR158_MYO16

check button Fusion gene summary
Fusion gene informationFusion gene name: GPR158_MYO16
Fusion gene ID: 15269
HgeneTgene
Gene symbol

GPR158

MYO16

Gene ID

57512

23026

Gene nameG protein-coupled receptor 158myosin XVI
Synonyms-MYAP3|MYR8|Myo16b|NYAP3|PPP1R107
Cytomap

10p12.1

13q33.3

Type of geneprotein-codingprotein-coding
Descriptionprobable G-protein coupled receptor 158unconventional myosin-XVIMYO16 variant proteinmyosin heavy chain Myr 8neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 3neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 3protein phosphatase 1, regulatory subunit 10
Modification date2018032920180519
UniProtAcc

Q5T848

Q9Y6X6

Ensembl transtripts involved in fusion geneENST00000376351, ENST00000490549, 
ENST00000356711, ENST00000251041, 
ENST00000357550, ENST00000457511, 
ENST00000467639, 
Fusion gene scores* DoF score2 X 2 X 2=810 X 8 X 9=720
# samples 210
** MAII scorelog2(2/8*10)=1.32192809488736log2(10/720*10)=-2.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: GPR158 [Title/Abstract] AND MYO16 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-C8-A1HO-01AGPR158chr10

25465251

+MYO16chr13

109644724

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000376351ENST00000356711GPR158chr10

25465251

+MYO16chr13

109644724

+
In-frameENST00000376351ENST00000251041GPR158chr10

25465251

+MYO16chr13

109644724

+
In-frameENST00000376351ENST00000357550GPR158chr10

25465251

+MYO16chr13

109644724

+
In-frameENST00000376351ENST00000457511GPR158chr10

25465251

+MYO16chr13

109644724

+
5CDS-intronENST00000376351ENST00000467639GPR158chr10

25465251

+MYO16chr13

109644724

+
intron-3CDSENST00000490549ENST00000356711GPR158chr10

25465251

+MYO16chr13

109644724

+
intron-3CDSENST00000490549ENST00000251041GPR158chr10

25465251

+MYO16chr13

109644724

+
intron-3CDSENST00000490549ENST00000357550GPR158chr10

25465251

+MYO16chr13

109644724

+
intron-3CDSENST00000490549ENST00000457511GPR158chr10

25465251

+MYO16chr13

109644724

+
intron-intronENST00000490549ENST00000467639GPR158chr10

25465251

+MYO16chr13

109644724

+

Top

FusionProtFeatures for GPR158_MYO16


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GPR158

Q5T848

MYO16

Q9Y6X6

Orphan receptor.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMYO16chr10:25465251chr13:109644724ENST00000251041+18241389_1671767941Compositional biasPro-rich
TgeneMYO16chr10:25465251chr13:109644724ENST00000356711+19351389_16717671859Compositional biasPro-rich
TgeneMYO16chr10:25465251chr13:109644724ENST00000357550+18341389_16717671859Compositional biasPro-rich
TgeneMYO16chr10:25465251chr13:109644724ENST00000251041+18241147_1176767941DomainIQ
TgeneMYO16chr10:25465251chr13:109644724ENST00000356711+19351147_11767671859DomainIQ
TgeneMYO16chr10:25465251chr13:109644724ENST00000357550+18341147_11767671859DomainIQ
TgeneMYO16chr10:25465251chr13:109644724ENST00000251041+18241111_1377767941RegionInvolved in CYFIP1- and NCKAP1-binding
TgeneMYO16chr10:25465251chr13:109644724ENST00000356711+19351111_13777671859RegionInvolved in CYFIP1- and NCKAP1-binding
TgeneMYO16chr10:25465251chr13:109644724ENST00000357550+18341111_13777671859RegionInvolved in CYFIP1- and NCKAP1-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+11124_4173001216Topological domainExtracellular
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111439_4513001216Topological domainCytoplasmic
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111473_4833001216Topological domainExtracellular
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111507_5283001216Topological domainCytoplasmic
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111550_5793001216Topological domainExtracellular
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111601_6133001216Topological domainCytoplasmic
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111635_6433001216Topological domainExtracellular
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111665_12153001216Topological domainCytoplasmic
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111418_4383001216TransmembraneHelical%3B Name%3D1
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111452_4723001216TransmembraneHelical%3B Name%3D2
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111484_5063001216TransmembraneHelical%3B Name%3D3
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111529_5493001216TransmembraneHelical%3B Name%3D4
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111580_6003001216TransmembraneHelical%3B Name%3D5
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111614_6343001216TransmembraneHelical%3B Name%3D6
HgeneGPR158chr10:25465251chr13:109644724ENST00000376351+111644_6643001216TransmembraneHelical%3B Name%3D7
TgeneMYO16chr10:25465251chr13:109644724ENST00000251041+1824401_1145767941DomainMyosin motor
TgeneMYO16chr10:25465251chr13:109644724ENST00000356711+1935401_11457671859DomainMyosin motor
TgeneMYO16chr10:25465251chr13:109644724ENST00000357550+1834401_11457671859DomainMyosin motor
TgeneMYO16chr10:25465251chr13:109644724ENST00000251041+1824497_504767941Nucleotide bindingATP
TgeneMYO16chr10:25465251chr13:109644724ENST00000356711+1935497_5047671859Nucleotide bindingATP
TgeneMYO16chr10:25465251chr13:109644724ENST00000357550+1834497_5047671859Nucleotide bindingATP
TgeneMYO16chr10:25465251chr13:109644724ENST00000251041+1824125_154767941RepeatANK 3
TgeneMYO16chr10:25465251chr13:109644724ENST00000251041+1824158_189767941RepeatANK 4
TgeneMYO16chr10:25465251chr13:109644724ENST00000251041+1824191_217767941RepeatANK 5
TgeneMYO16chr10:25465251chr13:109644724ENST00000251041+1824221_250767941RepeatANK 6
TgeneMYO16chr10:25465251chr13:109644724ENST00000251041+1824254_283767941RepeatANK 7
TgeneMYO16chr10:25465251chr13:109644724ENST00000251041+182459_88767941RepeatANK 1
TgeneMYO16chr10:25465251chr13:109644724ENST00000251041+182492_121767941RepeatANK 2
TgeneMYO16chr10:25465251chr13:109644724ENST00000356711+1935125_1547671859RepeatANK 3
TgeneMYO16chr10:25465251chr13:109644724ENST00000356711+1935158_1897671859RepeatANK 4
TgeneMYO16chr10:25465251chr13:109644724ENST00000356711+1935191_2177671859RepeatANK 5
TgeneMYO16chr10:25465251chr13:109644724ENST00000356711+1935221_2507671859RepeatANK 6
TgeneMYO16chr10:25465251chr13:109644724ENST00000356711+1935254_2837671859RepeatANK 7
TgeneMYO16chr10:25465251chr13:109644724ENST00000356711+193559_887671859RepeatANK 1
TgeneMYO16chr10:25465251chr13:109644724ENST00000356711+193592_1217671859RepeatANK 2
TgeneMYO16chr10:25465251chr13:109644724ENST00000357550+1834125_1547671859RepeatANK 3
TgeneMYO16chr10:25465251chr13:109644724ENST00000357550+1834158_1897671859RepeatANK 4
TgeneMYO16chr10:25465251chr13:109644724ENST00000357550+1834191_2177671859RepeatANK 5
TgeneMYO16chr10:25465251chr13:109644724ENST00000357550+1834221_2507671859RepeatANK 6
TgeneMYO16chr10:25465251chr13:109644724ENST00000357550+1834254_2837671859RepeatANK 7
TgeneMYO16chr10:25465251chr13:109644724ENST00000357550+183459_887671859RepeatANK 1
TgeneMYO16chr10:25465251chr13:109644724ENST00000357550+183492_1217671859RepeatANK 2


Top

FusionGeneSequence for GPR158_MYO16


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GPR158_ENST00000376351_chr10_25465251_+_MYO16_ENST00000356711_chr13_109644724_+_1392aa
MGAMAYPLLLCLLLAQLGLGAVGASRDPQGRPDSPRERTPKGKPHAQQPGRASASDSSAPWSRSTDGTILAQKLAEEVPMDVASYLYTGD
SHQLKRANCSGRYELAGLPGKWPALASAHPSLHRALDTLTHATNFLNVMLQSNKSREQNLQDDLDWYQALVWSLLEGEPSISRAAITFST
DSLSAPAPQVFLQATREESRILLQDLSSSAPHLANATLETEWFHGLRRKWRPHLHRRGPNQGPRGLGHSWRRKDGLGGDKSHFKWSPPTL
ECENGSYKPGWLVTLSSAIYGLQPNLVPEFSMQTLDIGILDIFGFEEFQKNEFEQLCVNMTNEKMHHTINEVLFLHEQVECVQEGVTMET
ATSPGNQNGVLDFFFQKPSGFLTLLDEESQMIWSVESNFPKKLQSLLESSNTNAVYSPMKDGNGNVALKDHGTAFTIMHYAGRVMTDVVG
AIEKNKDSLSQNLLFVMKTSENVVINHLFQSKLSQTGSLVSATPSFKFRGHKSALLSKKMTASSIIGENKNTLELSKLLKKKGTSTFLQR
LERGDPVTIASQLRKSLMDIIGKLQKCTPHFIHCIRPNNSKLPDTFDNFYVSAQLQTIGVLEMVKIFRTGYPVRLSFSDFLSRTKPLADT
FLREKKEQSAAERCRLVLQQCKLQGWQMGVRKVFLKYWHADQLNDLCLQLQRKIITCQKVIRGFLARQHLLQRISIRQQEVTSINSFLQN
TEDMGLKTYDALVIQNASDIARENDRLRSEMNAPYHKEKLEVRNMQEEGSKRTDDKSGPRHFHPSSMSVCAAVDGLGQCLVGPSIWSPSL
HSVFSMDDSSSLPSPRKQPPPKPKRDPNTRLSASTEAVSACLSAAREAANEALARPRPHSDDYSTMKKIPPRKPKRSPNTKLSGSYEEIS
GSRPGDARPAGAPGAAARVLTPGTPQCALPPAAPPGDEDDSEPVYIEMLGHAARPDSPDPGESVYEEMKCCLPDDGGPGAGSFLLHGASP
PLLHRAPEDEAAGPPGDACDIPPPFPNLLPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSSPLSPQYSKSQK
GDGDRPASPGLALFNGSGRASPPSTPPPPPPPPGPPPAPYRPCAHLAFPPEPAPVNAGKAGPSAEAPKVHPKPNSAPVAGPCSSFPKIPT
SPVKATRADARKAGSSASPPAPYSPPSSRPLSSPLDELASLFNSGRSVLRKSAAGRKIREAEGFETNMNISSRDDPSTSEITSETQDRNA
NNHGIQLSNSLSSAITAENGNSISNGLPEEDGYSRLSISGTGTSTFQRHRDSHTTQVIHQLRLSENESVALQELLDWRRKLCEEGQDWQQ

