FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1523

FusionGeneSummary for ALG11_ZFYVE28

check button Fusion gene summary
Fusion gene informationFusion gene name: ALG11_ZFYVE28
Fusion gene ID: 1523
HgeneTgene
Gene symbol

ALG11

ZFYVE28

Gene ID

440138

57732

Gene nameALG11, alpha-1,2-mannosyltransferasezinc finger FYVE-type containing 28
SynonymsCDG1P|GT8LST2|LYST2
Cytomap

13q14.3

4p16.3

Type of geneprotein-codingprotein-coding
DescriptionGDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferaseGDP-Man:Man(3)GlcNAc(2)-PP-dolichol alpha-1,2-mannosyltransferaseasparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homologasparagine-linked glycosylation protein 11 homologglylateral signaling target protein 2 homologhLst2zinc finger FYVE domain-containing protein 28zinc finger, FYVE domain containing 28
Modification date2018052320180523
UniProtAcc

Q2TAA5

Q9HCC9

Ensembl transtripts involved in fusion geneENST00000523764, ENST00000521508, 
ENST00000519151, 
ENST00000290974, 
ENST00000511071, ENST00000515312, 
ENST00000515169, ENST00000509171, 
ENST00000503000, ENST00000508471, 
ENST00000505421, 
Fusion gene scores* DoF score3 X 2 X 3=188 X 6 X 7=336
# samples 38
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(8/336*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ALG11 [Title/Abstract] AND ZFYVE28 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-55-8513-01AALG11chr13

52586598

+ZFYVE28chr4

2275943

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000523764ENST00000290974ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
In-frameENST00000523764ENST00000511071ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
In-frameENST00000523764ENST00000515312ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
5CDS-intronENST00000523764ENST00000515169ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
5CDS-intronENST00000523764ENST00000509171ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
5CDS-intronENST00000523764ENST00000503000ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
5CDS-5UTRENST00000523764ENST00000508471ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
5CDS-intronENST00000523764ENST00000505421ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
In-frameENST00000521508ENST00000290974ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
In-frameENST00000521508ENST00000511071ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
In-frameENST00000521508ENST00000515312ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
5CDS-intronENST00000521508ENST00000515169ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
5CDS-intronENST00000521508ENST00000509171ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
5CDS-intronENST00000521508ENST00000503000ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
5CDS-5UTRENST00000521508ENST00000508471ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
5CDS-intronENST00000521508ENST00000505421ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
intron-3CDSENST00000519151ENST00000290974ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
intron-3CDSENST00000519151ENST00000511071ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
intron-3CDSENST00000519151ENST00000515312ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
intron-intronENST00000519151ENST00000515169ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
intron-intronENST00000519151ENST00000509171ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
intron-intronENST00000519151ENST00000503000ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
intron-5UTRENST00000519151ENST00000508471ALG11chr13

52586598

+ZFYVE28chr4

2275943

-
intron-intronENST00000519151ENST00000505421ALG11chr13

52586598

+ZFYVE28chr4

2275943

-

Top

FusionProtFeatures for ALG11_ZFYVE28


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ALG11

Q2TAA5

ZFYVE28

Q9HCC9

Mannosyltransferase involved in the last steps of thesynthesis of Man5GlcNAc(2)-PP-dolichol core oligosaccharide on thecytoplasmic face of the endoplasmic reticulum. Catalyzes theaddition of the 4th and 5th mannose residues to the dolichol-linked oligosaccharide chain. {ECO:0000269|PubMed:20080937}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneZFYVE28chr13:52586598chr4:2275943ENST00000290974-713817_879683888Zinc fingerFYVE-type
TgeneZFYVE28chr13:52586598chr4:2275943ENST00000503000-07817_879-96288Zinc fingerFYVE-type
TgeneZFYVE28chr13:52586598chr4:2275943ENST00000509171-05817_879-110173Zinc fingerFYVE-type
TgeneZFYVE28chr13:52586598chr4:2275943ENST00000511071-612817_879653858Zinc fingerFYVE-type
TgeneZFYVE28chr13:52586598chr4:2275943ENST00000515169-07817_879-164164Zinc fingerFYVE-type
TgeneZFYVE28chr13:52586598chr4:2275943ENST00000515312-713817_879613818Zinc fingerFYVE-type

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneALG11chr13:52586598chr4:2275943ENST00000521508+1420_4014493TransmembraneHelical
HgeneALG11chr13:52586598chr4:2275943ENST00000521508+14234_25414493TransmembraneHelical


