FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15096

FusionGeneSummary for GON4L_PMVK

check button Fusion gene summary
Fusion gene informationFusion gene name: GON4L_PMVK
Fusion gene ID: 15096
HgeneTgene
Gene symbol

GON4L

PMVK

Gene ID

54856

10654

Gene namegon-4 likephosphomevalonate kinase
SynonymsGON-4|GON4|YARPHUMPMKI|PMK|PMKA|PMKASE|POROK1
Cytomap

1q22

1q21.3

Type of geneprotein-codingprotein-coding
DescriptionGON-4-like protein2610100B20RikYY1AP related proteinYY1AP-related protein1gon-4 homologphosphomevalonate kinasetestis tissue sperm-binding protein Li 95mP
Modification date2018052320180523
UniProtAcc

Q3T8J9

Q15126

Ensembl transtripts involved in fusion geneENST00000437809, ENST00000368331, 
ENST00000271883, ENST00000361040, 
ENST00000471341, 
ENST00000368467, 
Fusion gene scores* DoF score11 X 12 X 10=13204 X 4 X 3=48
# samples 154
** MAII scorelog2(15/1320*10)=-3.13750352374993
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: GON4L [Title/Abstract] AND PMVK [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePMVK

GO:0006695

cholesterol biosynthetic process

8663599

TgenePMVK

GO:0016126

sterol biosynthetic process

16519518


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDTHCATCGA-EL-A3H2-01AGON4Lchr1

155727682

-PMVKchr1

154904891

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000437809ENST00000368467GON4Lchr1

155727682

-PMVKchr1

154904891

-
In-frameENST00000368331ENST00000368467GON4Lchr1

155727682

-PMVKchr1

154904891

-
In-frameENST00000271883ENST00000368467GON4Lchr1

155727682

-PMVKchr1

154904891

-
intron-3CDSENST00000361040ENST00000368467GON4Lchr1

155727682

-PMVKchr1

154904891

-
intron-3CDSENST00000471341ENST00000368467GON4Lchr1

155727682

-PMVKchr1

154904891

-

Top

FusionProtFeatures for GON4L_PMVK


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GON4L

Q3T8J9

PMVK

Q15126


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGON4Lchr1:155727682chr1:154904891ENST00000271883-25321449_156917512241Compositional biasNote=Glu-rich
HgeneGON4Lchr1:155727682chr1:154904891ENST00000271883-2532245_24817512241Compositional biasNote=Poly-Lys
HgeneGON4Lchr1:155727682chr1:154904891ENST00000271883-2532448_45417512241Compositional biasNote=Poly-Pro
HgeneGON4Lchr1:155727682chr1:154904891ENST00000271883-2532517_57617512241Compositional biasNote=Asp-rich
HgeneGON4Lchr1:155727682chr1:154904891ENST00000368331-25321449_156917512242Compositional biasNote=Glu-rich
HgeneGON4Lchr1:155727682chr1:154904891ENST00000368331-2532245_24817512242Compositional biasNote=Poly-Lys
HgeneGON4Lchr1:155727682chr1:154904891ENST00000368331-2532448_45417512242Compositional biasNote=Poly-Pro
HgeneGON4Lchr1:155727682chr1:154904891ENST00000368331-2532517_57617512242Compositional biasNote=Asp-rich
HgeneGON4Lchr1:155727682chr1:154904891ENST00000437809-25321449_156917512241Compositional biasNote=Glu-rich
HgeneGON4Lchr1:155727682chr1:154904891ENST00000437809-2532245_24817512241Compositional biasNote=Poly-Lys
HgeneGON4Lchr1:155727682chr1:154904891ENST00000437809-2532448_45417512241Compositional biasNote=Poly-Pro
HgeneGON4Lchr1:155727682chr1:154904891ENST00000437809-2532517_57617512241Compositional biasNote=Asp-rich
HgeneGON4Lchr1:155727682chr1:154904891ENST00000271883-25321624_169617512241DomainPAH 1
HgeneGON4Lchr1:155727682chr1:154904891ENST00000368331-25321624_169617512242DomainPAH 1
HgeneGON4Lchr1:155727682chr1:154904891ENST00000437809-25321624_169617512241DomainPAH 1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGON4Lchr1:155727682chr1:154904891ENST00000361040-1211449_1569-241530Compositional biasNote=Glu-rich
HgeneGON4Lchr1:155727682chr1:154904891ENST00000361040-121245_248-241530Compositional biasNote=Poly-Lys
HgeneGON4Lchr1:155727682chr1:154904891ENST00000361040-121448_454-241530Compositional biasNote=Poly-Pro
HgeneGON4Lchr1:155727682chr1:154904891ENST00000361040-121517_576-241530Compositional biasNote=Asp-rich
HgeneGON4Lchr1:155727682chr1:154904891ENST00000271883-25321706_177717512241DomainPAH 2
HgeneGON4Lchr1:155727682chr1:154904891ENST00000271883-25322148_220117512241DomainMyb-like
HgeneGON4Lchr1:155727682chr1:154904891ENST00000361040-1211624_1696-241530DomainPAH 1
HgeneGON4Lchr1:155727682chr1:154904891ENST00000361040-1211706_1777-241530DomainPAH 2
HgeneGON4Lchr1:155727682chr1:154904891ENST00000361040-1212148_2201-241530DomainMyb-like
HgeneGON4Lchr1:155727682chr1:154904891ENST00000368331-25321706_177717512242DomainPAH 2
HgeneGON4Lchr1:155727682chr1:154904891ENST00000368331-25322148_220117512242DomainMyb-like
HgeneGON4Lchr1:155727682chr1:154904891ENST00000437809-25321706_177717512241DomainPAH 2
HgeneGON4Lchr1:155727682chr1:154904891ENST00000437809-25322148_220117512241DomainMyb-like
TgenePMVKchr1:155727682chr1:154904891ENST00000368467-0517_2331193Nucleotide bindingATP