>In-frame_GPR158_ENST00000376351_chr10_25465251_+_MYO16_ENST00000251041_chr13_109644724_+_474aa
MGAMAYPLLLCLLLAQLGLGAVGASRDPQGRPDSPRERTPKGKPHAQQPGRASASDSSAPWSRSTDGTILAQKLAEEVPMDVASYLYTGD
SHQLKRANCSGRYELAGLPGKWPALASAHPSLHRALDTLTHATNFLNVMLQSNKSREQNLQDDLDWYQALVWSLLEGEPSISRAAITFST
DSLSAPAPQVFLQATREESRILLQDLSSSAPHLANATLETEWFHGLRRKWRPHLHRRGPNQGPRGLGHSWRRKDGLGGDKSHFKWSPPTL
ECENGSYKPGWLVTLSSAIYGLQPNLVPEFSMQTLDIGILDIFGFEEFQKNEFEQLCVNMTNEKMHHTINEVLFLHEQVECVQEGVTMET
ATSPGNQNGVLDFFFQKPSGFLTLLDEESQMIWSVESNFPKKLQSLLESSNTNAVYSPMKDGNGNVALKDHGTAFTIMHYAGRVMTDVVG

>In-frame_GPR158_ENST00000376351_chr10_25465251_+_MYO16_ENST00000357550_chr13_109644724_+_1392aa
MGAMAYPLLLCLLLAQLGLGAVGASRDPQGRPDSPRERTPKGKPHAQQPGRASASDSSAPWSRSTDGTILAQKLAEEVPMDVASYLYTGD
SHQLKRANCSGRYELAGLPGKWPALASAHPSLHRALDTLTHATNFLNVMLQSNKSREQNLQDDLDWYQALVWSLLEGEPSISRAAITFST
DSLSAPAPQVFLQATREESRILLQDLSSSAPHLANATLETEWFHGLRRKWRPHLHRRGPNQGPRGLGHSWRRKDGLGGDKSHFKWSPPTL
ECENGSYKPGWLVTLSSAIYGLQPNLVPEFSMQTLDIGILDIFGFEEFQKNEFEQLCVNMTNEKMHHTINEVLFLHEQVECVQEGVTMET
ATSPGNQNGVLDFFFQKPSGFLTLLDEESQMIWSVESNFPKKLQSLLESSNTNAVYSPMKDGNGNVALKDHGTAFTIMHYAGRVMTDVVG
AIEKNKDSLSQNLLFVMKTSENVVINHLFQSKLSQTGSLVSATPSFKFRGHKSALLSKKMTASSIIGENKNTLELSKLLKKKGTSTFLQR
LERGDPVTIASQLRKSLMDIIGKLQKCTPHFIHCIRPNNSKLPDTFDNFYVSAQLQTIGVLEMVKIFRTGYPVRLSFSDFLSRTKPLADT
FLREKKEQSAAERCRLVLQQCKLQGWQMGVRKVFLKYWHADQLNDLCLQLQRKIITCQKVIRGFLARQHLLQRISIRQQEVTSINSFLQN
TEDMGLKTYDALVIQNASDIARENDRLRSEMNAPYHKEKLEVRNMQEEGSKRTDDKSGPRHFHPSSMSVCAAVDGLGQCLVGPSIWSPSL
HSVFSMDDSSSLPSPRKQPPPKPKRDPNTRLSASTEAVSACLSAAREAANEALARPRPHSDDYSTMKKIPPRKPKRSPNTKLSGSYEEIS
GSRPGDARPAGAPGAAARVLTPGTPQCALPPAAPPGDEDDSEPVYIEMLGHAARPDSPDPGESVYEEMKCCLPDDGGPGAGSFLLHGASP
PLLHRAPEDEAAGPPGDACDIPPPFPNLLPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSSPLSPQYSKSQK
GDGDRPASPGLALFNGSGRASPPSTPPPPPPPPGPPPAPYRPCAHLAFPPEPAPVNAGKAGPSAEAPKVHPKPNSAPVAGPCSSFPKIPT
SPVKATRADARKAGSSASPPAPYSPPSSRPLSSPLDELASLFNSGRSVLRKSAAGRKIREAEGFETNMNISSRDDPSTSEITSETQDRNA
NNHGIQLSNSLSSAITAENGNSISNGLPEEDGYSRLSISGTGTSTFQRHRDSHTTQVIHQLRLSENESVALQELLDWRRKLCEEGQDWQQ