Top

FusionGeneSequence for ALG11_ZFYVE28


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ALG11_ENST00000523764_chr13_52586598_+_ZFYVE28_ENST00000290974_chr4_2275943_-_219aa
MAAGERSWCLCKLLSSSTAGSCSSDKMGPEAAPAATHAAPQATREKIRSRFHGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEV
MATKPETDDKEKLRKVTQTLRSAALEDCALCQETLSSSELAAKTRDGDFEDPPEWVPDEACGFCTACKAPFTVIRRKHHCRSCGKIFCSR

>In-frame_ALG11_ENST00000523764_chr13_52586598_+_ZFYVE28_ENST00000511071_chr4_2275943_-_219aa
MAAGERSWCLCKLLSSSTAGSCSSDKMGPEAAPAATHAAPQATREKIRSRFHGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEV
MATKPETDDKEKLRKVTQTLRSAALEDCALCQETLSSSELAAKTRDGDFEDPPEWVPDEACGFCTACKAPFTVIRRKHHCRSCGKIFCSR

>In-frame_ALG11_ENST00000523764_chr13_52586598_+_ZFYVE28_ENST00000515312_chr4_2275943_-_219aa
MAAGERSWCLCKLLSSSTAGSCSSDKMGPEAAPAATHAAPQATREKIRSRFHGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEV
MATKPETDDKEKLRKVTQTLRSAALEDCALCQETLSSSELAAKTRDGDFEDPPEWVPDEACGFCTACKAPFTVIRRKHHCRSCGKIFCSR

>In-frame_ALG11_ENST00000521508_chr13_52586598_+_ZFYVE28_ENST00000290974_chr4_2275943_-_219aa
MAAGERSWCLCKLLSSSTAGSCSSDKMGPEAAPAATHAAPQATREKIRSRFHGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEV
MATKPETDDKEKLRKVTQTLRSAALEDCALCQETLSSSELAAKTRDGDFEDPPEWVPDEACGFCTACKAPFTVIRRKHHCRSCGKIFCSR

>In-frame_ALG11_ENST00000521508_chr13_52586598_+_ZFYVE28_ENST00000511071_chr4_2275943_-_219aa
MAAGERSWCLCKLLSSSTAGSCSSDKMGPEAAPAATHAAPQATREKIRSRFHGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEV
MATKPETDDKEKLRKVTQTLRSAALEDCALCQETLSSSELAAKTRDGDFEDPPEWVPDEACGFCTACKAPFTVIRRKHHCRSCGKIFCSR

>In-frame_ALG11_ENST00000521508_chr13_52586598_+_ZFYVE28_ENST00000515312_chr4_2275943_-_219aa
MAAGERSWCLCKLLSSSTAGSCSSDKMGPEAAPAATHAAPQATREKIRSRFHGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEV
MATKPETDDKEKLRKVTQTLRSAALEDCALCQETLSSSELAAKTRDGDFEDPPEWVPDEACGFCTACKAPFTVIRRKHHCRSCGKIFCSR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ALG11_ENST00000523764_chr13_52586598_+_ZFYVE28_ENST00000290974_chr4_2275943_-_657nt
ATGGCGGCCGGCGAAAGGAGCTGGTGCCTGTGCAAGTTGTTGAGCAGCTCCACAGCTGGGTCCTGCTCCTCAGACAAGATGGGGCCAGAG
GCGGCCCCAGCAGCCACGCATGCTGCCCCACAGGCCACAAGAGAGAAGATCCGGTCCAGGTTCCACGGCAGCCACGACCTCATCCACCGC
CTGTTCGTCTGCATTTCAGGTGTGGCTGACCAGCTGCAGACGAACTATGCCAGTGACCTGAGAAGTATTCTTAAAACACTGTTTGAGGTC
ATGGCCACCAAGCCTGAAACAGACGACAAGGAAAAGTTAAGGAAGGTCACCCAGACTCTGCGGAGTGCGGCCTTGGAGGACTGTGCACTG
TGCCAGGAGACCCTGTCATCCTCTGAACTGGCAGCCAAGACCCGCGATGGGGACTTTGAAGACCCCCCGGAGTGGGTGCCAGACGAGGCC
TGTGGCTTCTGCACGGCGTGCAAAGCACCCTTCACCGTCATCCGCCGGAAGCACCACTGCCGCAGCTGTGGGAAGATCTTCTGCTCGCGC
TGCTCCTCGCACTCAGCACCGCTGCCCCGCTACGGGCAGGTGAAGCCGGTCCGAGTGTGCACCCACTGCTACATGTTCCATGTCACGCCC