Top

FusionGeneSequence for GON4L_PMVK


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GON4L_ENST00000437809_chr1_155727682_-_PMVK_ENST00000368467_chr1_154904891_-_1912aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGGKPQMNSEGEIP
SLPSGSQSAKPVSQPRKSTQPDVCASPQEKPLRTLFHQPEEEIEDGGLFIPMEEQDNEESEKRRKKKKGTKRKRDGRGQEGTLATDLKLD
DMLDRTLEDGAKQHNLTAVNVRNILHEVITNEHVVAMMKAAISETEDMPMFEPKMTRSKLKEVVEKGVVIPTWNISPIKKANEIKPPQFV
DIHLEEDDSSDEEYQPDDEEEDETAEESLLESDVESTASSPRGAKKSRLRQSSEMTETDEESGILSEAEKVTTPAIRHISAEVVPMGPPP
PPKPKQTRDSTFMEKLHAVDEELASSPVCMDSFQPMDDSLIAFRTRSKMPLKDVPLGQLEAELQAPDITPDMTDPNTADDEDWKMWLGGL
MNDDVGNEDEADDDDDPETNFLEDLDEPDTEDFRTDRAVRITKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVAEPRPNFNTPQAL
RFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEAT
TTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMTPELL
PVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTKQLPVLGKCCEEI
QPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVVLKLKPVATRFPR
KAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESPAALPAVPPEAR
TSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLGGGCNMIQPVNAA
VAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPKLEPQELSPLSAT
VFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISGSPERDICDDIKV
EHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPPGKPEDSSSVDGQ
SVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENSQEENSEPEEEEEE
EAEGMESLQKEDEMTDEAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKLLLLTDEDILERD
PLREQKDLAFAQATLTRVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQALACGLFEEQQAF
EKSRKFLRQLEICFAENPSHHQKIIKVLQGCADCLPQEITETWS_CLCCPPALWSTQGTVCSGAWLELPETPGHQHLQGGLSEGHDPLGR
GETPG_PRLLLQEDCGGHLPAHLAGE_HTESV_HPVVSGGLWGRDADGPRCSVGAEPTAAGLGVHARGGRC_VRMWPGQLRGL_LGHREP