>In-frame_GPR158_ENST00000376351_chr10_25465251_+_MYO16_ENST00000457511_chr13_109644724_+_879aa
MGAMAYPLLLCLLLAQLGLGAVGASRDPQGRPDSPRERTPKGKPHAQQPGRASASDSSAPWSRSTDGTILAQKLAEEVPMDVASYLYTGD
SHQLKRANCSGRYELAGLPGKWPALASAHPSLHRALDTLTHATNFLNVMLQSNKSREQNLQDDLDWYQALVWSLLEGEPSISRAAITFST
DSLSAPAPQVFLQATREESRILLQDLSSSAPHLANATLETEWFHGLRRKWRPHLHRRGPNQGPRGLGHSWRRKDGLGGDKSHFKWSPPTL
ECENGSYKPGWLVTLSSAIYGLQPNLVPEFSMQTLDIGILDIFGFEEFQKNEFEQLCVNMTNEKMHHTINEVLFLHEQVECVQEGVTMET
ATSPGNQNGVLDFFFQKPSGFLTLLDEESQMIWSVESNFPKKLQSLLESSNTNAVYSPMKDGNGNVALKDHGTAFTIMHYAGRVMTDVVG
AIEKNKDSLSQNLLFVMKTSENVVINHLFQSKLSQTGSLVSATPSFKFRGHKSALLSKKMTASSIIGENKNTLELSKLLKKKGTSTFLQR
LERGDPVTIASQLRKSLMDIIGKLQKCTPHFIHCIRPNNSKLPDTFDNFYVSAQLQTIGVLEMVKIFRTGYPVRLSFSDFLSRTKPLADT
FLREKKEQSAAERCRLVLQQCKLQGWQMGVRKVFLKYWHADQLNDLCLQLQRKIITCQKVIRGFLARQHLLQRISIRQQEVTSINSFLQN
TEDMGLKTYDALVIQNASDIARENDRLRSEMNAPYHKEKLEVRNMQEEGSKRTDDKSGPRHFHPSSMSVCAAVDGLGQCLVGPSIWSPSL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GPR158_ENST00000376351_chr10_25465251_+_MYO16_ENST00000356711_chr13_109644724_+_4176nt
ATGGGAGCCATGGCTTACCCCTTACTCCTCTGCCTCCTGCTTGCTCAGCTGGGATTGGGAGCTGTTGGCGCCAGCCGCGACCCCCAAGGA
CGGCCGGATTCCCCTCGAGAGAGGACCCCGAAGGGGAAGCCGCACGCCCAGCAGCCGGGTCGAGCCTCTGCCTCGGACTCCTCGGCTCCC
TGGAGCCGCTCCACCGATGGCACCATCTTGGCGCAGAAACTCGCCGAGGAGGTGCCCATGGACGTGGCCTCTTACCTCTACACCGGGGAC
TCCCACCAGCTGAAGCGAGCCAACTGCTCCGGCCGCTACGAGTTGGCGGGCCTGCCGGGGAAGTGGCCAGCCCTGGCCAGCGCGCACCCC
TCCTTGCACCGGGCGCTGGACACACTGACACACGCCACCAACTTCCTCAACGTGATGCTGCAGAGCAATAAGTCGCGGGAGCAGAACTTG
CAGGACGACCTGGATTGGTACCAGGCGCTGGTGTGGAGCCTTCTGGAGGGCGAGCCCAGCATCTCCCGGGCGGCCATCACCTTCAGCACC
GATTCGCTGTCCGCACCGGCCCCACAGGTCTTCCTCCAGGCCACGCGCGAGGAGAGCCGCATCCTGCTCCAAGACCTGTCCTCCTCCGCA
CCCCACCTGGCCAACGCCACTCTGGAGACCGAGTGGTTCCACGGCCTCCGGCGCAAGTGGAGGCCCCACTTACACCGCCGCGGCCCCAAT
CAGGGGCCCCGGGGCCTGGGCCACAGCTGGCGGCGCAAGGACGGGCTCGGCGGGGACAAGAGCCACTTCAAGTGGTCTCCGCCTTATCTG
GAGTGCGAGAACGGGAGTTACAAGCCCGGGTGGCTGGTTACTCTTTCCTCTGCCATCTACGGGTTGCAGCCTAACCTGGTCCCGGAATTC
AGCATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTCAACATG
ACCAATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATGGAAACA
GCATATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAAAGTCAA
ATGATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCCATGAAG
GATGGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTTGTTGGG
GCGATTGAAAAAAATAAAGACTCCCTTTCACAGAATCTTCTATTTGTAATGAAAACTAGTGAAAATGTCGTGATCAATCATTTGTTCCAG
TCGAAATTGTCACAAACAGGATCCCTCGTATCTGCCTATCCTTCCTTTAAATTCCGAGGACATAAGTCTGCCCTGCTCAGTAAGAAAATG
ACAGCTTCTTCAATTATTGGAGAAAACAAGAATTATCTAGAACTTAGTAAGTTATTAAAAAAGAAAGGAACTTCTACATTTCTTCAAAGA
TTGGAACGAGGAGATCCAGTCACCATAGCATCACAACTCAGGAAATCACTAATGGATATTATTGGAAAACTTCAGAAGTGCACTCCACAC
TTCATTCATTGCATCAGGCCCAATAACTCAAAGCTGCCAGATACTTTTGATAATTTTTACGTGTCTGCTCAGCTACAATATATTGGGGTC
CTGGAGATGGTGAAGATCTTCCGATATGGATACCCTGTTCGCCTTTCCTTCTCGGATTTCCTGTCAAGGTATAAGCCACTGGCTGATACA
TTCCTGCGTGAGAAGAAGGAACAGTCAGCTGCCGAGCGATGTCGACTTGTTCTCCAGCAGTGTAAATTACAAGGCTGGCAGATGGGAGTC
CGAAAAGTGTTTCTAAAATACTGGCATGCTGACCAACTCAATGATTTGTGCCTACAGTTGCAGAGAAAAATTATAACCTGCCAAAAAGTT
ATCAGAGGATTTTTAGCACGCCAGCACCTGCTTCAGAGAATAAGCATCAGACAACAAGAGGTGACTTCTATCAATAGCTTTCTGCAGAAC
ACAGAGGACATGGGGCTGAAAACCTACGATGCCCTGGTCATTCAGAATGCTTCAGACATTGCCCGGGAAAATGACCGGCTCCGTAGTGAA
ATGAACGCTCCCTACCATAAAGAGAAGTTAGAGGTCAGGAACATGCAAGAGGAAGGAAGCAAAAGAACCGATGACAAGAGTGGACCCAGG
CATTTCCACCCCAGCTCCATGTCAGTCTGCGCGGCCGTGGATGGCCTGGGCCAGTGCCTCGTTGGCCCGTCCATCTGGTCTCCTTCGCTG
CACTCGGTGTTCAGCATGGATGACAGCAGCAGCCTCCCGTCTCCACGGAAACAGCCCCCGCCCAAGCCAAAGAGGGACCCCAACACCCGG
CTGAGTGCTTCCTATGAGGCTGTGAGCGCCTGCCTCTCCGCGGCCAGGGAAGCGGCCAACGAAGCTCTGGCCCGGCCCAGACCGCACAGC
GACGACTACAGCACCATGAAGAAGATTCCTCCTCGAAAGCCCAAGCGCAGCCCCAACACCAAGCTCAGCGGCTCCTACGAGGAGATATCG
GGGTCCCGGCCCGGGGACGCGAGGCCCGCGGGCGCCCCGGGGGCAGCAGCGCGCGTTCTGACCCCCGGGACTCCGCAGTGCGCGCTGCCC
CCGGCGGCGCCTCCGGGTGACGAGGACGACAGCGAGCCTGTGTACATCGAGATGCTGGGGCACGCGGCCAGGCCCGATAGCCCGGACCCC
GGGGAGTCCGTGTACGAGGAGATGAAGTGTTGCCTGCCCGACGACGGCGGCCCGGGCGCGGGCTCCTTCCTGCTCCACGGCGCATCGCCG
CCCCTGCTCCACCGCGCGCCGGAGGACGAGGCGGCGGGGCCCCCAGGGGACGCGTGCGACATCCCGCCGCCCTTCCCCAACCTGCTGCCG
CACCGGCCGCCCCTGCTGGTGTTCCCCCCGACCCCCGTCACCTGCTCCCCCGCCTCCGACGAGTCGCCCCTGACACCCCTGGAGGTGAAG
AAGCTGCCAGTCCTGGAGACCAACCTCAAGTACCCCGTGCAGCCGGAGGGGTCGAGCCCGCTGTCCCCGCAGTACTCCAAGAGCCAGAAG
GGCGACGGCGACAGGCCCGCGTCCCCCGGCCTGGCGCTGTTCAACGGGTCCGGCCGAGCCTCCCCGCCGTCCACGCCGCCCCCGCCCCCG
CCCCCGCCCGGGCCGCCCCCCGCGCCCTACAGGCCCTGCGCGCACTTGGCCTTCCCGCCGGAGCCCGCCCCGGTGAACGCGGGGAAAGCG
GGGCCGAGCGCAGAGGCGCCCAAGGTTCACCCAAAGCCAAACTCTGCCCCCGTGGCCGGGCCCTGCAGCTCCTTCCCCAAGATCCCATAT
TCCCCCGTGAAGGCCACCAGGGCGGACGCCAGGAAGGCCGGCTCCAGTGCCTCGCCCCCCGCGCCCTACAGCCCTCCCAGCTCCAGGCCT
CTCAGCAGCCCCCTGGACGAGCTCGCCAGCCTCTTCAACTCGGGGAGGAGTGTGCTTCGGAAATCCGCGGCGGGAAGAAAAATCAGGGAA
GCAGAAGGTTTTGAAACTAACATGAACATAAGTAGCCGAGATGACCCTAGTACGTCAGAAATTACTTCCGAGACTCAAGACAGAAATGCA
AATAACCATGGAATTCAGTTATCTAATTCACTATCTAGTGCTATAACTGCTGAAAATGGAAATTCCATCTCAAATGGTTTACCTGAAGAA
GATGGATACTCACGGTTGTCTATAAGTGGCACAGGGACTTCGACATTTCAAAGACACAGGGACAGTCACACCACTCAGGTAATCCATCAG
CTGAGGCTCTCAGAGAATGAAAGTGTGGCCCTGCAGGAACTCTTGGACTGGAGGAGAAAGCTCTGTGAGGAAGGACAAGACTGGCAGCAG
ATCCTGCACCACGCTGAGCCCAGGGTGCCTCCCCCACCACCTTGCAAGAAGCCCAGCCTTCTGAAGAAGCCGGAAGGGGCCTCCTGCAAC

>In-frame_GPR158_ENST00000376351_chr10_25465251_+_MYO16_ENST00000251041_chr13_109644724_+_1422nt
ATGGGAGCCATGGCTTACCCCTTACTCCTCTGCCTCCTGCTTGCTCAGCTGGGATTGGGAGCTGTTGGCGCCAGCCGCGACCCCCAAGGA
CGGCCGGATTCCCCTCGAGAGAGGACCCCGAAGGGGAAGCCGCACGCCCAGCAGCCGGGTCGAGCCTCTGCCTCGGACTCCTCGGCTCCC
TGGAGCCGCTCCACCGATGGCACCATCTTGGCGCAGAAACTCGCCGAGGAGGTGCCCATGGACGTGGCCTCTTACCTCTACACCGGGGAC
TCCCACCAGCTGAAGCGAGCCAACTGCTCCGGCCGCTACGAGTTGGCGGGCCTGCCGGGGAAGTGGCCAGCCCTGGCCAGCGCGCACCCC
TCCTTGCACCGGGCGCTGGACACACTGACACACGCCACCAACTTCCTCAACGTGATGCTGCAGAGCAATAAGTCGCGGGAGCAGAACTTG
CAGGACGACCTGGATTGGTACCAGGCGCTGGTGTGGAGCCTTCTGGAGGGCGAGCCCAGCATCTCCCGGGCGGCCATCACCTTCAGCACC
GATTCGCTGTCCGCACCGGCCCCACAGGTCTTCCTCCAGGCCACGCGCGAGGAGAGCCGCATCCTGCTCCAAGACCTGTCCTCCTCCGCA
CCCCACCTGGCCAACGCCACTCTGGAGACCGAGTGGTTCCACGGCCTCCGGCGCAAGTGGAGGCCCCACTTACACCGCCGCGGCCCCAAT
CAGGGGCCCCGGGGCCTGGGCCACAGCTGGCGGCGCAAGGACGGGCTCGGCGGGGACAAGAGCCACTTCAAGTGGTCTCCGCCTTATCTG
GAGTGCGAGAACGGGAGTTACAAGCCCGGGTGGCTGGTTACTCTTTCCTCTGCCATCTACGGGTTGCAGCCTAACCTGGTCCCGGAATTC
AGCATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTCAACATG
ACCAATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATGGAAACA
GCATATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAAAGTCAA
ATGATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCCATGAAG
GATGGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTTGTTGGG

>In-frame_GPR158_ENST00000376351_chr10_25465251_+_MYO16_ENST00000357550_chr13_109644724_+_4176nt
ATGGGAGCCATGGCTTACCCCTTACTCCTCTGCCTCCTGCTTGCTCAGCTGGGATTGGGAGCTGTTGGCGCCAGCCGCGACCCCCAAGGA
CGGCCGGATTCCCCTCGAGAGAGGACCCCGAAGGGGAAGCCGCACGCCCAGCAGCCGGGTCGAGCCTCTGCCTCGGACTCCTCGGCTCCC
TGGAGCCGCTCCACCGATGGCACCATCTTGGCGCAGAAACTCGCCGAGGAGGTGCCCATGGACGTGGCCTCTTACCTCTACACCGGGGAC
TCCCACCAGCTGAAGCGAGCCAACTGCTCCGGCCGCTACGAGTTGGCGGGCCTGCCGGGGAAGTGGCCAGCCCTGGCCAGCGCGCACCCC
TCCTTGCACCGGGCGCTGGACACACTGACACACGCCACCAACTTCCTCAACGTGATGCTGCAGAGCAATAAGTCGCGGGAGCAGAACTTG
CAGGACGACCTGGATTGGTACCAGGCGCTGGTGTGGAGCCTTCTGGAGGGCGAGCCCAGCATCTCCCGGGCGGCCATCACCTTCAGCACC
GATTCGCTGTCCGCACCGGCCCCACAGGTCTTCCTCCAGGCCACGCGCGAGGAGAGCCGCATCCTGCTCCAAGACCTGTCCTCCTCCGCA
CCCCACCTGGCCAACGCCACTCTGGAGACCGAGTGGTTCCACGGCCTCCGGCGCAAGTGGAGGCCCCACTTACACCGCCGCGGCCCCAAT
CAGGGGCCCCGGGGCCTGGGCCACAGCTGGCGGCGCAAGGACGGGCTCGGCGGGGACAAGAGCCACTTCAAGTGGTCTCCGCCTTATCTG
GAGTGCGAGAACGGGAGTTACAAGCCCGGGTGGCTGGTTACTCTTTCCTCTGCCATCTACGGGTTGCAGCCTAACCTGGTCCCGGAATTC
AGCATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTCAACATG
ACCAATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATGGAAACA
GCATATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAAAGTCAA
ATGATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCCATGAAG
GATGGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTTGTTGGG
GCGATTGAAAAAAATAAAGACTCCCTTTCACAGAATCTTCTATTTGTAATGAAAACTAGTGAAAATGTCGTGATCAATCATTTGTTCCAG
TCGAAATTGTCACAAACAGGATCCCTCGTATCTGCCTATCCTTCCTTTAAATTCCGAGGACATAAGTCTGCCCTGCTCAGTAAGAAAATG
ACAGCTTCTTCAATTATTGGAGAAAACAAGAATTATCTAGAACTTAGTAAGTTATTAAAAAAGAAAGGAACTTCTACATTTCTTCAAAGA
TTGGAACGAGGAGATCCAGTCACCATAGCATCACAACTCAGGAAATCACTAATGGATATTATTGGAAAACTTCAGAAGTGCACTCCACAC
TTCATTCATTGCATCAGGCCCAATAACTCAAAGCTGCCAGATACTTTTGATAATTTTTACGTGTCTGCTCAGCTACAATATATTGGGGTC
CTGGAGATGGTGAAGATCTTCCGATATGGATACCCTGTTCGCCTTTCCTTCTCGGATTTCCTGTCAAGGTATAAGCCACTGGCTGATACA
TTCCTGCGTGAGAAGAAGGAACAGTCAGCTGCCGAGCGATGTCGACTTGTTCTCCAGCAGTGTAAATTACAAGGCTGGCAGATGGGAGTC
CGAAAAGTGTTTCTAAAATACTGGCATGCTGACCAACTCAATGATTTGTGCCTACAGTTGCAGAGAAAAATTATAACCTGCCAAAAAGTT
ATCAGAGGATTTTTAGCACGCCAGCACCTGCTTCAGAGAATAAGCATCAGACAACAAGAGGTGACTTCTATCAATAGCTTTCTGCAGAAC
ACAGAGGACATGGGGCTGAAAACCTACGATGCCCTGGTCATTCAGAATGCTTCAGACATTGCCCGGGAAAATGACCGGCTCCGTAGTGAA
ATGAACGCTCCCTACCATAAAGAGAAGTTAGAGGTCAGGAACATGCAAGAGGAAGGAAGCAAAAGAACCGATGACAAGAGTGGACCCAGG
CATTTCCACCCCAGCTCCATGTCAGTCTGCGCGGCCGTGGATGGCCTGGGCCAGTGCCTCGTTGGCCCGTCCATCTGGTCTCCTTCGCTG
CACTCGGTGTTCAGCATGGATGACAGCAGCAGCCTCCCGTCTCCACGGAAACAGCCCCCGCCCAAGCCAAAGAGGGACCCCAACACCCGG
CTGAGTGCTTCCTATGAGGCTGTGAGCGCCTGCCTCTCCGCGGCCAGGGAAGCGGCCAACGAAGCTCTGGCCCGGCCCAGACCGCACAGC
GACGACTACAGCACCATGAAGAAGATTCCTCCTCGAAAGCCCAAGCGCAGCCCCAACACCAAGCTCAGCGGCTCCTACGAGGAGATATCG
GGGTCCCGGCCCGGGGACGCGAGGCCCGCGGGCGCCCCGGGGGCAGCAGCGCGCGTTCTGACCCCCGGGACTCCGCAGTGCGCGCTGCCC
CCGGCGGCGCCTCCGGGTGACGAGGACGACAGCGAGCCTGTGTACATCGAGATGCTGGGGCACGCGGCCAGGCCCGATAGCCCGGACCCC
GGGGAGTCCGTGTACGAGGAGATGAAGTGTTGCCTGCCCGACGACGGCGGCCCGGGCGCGGGCTCCTTCCTGCTCCACGGCGCATCGCCG
CCCCTGCTCCACCGCGCGCCGGAGGACGAGGCGGCGGGGCCCCCAGGGGACGCGTGCGACATCCCGCCGCCCTTCCCCAACCTGCTGCCG
CACCGGCCGCCCCTGCTGGTGTTCCCCCCGACCCCCGTCACCTGCTCCCCCGCCTCCGACGAGTCGCCCCTGACACCCCTGGAGGTGAAG
AAGCTGCCAGTCCTGGAGACCAACCTCAAGTACCCCGTGCAGCCGGAGGGGTCGAGCCCGCTGTCCCCGCAGTACTCCAAGAGCCAGAAG
GGCGACGGCGACAGGCCCGCGTCCCCCGGCCTGGCGCTGTTCAACGGGTCCGGCCGAGCCTCCCCGCCGTCCACGCCGCCCCCGCCCCCG
CCCCCGCCCGGGCCGCCCCCCGCGCCCTACAGGCCCTGCGCGCACTTGGCCTTCCCGCCGGAGCCCGCCCCGGTGAACGCGGGGAAAGCG
GGGCCGAGCGCAGAGGCGCCCAAGGTTCACCCAAAGCCAAACTCTGCCCCCGTGGCCGGGCCCTGCAGCTCCTTCCCCAAGATCCCATAT
TCCCCCGTGAAGGCCACCAGGGCGGACGCCAGGAAGGCCGGCTCCAGTGCCTCGCCCCCCGCGCCCTACAGCCCTCCCAGCTCCAGGCCT
CTCAGCAGCCCCCTGGACGAGCTCGCCAGCCTCTTCAACTCGGGGAGGAGTGTGCTTCGGAAATCCGCGGCGGGAAGAAAAATCAGGGAA
GCAGAAGGTTTTGAAACTAACATGAACATAAGTAGCCGAGATGACCCTAGTACGTCAGAAATTACTTCCGAGACTCAAGACAGAAATGCA
AATAACCATGGAATTCAGTTATCTAATTCACTATCTAGTGCTATAACTGCTGAAAATGGAAATTCCATCTCAAATGGTTTACCTGAAGAA
GATGGATACTCACGGTTGTCTATAAGTGGCACAGGGACTTCGACATTTCAAAGACACAGGGACAGTCACACCACTCAGGTAATCCATCAG
CTGAGGCTCTCAGAGAATGAAAGTGTGGCCCTGCAGGAACTCTTGGACTGGAGGAGAAAGCTCTGTGAGGAAGGACAAGACTGGCAGCAG
ATCCTGCACCACGCTGAGCCCAGGGTGCCTCCCCCACCACCTTGCAAGAAGCCCAGCCTTCTGAAGAAGCCGGAAGGGGCCTCCTGCAAC