>In-frame_ALG11_ENST00000523764_chr13_52586598_+_ZFYVE28_ENST00000511071_chr4_2275943_-_657nt
ATGGCGGCCGGCGAAAGGAGCTGGTGCCTGTGCAAGTTGTTGAGCAGCTCCACAGCTGGGTCCTGCTCCTCAGACAAGATGGGGCCAGAG
GCGGCCCCAGCAGCCACGCATGCTGCCCCACAGGCCACAAGAGAGAAGATCCGGTCCAGGTTCCACGGCAGCCACGACCTCATCCACCGC
CTGTTCGTCTGCATTTCAGGTGTGGCTGACCAGCTGCAGACGAACTATGCCAGTGACCTGAGAAGTATTCTTAAAACACTGTTTGAGGTC
ATGGCCACCAAGCCTGAAACAGACGACAAGGAAAAGTTAAGGAAGGTCACCCAGACTCTGCGGAGTGCGGCCTTGGAGGACTGTGCACTG
TGCCAGGAGACCCTGTCATCCTCTGAACTGGCAGCCAAGACCCGCGATGGGGACTTTGAAGACCCCCCGGAGTGGGTGCCAGACGAGGCC
TGTGGCTTCTGCACGGCGTGCAAAGCACCCTTCACCGTCATCCGCCGGAAGCACCACTGCCGCAGCTGTGGGAAGATCTTCTGCTCGCGC
TGCTCCTCGCACTCAGCACCGCTGCCCCGCTACGGGCAGGTGAAGCCGGTCCGAGTGTGCACCCACTGCTACATGTTCCATGTCACGCCC

>In-frame_ALG11_ENST00000523764_chr13_52586598_+_ZFYVE28_ENST00000515312_chr4_2275943_-_657nt
ATGGCGGCCGGCGAAAGGAGCTGGTGCCTGTGCAAGTTGTTGAGCAGCTCCACAGCTGGGTCCTGCTCCTCAGACAAGATGGGGCCAGAG
GCGGCCCCAGCAGCCACGCATGCTGCCCCACAGGCCACAAGAGAGAAGATCCGGTCCAGGTTCCACGGCAGCCACGACCTCATCCACCGC
CTGTTCGTCTGCATTTCAGGTGTGGCTGACCAGCTGCAGACGAACTATGCCAGTGACCTGAGAAGTATTCTTAAAACACTGTTTGAGGTC
ATGGCCACCAAGCCTGAAACAGACGACAAGGAAAAGTTAAGGAAGGTCACCCAGACTCTGCGGAGTGCGGCCTTGGAGGACTGTGCACTG
TGCCAGGAGACCCTGTCATCCTCTGAACTGGCAGCCAAGACCCGCGATGGGGACTTTGAAGACCCCCCGGAGTGGGTGCCAGACGAGGCC
TGTGGCTTCTGCACGGCGTGCAAAGCACCCTTCACCGTCATCCGCCGGAAGCACCACTGCCGCAGCTGTGGGAAGATCTTCTGCTCGCGC
TGCTCCTCGCACTCAGCACCGCTGCCCCGCTACGGGCAGGTGAAGCCGGTCCGAGTGTGCACCCACTGCTACATGTTCCATGTCACGCCC

>In-frame_ALG11_ENST00000521508_chr13_52586598_+_ZFYVE28_ENST00000290974_chr4_2275943_-_657nt
ATGGCGGCCGGCGAAAGGAGCTGGTGCCTGTGCAAGTTGTTGAGCAGCTCCACAGCTGGGTCCTGCTCCTCAGACAAGATGGGGCCAGAG
GCGGCCCCAGCAGCCACGCATGCTGCCCCACAGGCCACAAGAGAGAAGATCCGGTCCAGGTTCCACGGCAGCCACGACCTCATCCACCGC
CTGTTCGTCTGCATTTCAGGTGTGGCTGACCAGCTGCAGACGAACTATGCCAGTGACCTGAGAAGTATTCTTAAAACACTGTTTGAGGTC
ATGGCCACCAAGCCTGAAACAGACGACAAGGAAAAGTTAAGGAAGGTCACCCAGACTCTGCGGAGTGCGGCCTTGGAGGACTGTGCACTG
TGCCAGGAGACCCTGTCATCCTCTGAACTGGCAGCCAAGACCCGCGATGGGGACTTTGAAGACCCCCCGGAGTGGGTGCCAGACGAGGCC
TGTGGCTTCTGCACGGCGTGCAAAGCACCCTTCACCGTCATCCGCCGGAAGCACCACTGCCGCAGCTGTGGGAAGATCTTCTGCTCGCGC
TGCTCCTCGCACTCAGCACCGCTGCCCCGCTACGGGCAGGTGAAGCCGGTCCGAGTGTGCACCCACTGCTACATGTTCCATGTCACGCCC

>In-frame_ALG11_ENST00000521508_chr13_52586598_+_ZFYVE28_ENST00000511071_chr4_2275943_-_657nt
ATGGCGGCCGGCGAAAGGAGCTGGTGCCTGTGCAAGTTGTTGAGCAGCTCCACAGCTGGGTCCTGCTCCTCAGACAAGATGGGGCCAGAG
GCGGCCCCAGCAGCCACGCATGCTGCCCCACAGGCCACAAGAGAGAAGATCCGGTCCAGGTTCCACGGCAGCCACGACCTCATCCACCGC
CTGTTCGTCTGCATTTCAGGTGTGGCTGACCAGCTGCAGACGAACTATGCCAGTGACCTGAGAAGTATTCTTAAAACACTGTTTGAGGTC
ATGGCCACCAAGCCTGAAACAGACGACAAGGAAAAGTTAAGGAAGGTCACCCAGACTCTGCGGAGTGCGGCCTTGGAGGACTGTGCACTG
TGCCAGGAGACCCTGTCATCCTCTGAACTGGCAGCCAAGACCCGCGATGGGGACTTTGAAGACCCCCCGGAGTGGGTGCCAGACGAGGCC
TGTGGCTTCTGCACGGCGTGCAAAGCACCCTTCACCGTCATCCGCCGGAAGCACCACTGCCGCAGCTGTGGGAAGATCTTCTGCTCGCGC
TGCTCCTCGCACTCAGCACCGCTGCCCCGCTACGGGCAGGTGAAGCCGGTCCGAGTGTGCACCCACTGCTACATGTTCCATGTCACGCCC