>In-frame_GPR158_ENST00000376351_chr10_25465251_+_MYO16_ENST00000457511_chr13_109644724_+_2637nt
ATGGGAGCCATGGCTTACCCCTTACTCCTCTGCCTCCTGCTTGCTCAGCTGGGATTGGGAGCTGTTGGCGCCAGCCGCGACCCCCAAGGA
CGGCCGGATTCCCCTCGAGAGAGGACCCCGAAGGGGAAGCCGCACGCCCAGCAGCCGGGTCGAGCCTCTGCCTCGGACTCCTCGGCTCCC
TGGAGCCGCTCCACCGATGGCACCATCTTGGCGCAGAAACTCGCCGAGGAGGTGCCCATGGACGTGGCCTCTTACCTCTACACCGGGGAC
TCCCACCAGCTGAAGCGAGCCAACTGCTCCGGCCGCTACGAGTTGGCGGGCCTGCCGGGGAAGTGGCCAGCCCTGGCCAGCGCGCACCCC
TCCTTGCACCGGGCGCTGGACACACTGACACACGCCACCAACTTCCTCAACGTGATGCTGCAGAGCAATAAGTCGCGGGAGCAGAACTTG
CAGGACGACCTGGATTGGTACCAGGCGCTGGTGTGGAGCCTTCTGGAGGGCGAGCCCAGCATCTCCCGGGCGGCCATCACCTTCAGCACC
GATTCGCTGTCCGCACCGGCCCCACAGGTCTTCCTCCAGGCCACGCGCGAGGAGAGCCGCATCCTGCTCCAAGACCTGTCCTCCTCCGCA
CCCCACCTGGCCAACGCCACTCTGGAGACCGAGTGGTTCCACGGCCTCCGGCGCAAGTGGAGGCCCCACTTACACCGCCGCGGCCCCAAT
CAGGGGCCCCGGGGCCTGGGCCACAGCTGGCGGCGCAAGGACGGGCTCGGCGGGGACAAGAGCCACTTCAAGTGGTCTCCGCCTTATCTG
GAGTGCGAGAACGGGAGTTACAAGCCCGGGTGGCTGGTTACTCTTTCCTCTGCCATCTACGGGTTGCAGCCTAACCTGGTCCCGGAATTC
AGCATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTCAACATG
ACCAATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATGGAAACA
GCATATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAAAGTCAA
ATGATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCCATGAAG
GATGGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTTGTTGGG
GCGATTGAAAAAAATAAAGACTCCCTTTCACAGAATCTTCTATTTGTAATGAAAACTAGTGAAAATGTCGTGATCAATCATTTGTTCCAG
TCGAAATTGTCACAAACAGGATCCCTCGTATCTGCCTATCCTTCCTTTAAATTCCGAGGACATAAGTCTGCCCTGCTCAGTAAGAAAATG
ACAGCTTCTTCAATTATTGGAGAAAACAAGAATTATCTAGAACTTAGTAAGTTATTAAAAAAGAAAGGAACTTCTACATTTCTTCAAAGA
TTGGAACGAGGAGATCCAGTCACCATAGCATCACAACTCAGGAAATCACTAATGGATATTATTGGAAAACTTCAGAAGTGCACTCCACAC
TTCATTCATTGCATCAGGCCCAATAACTCAAAGCTGCCAGATACTTTTGATAATTTTTACGTGTCTGCTCAGCTACAATATATTGGGGTC
CTGGAGATGGTGAAGATCTTCCGATATGGATACCCTGTTCGCCTTTCCTTCTCGGATTTCCTGTCAAGGTATAAGCCACTGGCTGATACA
TTCCTGCGTGAGAAGAAGGAACAGTCAGCTGCCGAGCGATGTCGACTTGTTCTCCAGCAGTGTAAATTACAAGGCTGGCAGATGGGAGTC
CGAAAAGTGTTTCTAAAATACTGGCATGCTGACCAACTCAATGATTTGTGCCTACAGTTGCAGAGAAAAATTATAACCTGCCAAAAAGTT
ATCAGAGGATTTTTAGCACGCCAGCACCTGCTTCAGAGAATAAGCATCAGACAACAAGAGGTGACTTCTATCAATAGCTTTCTGCAGAAC
ACAGAGGACATGGGGCTGAAAACCTACGATGCCCTGGTCATTCAGAATGCTTCAGACATTGCCCGGGAAAATGACCGGCTCCGTAGTGAA
ATGAACGCTCCCTACCATAAAGAGAAGTTAGAGGTCAGGAACATGCAAGAGGAAGGAAGCAAAAGAACCGATGACAAGAGTGGACCCAGG
CATTTCCACCCCAGCTCCATGTCAGTCTGCGCGGCCGTGGATGGCCTGGGCCAGTGCCTCGTTGGCCCGTCCATCTGGTCTCCTTCGCTG
CACTCGGTGTTCAGCATGGATGACAGCAGCAGCCTCCCGTCTCCACGGAAACAGCCCCCGCCCAAGCCAAAGAGGGACCCCAACACCCGG
CTGAGTGCTTCCTATGAGGCTGTGAGCGCCTGCCTCTCCGCGGCCAGGGAAGCGGCCAACGAAGGTCAGCCCTGGGGAGGGACCCAGCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_GPR158_ENST00000376351_chr10_25465251_+_MYO16_ENST00000356711_chr13_109644724_+_5706nt
AATGAGAGCGGCGGTGGCGGCAGCCGGGCCGAGAGACGGACTCGGGCTGACTCCAGCCGCTGGGAGCGCGAGGCCATGTAACCCGCTCGG
CTCCAGGCTGCGAGGTGCGTAATCCCCAGCCGGCCCCTCGCGCAGCGGGCACGGCCAGCGCTGCCACAGGTGACTTGATTTCTGCGACGG
TAGCTTAGCCACCCGGGGCCAATCTCGAAACATTCTTATTTTCAAGTCCTTTGGACTGGGTGCCATCTGGAGAAGGGGGAAGACTCCTCG
AAAAAGTCTGACTGTTGAGAAACTGACGATCCAAATTTAAAAAGTGATTCCCCCCCCTCCCGTTCCCTCCTCTTCTCTCTGGGAGGCAGA
TGGGAGCCATGGCTTACCCCTTACTCCTCTGCCTCCTGCTTGCTCAGCTGGGATTGGGAGCTGTTGGCGCCAGCCGCGACCCCCAAGGAC
GGCCGGATTCCCCTCGAGAGAGGACCCCGAAGGGGAAGCCGCACGCCCAGCAGCCGGGTCGAGCCTCTGCCTCGGACTCCTCGGCTCCCT
GGAGCCGCTCCACCGATGGCACCATCTTGGCGCAGAAACTCGCCGAGGAGGTGCCCATGGACGTGGCCTCTTACCTCTACACCGGGGACT
CCCACCAGCTGAAGCGAGCCAACTGCTCCGGCCGCTACGAGTTGGCGGGCCTGCCGGGGAAGTGGCCAGCCCTGGCCAGCGCGCACCCCT
CCTTGCACCGGGCGCTGGACACACTGACACACGCCACCAACTTCCTCAACGTGATGCTGCAGAGCAATAAGTCGCGGGAGCAGAACTTGC
AGGACGACCTGGATTGGTACCAGGCGCTGGTGTGGAGCCTTCTGGAGGGCGAGCCCAGCATCTCCCGGGCGGCCATCACCTTCAGCACCG
ATTCGCTGTCCGCACCGGCCCCACAGGTCTTCCTCCAGGCCACGCGCGAGGAGAGCCGCATCCTGCTCCAAGACCTGTCCTCCTCCGCAC
CCCACCTGGCCAACGCCACTCTGGAGACCGAGTGGTTCCACGGCCTCCGGCGCAAGTGGAGGCCCCACTTACACCGCCGCGGCCCCAATC
AGGGGCCCCGGGGCCTGGGCCACAGCTGGCGGCGCAAGGACGGGCTCGGCGGGGACAAGAGCCACTTCAAGTGGTCTCCGCCTTATCTGG
AGTGCGAGAACGGGAGTTACAAGCCCGGGTGGCTGGTTACTCTTTCCTCTGCCATCTACGGGTTGCAGCCTAACCTGGTCCCGGAATTCA
GCATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTCAACATGA
CCAATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATGGAAACAG
CATATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAAAGTCAAA
TGATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCCATGAAGG
ATGGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTTGTTGGGG
CGATTGAAAAAAATAAAGACTCCCTTTCACAGAATCTTCTATTTGTAATGAAAACTAGTGAAAATGTCGTGATCAATCATTTGTTCCAGT
CGAAATTGTCACAAACAGGATCCCTCGTATCTGCCTATCCTTCCTTTAAATTCCGAGGACATAAGTCTGCCCTGCTCAGTAAGAAAATGA
CAGCTTCTTCAATTATTGGAGAAAACAAGAATTATCTAGAACTTAGTAAGTTATTAAAAAAGAAAGGAACTTCTACATTTCTTCAAAGAT
TGGAACGAGGAGATCCAGTCACCATAGCATCACAACTCAGGAAATCACTAATGGATATTATTGGAAAACTTCAGAAGTGCACTCCACACT
TCATTCATTGCATCAGGCCCAATAACTCAAAGCTGCCAGATACTTTTGATAATTTTTACGTGTCTGCTCAGCTACAATATATTGGGGTCC
TGGAGATGGTGAAGATCTTCCGATATGGATACCCTGTTCGCCTTTCCTTCTCGGATTTCCTGTCAAGGTATAAGCCACTGGCTGATACAT
TCCTGCGTGAGAAGAAGGAACAGTCAGCTGCCGAGCGATGTCGACTTGTTCTCCAGCAGTGTAAATTACAAGGCTGGCAGATGGGAGTCC
GAAAAGTGTTTCTAAAATACTGGCATGCTGACCAACTCAATGATTTGTGCCTACAGTTGCAGAGAAAAATTATAACCTGCCAAAAAGTTA
TCAGAGGATTTTTAGCACGCCAGCACCTGCTTCAGAGAATAAGCATCAGACAACAAGAGGTGACTTCTATCAATAGCTTTCTGCAGAACA
CAGAGGACATGGGGCTGAAAACCTACGATGCCCTGGTCATTCAGAATGCTTCAGACATTGCCCGGGAAAATGACCGGCTCCGTAGTGAAA
TGAACGCTCCCTACCATAAAGAGAAGTTAGAGGTCAGGAACATGCAAGAGGAAGGAAGCAAAAGAACCGATGACAAGAGTGGACCCAGGC
ATTTCCACCCCAGCTCCATGTCAGTCTGCGCGGCCGTGGATGGCCTGGGCCAGTGCCTCGTTGGCCCGTCCATCTGGTCTCCTTCGCTGC
ACTCGGTGTTCAGCATGGATGACAGCAGCAGCCTCCCGTCTCCACGGAAACAGCCCCCGCCCAAGCCAAAGAGGGACCCCAACACCCGGC
TGAGTGCTTCCTATGAGGCTGTGAGCGCCTGCCTCTCCGCGGCCAGGGAAGCGGCCAACGAAGCTCTGGCCCGGCCCAGACCGCACAGCG
ACGACTACAGCACCATGAAGAAGATTCCTCCTCGAAAGCCCAAGCGCAGCCCCAACACCAAGCTCAGCGGCTCCTACGAGGAGATATCGG
GGTCCCGGCCCGGGGACGCGAGGCCCGCGGGCGCCCCGGGGGCAGCAGCGCGCGTTCTGACCCCCGGGACTCCGCAGTGCGCGCTGCCCC
CGGCGGCGCCTCCGGGTGACGAGGACGACAGCGAGCCTGTGTACATCGAGATGCTGGGGCACGCGGCCAGGCCCGATAGCCCGGACCCCG
GGGAGTCCGTGTACGAGGAGATGAAGTGTTGCCTGCCCGACGACGGCGGCCCGGGCGCGGGCTCCTTCCTGCTCCACGGCGCATCGCCGC
CCCTGCTCCACCGCGCGCCGGAGGACGAGGCGGCGGGGCCCCCAGGGGACGCGTGCGACATCCCGCCGCCCTTCCCCAACCTGCTGCCGC
ACCGGCCGCCCCTGCTGGTGTTCCCCCCGACCCCCGTCACCTGCTCCCCCGCCTCCGACGAGTCGCCCCTGACACCCCTGGAGGTGAAGA
AGCTGCCAGTCCTGGAGACCAACCTCAAGTACCCCGTGCAGCCGGAGGGGTCGAGCCCGCTGTCCCCGCAGTACTCCAAGAGCCAGAAGG
GCGACGGCGACAGGCCCGCGTCCCCCGGCCTGGCGCTGTTCAACGGGTCCGGCCGAGCCTCCCCGCCGTCCACGCCGCCCCCGCCCCCGC
CCCCGCCCGGGCCGCCCCCCGCGCCCTACAGGCCCTGCGCGCACTTGGCCTTCCCGCCGGAGCCCGCCCCGGTGAACGCGGGGAAAGCGG
GGCCGAGCGCAGAGGCGCCCAAGGTTCACCCAAAGCCAAACTCTGCCCCCGTGGCCGGGCCCTGCAGCTCCTTCCCCAAGATCCCATATT
CCCCCGTGAAGGCCACCAGGGCGGACGCCAGGAAGGCCGGCTCCAGTGCCTCGCCCCCCGCGCCCTACAGCCCTCCCAGCTCCAGGCCTC
TCAGCAGCCCCCTGGACGAGCTCGCCAGCCTCTTCAACTCGGGGAGGAGTGTGCTTCGGAAATCCGCGGCGGGAAGAAAAATCAGGGAAG
CAGAAGGTTTTGAAACTAACATGAACATAAGTAGCCGAGATGACCCTAGTACGTCAGAAATTACTTCCGAGACTCAAGACAGAAATGCAA
ATAACCATGGAATTCAGTTATCTAATTCACTATCTAGTGCTATAACTGCTGAAAATGGAAATTCCATCTCAAATGGTTTACCTGAAGAAG
ATGGATACTCACGGTTGTCTATAAGTGGCACAGGGACTTCGACATTTCAAAGACACAGGGACAGTCACACCACTCAGGTAATCCATCAGC
TGAGGCTCTCAGAGAATGAAAGTGTGGCCCTGCAGGAACTCTTGGACTGGAGGAGAAAGCTCTGTGAGGAAGGACAAGACTGGCAGCAGA
TCCTGCACCACGCTGAGCCCAGGGTGCCTCCCCCACCACCTTGCAAGAAGCCCAGCCTTCTGAAGAAGCCGGAAGGGGCCTCCTGCAACA
GGCTGCCGTCTGAGCTCTGGGACACCACCATTTGATGTGGCCTGAACTGCAGACTTACAAAATAGAACTGCCTACTGATTCCGGGCTGCA
ACAACAGAAGGCTGCCTTCTGACATGCGCTGGGGCTTCTCTCCACGCATTTAGACAAAAAAAGCACAGGACACAGACACTAAATATATGA
GATCCCGTGTGTGTGTGTGTGTGTTTGTGTGTGTGTGTGTGGGTTCTTTCTTATCCATCTCGTGGTGATACACTCTGATTTTCAAGCTCC
TCATTTACGGCTCTGTGCTACCCCTAGGTAGCAAGAGAGAGGCTGGGAAAAGTGTGGACGTGGCCAGAGCGAGAGAGTAGCGGAGGAAAG
GAGCAATCCATGCACACTCTGTACAGTTGTTTTTCTACGGTTCAACAGTCTGTTTATTGTACTTCCAATGGTTTTATTATAATACAGTAT
ACGGGACATATATTTTATTTCTTTGTAGCTACTTGTGTTTTATTGGTATTATAAACCTGATAATTATTTACATGTTTATTACTGTAATTT
TATAAATTTATGCAATTGGTGGTGCTTCCTTTCTTCAAAATACAGATTTTAAAAAATCATTTCTAGATTATTTTTTTCCTCCACAGTCCT
TTTTTTTCACCTAACGCACCTAAATCTTGAAACTACATTGTTGTTTTAGCTTCGCCAGTGTCACCCCTTGCAAAACTATGAATTGAGCCC
CATGTTTTAGGTGTTACTCATGGATGAGGAGGCTGTTCTTTCCTATGCCCTGTATTTCTGGATAAGTGGATTGTGTACCCTTTAGTTAAA
TTTCACCTCCCGACTTCAGCATAGATCACAGGAAATCACATGGCACACGGTTAAACACGTATGGCTTCAAATCCATAGCCGGTGGTGTAA
AATGATCATATTCATTCAAAGGCCTACACAGTACAAATGAGCACGCTGCCATGTACTGGTTTGAGCAGTAGGGGCTGCATCGCACAGCGC
TCGTCCCCCGGGACTTACACTGCATGATTCCCTCACTGTATATCCTCAACCCTCCCATAATGCAAGGCCTTGTTCATTGATGTGCTTTCG
TCGGCTGTCGGAAAGTTCTGAGCAGTGGCTCCAGACCACCTTGTCTTGCTACTTGGAACTTTTTATTCATACCAGCCTTTGAAAAGTTAC