>In-frame_ALG11_ENST00000521508_chr13_52586598_+_ZFYVE28_ENST00000515312_chr4_2275943_-_657nt
ATGGCGGCCGGCGAAAGGAGCTGGTGCCTGTGCAAGTTGTTGAGCAGCTCCACAGCTGGGTCCTGCTCCTCAGACAAGATGGGGCCAGAG
GCGGCCCCAGCAGCCACGCATGCTGCCCCACAGGCCACAAGAGAGAAGATCCGGTCCAGGTTCCACGGCAGCCACGACCTCATCCACCGC
CTGTTCGTCTGCATTTCAGGTGTGGCTGACCAGCTGCAGACGAACTATGCCAGTGACCTGAGAAGTATTCTTAAAACACTGTTTGAGGTC
ATGGCCACCAAGCCTGAAACAGACGACAAGGAAAAGTTAAGGAAGGTCACCCAGACTCTGCGGAGTGCGGCCTTGGAGGACTGTGCACTG
TGCCAGGAGACCCTGTCATCCTCTGAACTGGCAGCCAAGACCCGCGATGGGGACTTTGAAGACCCCCCGGAGTGGGTGCCAGACGAGGCC
TGTGGCTTCTGCACGGCGTGCAAAGCACCCTTCACCGTCATCCGCCGGAAGCACCACTGCCGCAGCTGTGGGAAGATCTTCTGCTCGCGC
TGCTCCTCGCACTCAGCACCGCTGCCCCGCTACGGGCAGGTGAAGCCGGTCCGAGTGTGCACCCACTGCTACATGTTCCATGTCACGCCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ALG11_ENST00000523764_chr13_52586598_+_ZFYVE28_ENST00000290974_chr4_2275943_-_1805nt
GAGTTCGGGGGTCGGCGGAAGATGGCGGCCGGCGAAAGGAGCTGGTGCCTGTGCAAGTTGTTGAGCAGCTCCACAGCTGGGTCCTGCTCC
TCAGACAAGATGGGGCCAGAGGCGGCCCCAGCAGCCACGCATGCTGCCCCACAGGCCACAAGAGAGAAGATCCGGTCCAGGTTCCACGGC
AGCCACGACCTCATCCACCGCCTGTTCGTCTGCATTTCAGGTGTGGCTGACCAGCTGCAGACGAACTATGCCAGTGACCTGAGAAGTATT
CTTAAAACACTGTTTGAGGTCATGGCCACCAAGCCTGAAACAGACGACAAGGAAAAGTTAAGGAAGGTCACCCAGACTCTGCGGAGTGCG
GCCTTGGAGGACTGTGCACTGTGCCAGGAGACCCTGTCATCCTCTGAACTGGCAGCCAAGACCCGCGATGGGGACTTTGAAGACCCCCCG
GAGTGGGTGCCAGACGAGGCCTGTGGCTTCTGCACGGCGTGCAAAGCACCCTTCACCGTCATCCGCCGGAAGCACCACTGCCGCAGCTGT
GGGAAGATCTTCTGCTCGCGCTGCTCCTCGCACTCAGCACCGCTGCCCCGCTACGGGCAGGTGAAGCCGGTCCGAGTGTGCACCCACTGC
TACATGTTCCATGTCACGCCCTTCTACAGCGACAAGGCCGGCCTGTGACGTGGTGCCAGGGGCAGCCCCAACCCACCCGGGCCAGGAACC
CCCAGGAAGGTGGGGCCACGCTGCAGGCAGGTCTCACTGCGTCTCATGAGGCCGCTGCCGCTGCTGCAGGGGCACCCAGACCTCCAGAGC
ATCCAGAGCCTCTGTCCTGCCCACGCTAGCCTCCCTGCAGGGACCCCGGGCCGGCTGCAGGGGCCAACAAGAGGTCAGCTTTGCCCAGCA
GGGGACCCGGAGGAGCCTGGTGGCTGCCTCAGGGCAGGGTGCCTGGCGGAGAAGGCCTGGGCCCTCCCACTGGTCCCTCGGAGATCTGCT
GGGGCTATGGGAATCGGGGCGGGTGATGGAGGTGGACAAGAGTGGGGCCACTCTGCGCCTCTGCTGTTGCGGTGAATCTGGAAGCCGGAG
CAAGGGCCACTCCACAGGCTCTTTGGCACAGCAGGGCTCCCTATGTGCCTCCCAAACGTCAAATGCAGGCTACCCATTCTCCCCATCAGC
TGCCCACCTCGTTCCCCAGCCCTCACCCCTCACCCCTCACCATCCTTCCTCAGGACTTGGCTAAACAACATGCATCTCATTTCTTCTTGG
AGTGGGGAGATGCGGGAAGCTGACCCAGTGGTCCTCTAGGCAGGCAGGGTGCTCCTGGTGTCTGCCCACCACTGTCCCCTTGCTGATGGC
ATGGGGGTCCGACCAGGCACTGACACCGCAGGCAGAGGTTGCTCGGGGCCTTGGGTCGGGTTTACCAATCAGCCAGGACGCCCGGGGCCA
CCAGCTCAGCTACCACTTCCCCTTCCCTCTGCACCCTCTGGAACCCTGGCCCAATTCCTCAGACCCCAGAGTGGCCTGGGACCCAAGCTG
CCGCAGCTGAGTGGCCCCAGCGGACACCTCCTCAGGCTTAAATCTCAGGCTTCACATTGCAATGACGATTGCAGTTTTATTTTTGGAGAT
GACACACCTACTGCTTCTTTTCTAGGATAAATCTAATTACTGTTTACTGGTGGAGTACATATGCATAGAAACGGCTTCTGTCGGGGGGAG
AGTATATAATGGAGGAAATATTATGTATTGAGATTATATTTATTTTCTAAATGCTGTAATTTGAAGCCATTTCCATAAATCTATTTAAGG

>In-frame_ALG11_ENST00000523764_chr13_52586598_+_ZFYVE28_ENST00000511071_chr4_2275943_-_1064nt
GAGTTCGGGGGTCGGCGGAAGATGGCGGCCGGCGAAAGGAGCTGGTGCCTGTGCAAGTTGTTGAGCAGCTCCACAGCTGGGTCCTGCTCC
TCAGACAAGATGGGGCCAGAGGCGGCCCCAGCAGCCACGCATGCTGCCCCACAGGCCACAAGAGAGAAGATCCGGTCCAGGTTCCACGGC
AGCCACGACCTCATCCACCGCCTGTTCGTCTGCATTTCAGGTGTGGCTGACCAGCTGCAGACGAACTATGCCAGTGACCTGAGAAGTATT
CTTAAAACACTGTTTGAGGTCATGGCCACCAAGCCTGAAACAGACGACAAGGAAAAGTTAAGGAAGGTCACCCAGACTCTGCGGAGTGCG
GCCTTGGAGGACTGTGCACTGTGCCAGGAGACCCTGTCATCCTCTGAACTGGCAGCCAAGACCCGCGATGGGGACTTTGAAGACCCCCCG
GAGTGGGTGCCAGACGAGGCCTGTGGCTTCTGCACGGCGTGCAAAGCACCCTTCACCGTCATCCGCCGGAAGCACCACTGCCGCAGCTGT
GGGAAGATCTTCTGCTCGCGCTGCTCCTCGCACTCAGCACCGCTGCCCCGCTACGGGCAGGTGAAGCCGGTCCGAGTGTGCACCCACTGC
TACATGTTCCATGTCACGCCCTTCTACAGCGACAAGGCCGGCCTGTGACGTGGTGCCAGGGGCAGCCCCAACCCACCCGGGCCAGGAACC
CCCAGGAAGGTGGGGCCACGCTGCAGGCAGGTCTCACTGCGTCTCATGAGGCCGCTGCCGCTGCTGCAGGGGCACCCAGACCTCCAGAGC
ATCCAGAGCCTCTGTCCTGCCCACGCTAGCCTCCCTGCAGGGACCCCGGGCCGGCTGCAGGGGCCAACAAGAGGTCAGCTTTGCCCAGCA
GGGGACCCGGAGGAGCCTGGTGGCTGCCTCAGGGCAGGGTGCCTGGCGGAGAAGGCCTGGGCCCTCCCACTGGTCCCTCGGAGATCTGCT

>In-frame_ALG11_ENST00000523764_chr13_52586598_+_ZFYVE28_ENST00000515312_chr4_2275943_-_908nt
GAGTTCGGGGGTCGGCGGAAGATGGCGGCCGGCGAAAGGAGCTGGTGCCTGTGCAAGTTGTTGAGCAGCTCCACAGCTGGGTCCTGCTCC
TCAGACAAGATGGGGCCAGAGGCGGCCCCAGCAGCCACGCATGCTGCCCCACAGGCCACAAGAGAGAAGATCCGGTCCAGGTTCCACGGC
AGCCACGACCTCATCCACCGCCTGTTCGTCTGCATTTCAGGTGTGGCTGACCAGCTGCAGACGAACTATGCCAGTGACCTGAGAAGTATT
CTTAAAACACTGTTTGAGGTCATGGCCACCAAGCCTGAAACAGACGACAAGGAAAAGTTAAGGAAGGTCACCCAGACTCTGCGGAGTGCG
GCCTTGGAGGACTGTGCACTGTGCCAGGAGACCCTGTCATCCTCTGAACTGGCAGCCAAGACCCGCGATGGGGACTTTGAAGACCCCCCG
GAGTGGGTGCCAGACGAGGCCTGTGGCTTCTGCACGGCGTGCAAAGCACCCTTCACCGTCATCCGCCGGAAGCACCACTGCCGCAGCTGT
GGGAAGATCTTCTGCTCGCGCTGCTCCTCGCACTCAGCACCGCTGCCCCGCTACGGGCAGGTGAAGCCGGTCCGAGTGTGCACCCACTGC
TACATGTTCCATGTCACGCCCTTCTACAGCGACAAGGCCGGCCTGTGACGTGGTGCCAGGGGCAGCCCCAACCCACCCGGGCCAGGAACC
CCCAGGAAGGTGGGGCCACGCTGCAGGCAGGTCTCACTGCGTCTCATGAGGCCGCTGCCGCTGCTGCAGGGGCACCCAGACCTCCAGAGC
ATCCAGAGCCTCTGTCCTGCCCACGCTAGCCTCCCTGCAGGGACCCCGGGCCGGCTGCAGGGGCCAACAAGAGGTCAGCTTTGCCCAGCA