>In-frame_GPR158_ENST00000376351_chr10_25465251_+_MYO16_ENST00000251041_chr13_109644724_+_2409nt
AATGAGAGCGGCGGTGGCGGCAGCCGGGCCGAGAGACGGACTCGGGCTGACTCCAGCCGCTGGGAGCGCGAGGCCATGTAACCCGCTCGG
CTCCAGGCTGCGAGGTGCGTAATCCCCAGCCGGCCCCTCGCGCAGCGGGCACGGCCAGCGCTGCCACAGGTGACTTGATTTCTGCGACGG
TAGCTTAGCCACCCGGGGCCAATCTCGAAACATTCTTATTTTCAAGTCCTTTGGACTGGGTGCCATCTGGAGAAGGGGGAAGACTCCTCG
AAAAAGTCTGACTGTTGAGAAACTGACGATCCAAATTTAAAAAGTGATTCCCCCCCCTCCCGTTCCCTCCTCTTCTCTCTGGGAGGCAGA
TGGGAGCCATGGCTTACCCCTTACTCCTCTGCCTCCTGCTTGCTCAGCTGGGATTGGGAGCTGTTGGCGCCAGCCGCGACCCCCAAGGAC
GGCCGGATTCCCCTCGAGAGAGGACCCCGAAGGGGAAGCCGCACGCCCAGCAGCCGGGTCGAGCCTCTGCCTCGGACTCCTCGGCTCCCT
GGAGCCGCTCCACCGATGGCACCATCTTGGCGCAGAAACTCGCCGAGGAGGTGCCCATGGACGTGGCCTCTTACCTCTACACCGGGGACT
CCCACCAGCTGAAGCGAGCCAACTGCTCCGGCCGCTACGAGTTGGCGGGCCTGCCGGGGAAGTGGCCAGCCCTGGCCAGCGCGCACCCCT
CCTTGCACCGGGCGCTGGACACACTGACACACGCCACCAACTTCCTCAACGTGATGCTGCAGAGCAATAAGTCGCGGGAGCAGAACTTGC
AGGACGACCTGGATTGGTACCAGGCGCTGGTGTGGAGCCTTCTGGAGGGCGAGCCCAGCATCTCCCGGGCGGCCATCACCTTCAGCACCG
ATTCGCTGTCCGCACCGGCCCCACAGGTCTTCCTCCAGGCCACGCGCGAGGAGAGCCGCATCCTGCTCCAAGACCTGTCCTCCTCCGCAC
CCCACCTGGCCAACGCCACTCTGGAGACCGAGTGGTTCCACGGCCTCCGGCGCAAGTGGAGGCCCCACTTACACCGCCGCGGCCCCAATC
AGGGGCCCCGGGGCCTGGGCCACAGCTGGCGGCGCAAGGACGGGCTCGGCGGGGACAAGAGCCACTTCAAGTGGTCTCCGCCTTATCTGG
AGTGCGAGAACGGGAGTTACAAGCCCGGGTGGCTGGTTACTCTTTCCTCTGCCATCTACGGGTTGCAGCCTAACCTGGTCCCGGAATTCA
GCATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTCAACATGA
CCAATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATGGAAACAG
CATATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAAAGTCAAA
TGATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCCATGAAGG
ATGGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTTGTTGGGG
CGATTGAAAAAAATAAAGACTCCCTTTCACAGAATCTTCTATTTGTAATGAAAAGAGGAAGGTGCTTCTGAGCAAAAGGACAGAATTTAC
AATGTACCCTTTTGTATTTATACAGGAGGTGTCAGATTTTTTTTTTTGTAAAGGGCTAGAGAATAAATATTTTAGACCTTGTGCACCATA
AGATCCTTGTTGCAGTTACTCACCTCTGCTGTTATAATGTGAAAAACAGCTGTAGACAATACAAATGGATGTGACTGTATTCTGATAAAA
TTTTATTTACAAAAACAGGCAGTGGGCCATGTTTGGCTCAGGAGCCATGATTGCTCACTCACTCTATCATAAAAGCAAAATATTTGTGGT
TGCCATCATGTTTTATGAATCTGTGAAATACTTTGATGCTTGTACATATTTATTAAAAGCAAGTGTAATTCATAAATAATAATTTTTATT
TGCAGGTACTTTGCTTATAGTATCTAATTCAATTTTCGTAGCATCAAAAAGCTCCCAGTTGAGGAAGATGGTGAGGTCTGTTGTAGAATG
TACACAAGCAGAGCTGAGTCTCTGAGACCACTAACCAGGTACAGTCAGGGAGCTTGGAGACAGCTCATAGAGACACACAGCAAATACACT