>In-frame_ALG11_ENST00000521508_chr13_52586598_+_ZFYVE28_ENST00000290974_chr4_2275943_-_1789nt
GGAAGATGGCGGCCGGCGAAAGGAGCTGGTGCCTGTGCAAGTTGTTGAGCAGCTCCACAGCTGGGTCCTGCTCCTCAGACAAGATGGGGC
CAGAGGCGGCCCCAGCAGCCACGCATGCTGCCCCACAGGCCACAAGAGAGAAGATCCGGTCCAGGTTCCACGGCAGCCACGACCTCATCC
ACCGCCTGTTCGTCTGCATTTCAGGTGTGGCTGACCAGCTGCAGACGAACTATGCCAGTGACCTGAGAAGTATTCTTAAAACACTGTTTG
AGGTCATGGCCACCAAGCCTGAAACAGACGACAAGGAAAAGTTAAGGAAGGTCACCCAGACTCTGCGGAGTGCGGCCTTGGAGGACTGTG
CACTGTGCCAGGAGACCCTGTCATCCTCTGAACTGGCAGCCAAGACCCGCGATGGGGACTTTGAAGACCCCCCGGAGTGGGTGCCAGACG
AGGCCTGTGGCTTCTGCACGGCGTGCAAAGCACCCTTCACCGTCATCCGCCGGAAGCACCACTGCCGCAGCTGTGGGAAGATCTTCTGCT
CGCGCTGCTCCTCGCACTCAGCACCGCTGCCCCGCTACGGGCAGGTGAAGCCGGTCCGAGTGTGCACCCACTGCTACATGTTCCATGTCA
CGCCCTTCTACAGCGACAAGGCCGGCCTGTGACGTGGTGCCAGGGGCAGCCCCAACCCACCCGGGCCAGGAACCCCCAGGAAGGTGGGGC
CACGCTGCAGGCAGGTCTCACTGCGTCTCATGAGGCCGCTGCCGCTGCTGCAGGGGCACCCAGACCTCCAGAGCATCCAGAGCCTCTGTC
CTGCCCACGCTAGCCTCCCTGCAGGGACCCCGGGCCGGCTGCAGGGGCCAACAAGAGGTCAGCTTTGCCCAGCAGGGGACCCGGAGGAGC
CTGGTGGCTGCCTCAGGGCAGGGTGCCTGGCGGAGAAGGCCTGGGCCCTCCCACTGGTCCCTCGGAGATCTGCTGGGGCTATGGGAATCG
GGGCGGGTGATGGAGGTGGACAAGAGTGGGGCCACTCTGCGCCTCTGCTGTTGCGGTGAATCTGGAAGCCGGAGCAAGGGCCACTCCACA
GGCTCTTTGGCACAGCAGGGCTCCCTATGTGCCTCCCAAACGTCAAATGCAGGCTACCCATTCTCCCCATCAGCTGCCCACCTCGTTCCC
CAGCCCTCACCCCTCACCCCTCACCATCCTTCCTCAGGACTTGGCTAAACAACATGCATCTCATTTCTTCTTGGAGTGGGGAGATGCGGG
AAGCTGACCCAGTGGTCCTCTAGGCAGGCAGGGTGCTCCTGGTGTCTGCCCACCACTGTCCCCTTGCTGATGGCATGGGGGTCCGACCAG
GCACTGACACCGCAGGCAGAGGTTGCTCGGGGCCTTGGGTCGGGTTTACCAATCAGCCAGGACGCCCGGGGCCACCAGCTCAGCTACCAC
TTCCCCTTCCCTCTGCACCCTCTGGAACCCTGGCCCAATTCCTCAGACCCCAGAGTGGCCTGGGACCCAAGCTGCCGCAGCTGAGTGGCC
CCAGCGGACACCTCCTCAGGCTTAAATCTCAGGCTTCACATTGCAATGACGATTGCAGTTTTATTTTTGGAGATGACACACCTACTGCTT
CTTTTCTAGGATAAATCTAATTACTGTTTACTGGTGGAGTACATATGCATAGAAACGGCTTCTGTCGGGGGGAGAGTATATAATGGAGGA