>In-frame_GPR158_ENST00000376351_chr10_25465251_+_MYO16_ENST00000357550_chr13_109644724_+_5692nt
AATGAGAGCGGCGGTGGCGGCAGCCGGGCCGAGAGACGGACTCGGGCTGACTCCAGCCGCTGGGAGCGCGAGGCCATGTAACCCGCTCGG
CTCCAGGCTGCGAGGTGCGTAATCCCCAGCCGGCCCCTCGCGCAGCGGGCACGGCCAGCGCTGCCACAGGTGACTTGATTTCTGCGACGG
TAGCTTAGCCACCCGGGGCCAATCTCGAAACATTCTTATTTTCAAGTCCTTTGGACTGGGTGCCATCTGGAGAAGGGGGAAGACTCCTCG
AAAAAGTCTGACTGTTGAGAAACTGACGATCCAAATTTAAAAAGTGATTCCCCCCCCTCCCGTTCCCTCCTCTTCTCTCTGGGAGGCAGA
TGGGAGCCATGGCTTACCCCTTACTCCTCTGCCTCCTGCTTGCTCAGCTGGGATTGGGAGCTGTTGGCGCCAGCCGCGACCCCCAAGGAC
GGCCGGATTCCCCTCGAGAGAGGACCCCGAAGGGGAAGCCGCACGCCCAGCAGCCGGGTCGAGCCTCTGCCTCGGACTCCTCGGCTCCCT
GGAGCCGCTCCACCGATGGCACCATCTTGGCGCAGAAACTCGCCGAGGAGGTGCCCATGGACGTGGCCTCTTACCTCTACACCGGGGACT
CCCACCAGCTGAAGCGAGCCAACTGCTCCGGCCGCTACGAGTTGGCGGGCCTGCCGGGGAAGTGGCCAGCCCTGGCCAGCGCGCACCCCT
CCTTGCACCGGGCGCTGGACACACTGACACACGCCACCAACTTCCTCAACGTGATGCTGCAGAGCAATAAGTCGCGGGAGCAGAACTTGC
AGGACGACCTGGATTGGTACCAGGCGCTGGTGTGGAGCCTTCTGGAGGGCGAGCCCAGCATCTCCCGGGCGGCCATCACCTTCAGCACCG
ATTCGCTGTCCGCACCGGCCCCACAGGTCTTCCTCCAGGCCACGCGCGAGGAGAGCCGCATCCTGCTCCAAGACCTGTCCTCCTCCGCAC
CCCACCTGGCCAACGCCACTCTGGAGACCGAGTGGTTCCACGGCCTCCGGCGCAAGTGGAGGCCCCACTTACACCGCCGCGGCCCCAATC
AGGGGCCCCGGGGCCTGGGCCACAGCTGGCGGCGCAAGGACGGGCTCGGCGGGGACAAGAGCCACTTCAAGTGGTCTCCGCCTTATCTGG
AGTGCGAGAACGGGAGTTACAAGCCCGGGTGGCTGGTTACTCTTTCCTCTGCCATCTACGGGTTGCAGCCTAACCTGGTCCCGGAATTCA
GCATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTCAACATGA
CCAATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATGGAAACAG
CATATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAAAGTCAAA
TGATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCCATGAAGG
ATGGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTTGTTGGGG
CGATTGAAAAAAATAAAGACTCCCTTTCACAGAATCTTCTATTTGTAATGAAAACTAGTGAAAATGTCGTGATCAATCATTTGTTCCAGT
CGAAATTGTCACAAACAGGATCCCTCGTATCTGCCTATCCTTCCTTTAAATTCCGAGGACATAAGTCTGCCCTGCTCAGTAAGAAAATGA
CAGCTTCTTCAATTATTGGAGAAAACAAGAATTATCTAGAACTTAGTAAGTTATTAAAAAAGAAAGGAACTTCTACATTTCTTCAAAGAT
TGGAACGAGGAGATCCAGTCACCATAGCATCACAACTCAGGAAATCACTAATGGATATTATTGGAAAACTTCAGAAGTGCACTCCACACT
TCATTCATTGCATCAGGCCCAATAACTCAAAGCTGCCAGATACTTTTGATAATTTTTACGTGTCTGCTCAGCTACAATATATTGGGGTCC
TGGAGATGGTGAAGATCTTCCGATATGGATACCCTGTTCGCCTTTCCTTCTCGGATTTCCTGTCAAGGTATAAGCCACTGGCTGATACAT
TCCTGCGTGAGAAGAAGGAACAGTCAGCTGCCGAGCGATGTCGACTTGTTCTCCAGCAGTGTAAATTACAAGGCTGGCAGATGGGAGTCC
GAAAAGTGTTTCTAAAATACTGGCATGCTGACCAACTCAATGATTTGTGCCTACAGTTGCAGAGAAAAATTATAACCTGCCAAAAAGTTA
TCAGAGGATTTTTAGCACGCCAGCACCTGCTTCAGAGAATAAGCATCAGACAACAAGAGGTGACTTCTATCAATAGCTTTCTGCAGAACA
CAGAGGACATGGGGCTGAAAACCTACGATGCCCTGGTCATTCAGAATGCTTCAGACATTGCCCGGGAAAATGACCGGCTCCGTAGTGAAA
TGAACGCTCCCTACCATAAAGAGAAGTTAGAGGTCAGGAACATGCAAGAGGAAGGAAGCAAAAGAACCGATGACAAGAGTGGACCCAGGC
ATTTCCACCCCAGCTCCATGTCAGTCTGCGCGGCCGTGGATGGCCTGGGCCAGTGCCTCGTTGGCCCGTCCATCTGGTCTCCTTCGCTGC
ACTCGGTGTTCAGCATGGATGACAGCAGCAGCCTCCCGTCTCCACGGAAACAGCCCCCGCCCAAGCCAAAGAGGGACCCCAACACCCGGC
TGAGTGCTTCCTATGAGGCTGTGAGCGCCTGCCTCTCCGCGGCCAGGGAAGCGGCCAACGAAGCTCTGGCCCGGCCCAGACCGCACAGCG
ACGACTACAGCACCATGAAGAAGATTCCTCCTCGAAAGCCCAAGCGCAGCCCCAACACCAAGCTCAGCGGCTCCTACGAGGAGATATCGG
GGTCCCGGCCCGGGGACGCGAGGCCCGCGGGCGCCCCGGGGGCAGCAGCGCGCGTTCTGACCCCCGGGACTCCGCAGTGCGCGCTGCCCC
CGGCGGCGCCTCCGGGTGACGAGGACGACAGCGAGCCTGTGTACATCGAGATGCTGGGGCACGCGGCCAGGCCCGATAGCCCGGACCCCG
GGGAGTCCGTGTACGAGGAGATGAAGTGTTGCCTGCCCGACGACGGCGGCCCGGGCGCGGGCTCCTTCCTGCTCCACGGCGCATCGCCGC
CCCTGCTCCACCGCGCGCCGGAGGACGAGGCGGCGGGGCCCCCAGGGGACGCGTGCGACATCCCGCCGCCCTTCCCCAACCTGCTGCCGC
ACCGGCCGCCCCTGCTGGTGTTCCCCCCGACCCCCGTCACCTGCTCCCCCGCCTCCGACGAGTCGCCCCTGACACCCCTGGAGGTGAAGA
AGCTGCCAGTCCTGGAGACCAACCTCAAGTACCCCGTGCAGCCGGAGGGGTCGAGCCCGCTGTCCCCGCAGTACTCCAAGAGCCAGAAGG
GCGACGGCGACAGGCCCGCGTCCCCCGGCCTGGCGCTGTTCAACGGGTCCGGCCGAGCCTCCCCGCCGTCCACGCCGCCCCCGCCCCCGC
CCCCGCCCGGGCCGCCCCCCGCGCCCTACAGGCCCTGCGCGCACTTGGCCTTCCCGCCGGAGCCCGCCCCGGTGAACGCGGGGAAAGCGG
GGCCGAGCGCAGAGGCGCCCAAGGTTCACCCAAAGCCAAACTCTGCCCCCGTGGCCGGGCCCTGCAGCTCCTTCCCCAAGATCCCATATT
CCCCCGTGAAGGCCACCAGGGCGGACGCCAGGAAGGCCGGCTCCAGTGCCTCGCCCCCCGCGCCCTACAGCCCTCCCAGCTCCAGGCCTC
TCAGCAGCCCCCTGGACGAGCTCGCCAGCCTCTTCAACTCGGGGAGGAGTGTGCTTCGGAAATCCGCGGCGGGAAGAAAAATCAGGGAAG
CAGAAGGTTTTGAAACTAACATGAACATAAGTAGCCGAGATGACCCTAGTACGTCAGAAATTACTTCCGAGACTCAAGACAGAAATGCAA
ATAACCATGGAATTCAGTTATCTAATTCACTATCTAGTGCTATAACTGCTGAAAATGGAAATTCCATCTCAAATGGTTTACCTGAAGAAG
ATGGATACTCACGGTTGTCTATAAGTGGCACAGGGACTTCGACATTTCAAAGACACAGGGACAGTCACACCACTCAGGTAATCCATCAGC
TGAGGCTCTCAGAGAATGAAAGTGTGGCCCTGCAGGAACTCTTGGACTGGAGGAGAAAGCTCTGTGAGGAAGGACAAGACTGGCAGCAGA
TCCTGCACCACGCTGAGCCCAGGGTGCCTCCCCCACCACCTTGCAAGAAGCCCAGCCTTCTGAAGAAGCCGGAAGGGGCCTCCTGCAACA
GGCTGCCGTCTGAGCTCTGGGACACCACCATTTGATGTGGCCTGAACTGCAGACTTACAAAATAGAACTGCCTACTGATTCCGGGCTGCA
ACAACAGAAGGCTGCCTTCTGACATGCGCTGGGGCTTCTCTCCACGCATTTAGACAAAAAAAGCACAGGACACAGACACTAAATATATGA
GATCCCGTGTGTGTGTGTGTGTGTTTGTGTGTGTGTGTGTGGGTTCTTTCTTATCCATCTCGTGGTGATACACTCTGATTTTCAAGCTCC
TCATTTACGGCTCTGTGCTACCCCTAGGTAGCAAGAGAGAGGCTGGGAAAAGTGTGGACGTGGCCAGAGCGAGAGAGTAGCGGAGGAAAG
GAGCAATCCATGCACACTCTGTACAGTTGTTTTTCTACGGTTCAACAGTCTGTTTATTGTACTTCCAATGGTTTTATTATAATACAGTAT
ACGGGACATATATTTTATTTCTTTGTAGCTACTTGTGTTTTATTGGTATTATAAACCTGATAATTATTTACATGTTTATTACTGTAATTT
TATAAATTTATGCAATTGGTGGTGCTTCCTTTCTTCAAAATACAGATTTTAAAAAATCATTTCTAGATTATTTTTTTCCTCCACAGTCCT
TTTTTTTCACCTAACGCACCTAAATCTTGAAACTACATTGTTGTTTTAGCTTCGCCAGTGTCACCCCTTGCAAAACTATGAATTGAGCCC
CATGTTTTAGGTGTTACTCATGGATGAGGAGGCTGTTCTTTCCTATGCCCTGTATTTCTGGATAAGTGGATTGTGTACCCTTTAGTTAAA
TTTCACCTCCCGACTTCAGCATAGATCACAGGAAATCACATGGCACACGGTTAAACACGTATGGCTTCAAATCCATAGCCGGTGGTGTAA
AATGATCATATTCATTCAAAGGCCTACACAGTACAAATGAGCACGCTGCCATGTACTGGTTTGAGCAGTAGGGGCTGCATCGCACAGCGC
TCGTCCCCCGGGACTTACACTGCATGATTCCCTCACTGTATATCCTCAACCCTCCCATAATGCAAGGCCTTGTTCATTGATGTGCTTTCG
TCGGCTGTCGGAAAGTTCTGAGCAGTGGCTCCAGACCACCTTGTCTTGCTACTTGGAACTTTTTATTCATACCAGCCTTTGAAAAGTTAC

>In-frame_GPR158_ENST00000376351_chr10_25465251_+_MYO16_ENST00000457511_chr13_109644724_+_3084nt
AATGAGAGCGGCGGTGGCGGCAGCCGGGCCGAGAGACGGACTCGGGCTGACTCCAGCCGCTGGGAGCGCGAGGCCATGTAACCCGCTCGG
CTCCAGGCTGCGAGGTGCGTAATCCCCAGCCGGCCCCTCGCGCAGCGGGCACGGCCAGCGCTGCCACAGGTGACTTGATTTCTGCGACGG
TAGCTTAGCCACCCGGGGCCAATCTCGAAACATTCTTATTTTCAAGTCCTTTGGACTGGGTGCCATCTGGAGAAGGGGGAAGACTCCTCG
AAAAAGTCTGACTGTTGAGAAACTGACGATCCAAATTTAAAAAGTGATTCCCCCCCCTCCCGTTCCCTCCTCTTCTCTCTGGGAGGCAGA
TGGGAGCCATGGCTTACCCCTTACTCCTCTGCCTCCTGCTTGCTCAGCTGGGATTGGGAGCTGTTGGCGCCAGCCGCGACCCCCAAGGAC
GGCCGGATTCCCCTCGAGAGAGGACCCCGAAGGGGAAGCCGCACGCCCAGCAGCCGGGTCGAGCCTCTGCCTCGGACTCCTCGGCTCCCT
GGAGCCGCTCCACCGATGGCACCATCTTGGCGCAGAAACTCGCCGAGGAGGTGCCCATGGACGTGGCCTCTTACCTCTACACCGGGGACT
CCCACCAGCTGAAGCGAGCCAACTGCTCCGGCCGCTACGAGTTGGCGGGCCTGCCGGGGAAGTGGCCAGCCCTGGCCAGCGCGCACCCCT
CCTTGCACCGGGCGCTGGACACACTGACACACGCCACCAACTTCCTCAACGTGATGCTGCAGAGCAATAAGTCGCGGGAGCAGAACTTGC
AGGACGACCTGGATTGGTACCAGGCGCTGGTGTGGAGCCTTCTGGAGGGCGAGCCCAGCATCTCCCGGGCGGCCATCACCTTCAGCACCG
ATTCGCTGTCCGCACCGGCCCCACAGGTCTTCCTCCAGGCCACGCGCGAGGAGAGCCGCATCCTGCTCCAAGACCTGTCCTCCTCCGCAC
CCCACCTGGCCAACGCCACTCTGGAGACCGAGTGGTTCCACGGCCTCCGGCGCAAGTGGAGGCCCCACTTACACCGCCGCGGCCCCAATC
AGGGGCCCCGGGGCCTGGGCCACAGCTGGCGGCGCAAGGACGGGCTCGGCGGGGACAAGAGCCACTTCAAGTGGTCTCCGCCTTATCTGG
AGTGCGAGAACGGGAGTTACAAGCCCGGGTGGCTGGTTACTCTTTCCTCTGCCATCTACGGGTTGCAGCCTAACCTGGTCCCGGAATTCA
GCATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTCAACATGA
CCAATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATGGAAACAG
CATATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAAAGTCAAA
TGATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCCATGAAGG
ATGGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTTGTTGGGG
CGATTGAAAAAAATAAAGACTCCCTTTCACAGAATCTTCTATTTGTAATGAAAACTAGTGAAAATGTCGTGATCAATCATTTGTTCCAGT
CGAAATTGTCACAAACAGGATCCCTCGTATCTGCCTATCCTTCCTTTAAATTCCGAGGACATAAGTCTGCCCTGCTCAGTAAGAAAATGA
CAGCTTCTTCAATTATTGGAGAAAACAAGAATTATCTAGAACTTAGTAAGTTATTAAAAAAGAAAGGAACTTCTACATTTCTTCAAAGAT
TGGAACGAGGAGATCCAGTCACCATAGCATCACAACTCAGGAAATCACTAATGGATATTATTGGAAAACTTCAGAAGTGCACTCCACACT
TCATTCATTGCATCAGGCCCAATAACTCAAAGCTGCCAGATACTTTTGATAATTTTTACGTGTCTGCTCAGCTACAATATATTGGGGTCC
TGGAGATGGTGAAGATCTTCCGATATGGATACCCTGTTCGCCTTTCCTTCTCGGATTTCCTGTCAAGGTATAAGCCACTGGCTGATACAT
TCCTGCGTGAGAAGAAGGAACAGTCAGCTGCCGAGCGATGTCGACTTGTTCTCCAGCAGTGTAAATTACAAGGCTGGCAGATGGGAGTCC
GAAAAGTGTTTCTAAAATACTGGCATGCTGACCAACTCAATGATTTGTGCCTACAGTTGCAGAGAAAAATTATAACCTGCCAAAAAGTTA
TCAGAGGATTTTTAGCACGCCAGCACCTGCTTCAGAGAATAAGCATCAGACAACAAGAGGTGACTTCTATCAATAGCTTTCTGCAGAACA
CAGAGGACATGGGGCTGAAAACCTACGATGCCCTGGTCATTCAGAATGCTTCAGACATTGCCCGGGAAAATGACCGGCTCCGTAGTGAAA
TGAACGCTCCCTACCATAAAGAGAAGTTAGAGGTCAGGAACATGCAAGAGGAAGGAAGCAAAAGAACCGATGACAAGAGTGGACCCAGGC
ATTTCCACCCCAGCTCCATGTCAGTCTGCGCGGCCGTGGATGGCCTGGGCCAGTGCCTCGTTGGCCCGTCCATCTGGTCTCCTTCGCTGC
ACTCGGTGTTCAGCATGGATGACAGCAGCAGCCTCCCGTCTCCACGGAAACAGCCCCCGCCCAAGCCAAAGAGGGACCCCAACACCCGGC
TGAGTGCTTCCTATGAGGCTGTGAGCGCCTGCCTCTCCGCGGCCAGGGAAGCGGCCAACGAAGGTCAGCCCTGGGGAGGGACCCAGCCTC
GTGTTCCGGGCTCGCGCATGCTCTGACTTCGCCTTGGGGCGCCCATGGCAGTACTGTCGCCCTAATGTATTCTTAATAGAAATAAATCCA


Top

FusionGenePPI for GPR158_MYO16


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GPR158MYO16NRXN1, NCKAP1, CYFIP2, CYFIP1, PIK3R1, ARHGAP26, ACOT9


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GPR158_MYO16


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GPR158_MYO16


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneMYO16C0036341Schizophrenia1PSYGENET