>In-frame_ALG11_ENST00000521508_chr13_52586598_+_ZFYVE28_ENST00000511071_chr4_2275943_-_1048nt
GGAAGATGGCGGCCGGCGAAAGGAGCTGGTGCCTGTGCAAGTTGTTGAGCAGCTCCACAGCTGGGTCCTGCTCCTCAGACAAGATGGGGC
CAGAGGCGGCCCCAGCAGCCACGCATGCTGCCCCACAGGCCACAAGAGAGAAGATCCGGTCCAGGTTCCACGGCAGCCACGACCTCATCC
ACCGCCTGTTCGTCTGCATTTCAGGTGTGGCTGACCAGCTGCAGACGAACTATGCCAGTGACCTGAGAAGTATTCTTAAAACACTGTTTG
AGGTCATGGCCACCAAGCCTGAAACAGACGACAAGGAAAAGTTAAGGAAGGTCACCCAGACTCTGCGGAGTGCGGCCTTGGAGGACTGTG
CACTGTGCCAGGAGACCCTGTCATCCTCTGAACTGGCAGCCAAGACCCGCGATGGGGACTTTGAAGACCCCCCGGAGTGGGTGCCAGACG
AGGCCTGTGGCTTCTGCACGGCGTGCAAAGCACCCTTCACCGTCATCCGCCGGAAGCACCACTGCCGCAGCTGTGGGAAGATCTTCTGCT
CGCGCTGCTCCTCGCACTCAGCACCGCTGCCCCGCTACGGGCAGGTGAAGCCGGTCCGAGTGTGCACCCACTGCTACATGTTCCATGTCA
CGCCCTTCTACAGCGACAAGGCCGGCCTGTGACGTGGTGCCAGGGGCAGCCCCAACCCACCCGGGCCAGGAACCCCCAGGAAGGTGGGGC
CACGCTGCAGGCAGGTCTCACTGCGTCTCATGAGGCCGCTGCCGCTGCTGCAGGGGCACCCAGACCTCCAGAGCATCCAGAGCCTCTGTC
CTGCCCACGCTAGCCTCCCTGCAGGGACCCCGGGCCGGCTGCAGGGGCCAACAAGAGGTCAGCTTTGCCCAGCAGGGGACCCGGAGGAGC
CTGGTGGCTGCCTCAGGGCAGGGTGCCTGGCGGAGAAGGCCTGGGCCCTCCCACTGGTCCCTCGGAGATCTGCTGGGGCTATGGGAATCG

>In-frame_ALG11_ENST00000521508_chr13_52586598_+_ZFYVE28_ENST00000515312_chr4_2275943_-_892nt
GGAAGATGGCGGCCGGCGAAAGGAGCTGGTGCCTGTGCAAGTTGTTGAGCAGCTCCACAGCTGGGTCCTGCTCCTCAGACAAGATGGGGC
CAGAGGCGGCCCCAGCAGCCACGCATGCTGCCCCACAGGCCACAAGAGAGAAGATCCGGTCCAGGTTCCACGGCAGCCACGACCTCATCC
ACCGCCTGTTCGTCTGCATTTCAGGTGTGGCTGACCAGCTGCAGACGAACTATGCCAGTGACCTGAGAAGTATTCTTAAAACACTGTTTG
AGGTCATGGCCACCAAGCCTGAAACAGACGACAAGGAAAAGTTAAGGAAGGTCACCCAGACTCTGCGGAGTGCGGCCTTGGAGGACTGTG
CACTGTGCCAGGAGACCCTGTCATCCTCTGAACTGGCAGCCAAGACCCGCGATGGGGACTTTGAAGACCCCCCGGAGTGGGTGCCAGACG
AGGCCTGTGGCTTCTGCACGGCGTGCAAAGCACCCTTCACCGTCATCCGCCGGAAGCACCACTGCCGCAGCTGTGGGAAGATCTTCTGCT
CGCGCTGCTCCTCGCACTCAGCACCGCTGCCCCGCTACGGGCAGGTGAAGCCGGTCCGAGTGTGCACCCACTGCTACATGTTCCATGTCA
CGCCCTTCTACAGCGACAAGGCCGGCCTGTGACGTGGTGCCAGGGGCAGCCCCAACCCACCCGGGCCAGGAACCCCCAGGAAGGTGGGGC
CACGCTGCAGGCAGGTCTCACTGCGTCTCATGAGGCCGCTGCCGCTGCTGCAGGGGCACCCAGACCTCCAGAGCATCCAGAGCCTCTGTC


Top

FusionGenePPI for ALG11_ZFYVE28


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ALG11TSPAN5, HAUS7, SMPD1, TREML2, FAM63B, RAET1E, TMEM213, PVRZFYVE28EGF, RAB5A, RAB4A, RAB7A, EGFR, PRNP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ALG11_ZFYVE28


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ALG11_ZFYVE28


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneALG11C3150913CONGENITAL DISORDER OF GLYCOSYLATION, TYPE Ip2CTD_human;ORPHANET;UNIPROT