>In-frame_GON4L_ENST00000368331_chr1_155727682_-_PMVK_ENST00000368467_chr1_154904891_-_1912aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGGKPQMNSEGEIP
SLPSGSQSAKPVSQPRKSTQPDVCASPQEKPLRTLFHQPEEEIEDGGLFIPMEEQDNEESEKRRKKKKGTKRKRDGRGQEGTLATDLKLD
DMLDRTLEDGAKQHNLTAVNVRNILHEVITNEHVVAMMKAAISETEDMPMFEPKMTRSKLKEVVEKGVVIPTWNISPIKKANEIKPPQFV
DIHLEEDDSSDEEYQPDDEEEDETAEESLLESDVESTASSPRGAKKSRLRQSSEMTETDEESGILSEAEKVTTPAIRHISAEVVPMGPPP
PPKPKQTRDSTFMEKLHAVDEELASSPVCMDSFQPMDDSLIAFRTRSKMPLKDVPLGQLEAELQAPDITPDMTDPNTADDEDWKMWLGGL
MNDDVGNEDEADDDDDPETNFLEDLDEPDTEDFRTDRAVRITKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVAEPRPNFNTPQAL
RFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEAT
TTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMTPELL
PVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTKQLPVLGKCCEEI
QPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVVLKLKPVATRFPR
KAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESPAALPAVPPEAR
TSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLGGGCNMIQPVNAA
VAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPKLEPQELSPLSAT
VFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISGSPERDICDDIKV
EHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPPGKPEDSSSVDGQ
SVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENSQEENSEPEEEEEE
EAEGMESLQKEDEMTDEAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKLLLLTDEDILERD
PLREQKDLAFAQATLTRVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQALACGLFEEQQAF
EKSRKFLRQLEICFAENPSHHQKIIKVLQGCADCLPQEITETWS_CLCCPPALWSTQGTVCSGAWLELPETPGHQHLQGGLSEGHDPLGR
GETPG_PRLLLQEDCGGHLPAHLAGE_HTESV_HPVVSGGLWGRDADGPRCSVGAEPTAAGLGVHARGGRC_VRMWPGQLRGL_LGHREP

>In-frame_GON4L_ENST00000271883_chr1_155727682_-_PMVK_ENST00000368467_chr1_154904891_-_1912aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGGKPQMNSEGEIP
SLPSGSQSAKPVSQPRKSTQPDVCASPQEKPLRTLFHQPEEEIEDGGLFIPMEEQDNEESEKRRKKKKGTKRKRDGRGQEGTLATDLKLD
DMLDRTLEDGAKQHNLTAVNVRNILHEVITNEHVVAMMKAAISETEDMPMFEPKMTRSKLKEVVEKGVVIPTWNISPIKKANEIKPPQFV
DIHLEEDDSSDEEYQPDDEEEDETAEESLLESDVESTASSPRGAKKSRLRQSSEMTETDEESGILSEAEKVTTPAIRHISAEVVPMGPPP
PPKPKQTRDSTFMEKLHAVDEELASSPVCMDSFQPMDDSLIAFRTRSKMPLKDVPLGQLEAELQAPDITPDMTDPNTADDEDWKMWLGGL
MNDDVGNEDEADDDDDPETNFLEDLDEPDTEDFRTDRAVRITKKEVNELMEELFETFQDEMGFSNMEDDGPEEEECVAEPRPNFNTPQAL
RFEEPLANLLNEQHRTVKELFEQLKMKKSSAKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEAT
TTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMTPELL
PVCSLKAKNPQDKIVFTKAEDNLLALGLKHFEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFTKKTKQLPVLGKCCEEI
QPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDNLELGSESRYPLLLPKGVVLKLKPVATRFPR
KAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESPAALPAVPPEAR
TSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPTVRRRPSKRRGVKASPCMKPAPVIHHPASVIFTVPATTVKIVSLGGGCNMIQPVNAA
VAQSPQTIPITTLLVNPTSFPCPLNQSLVASSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPKLEPQELSPLSAT
VFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGDLEEIVKMEPEEAREEISGSPERDICDDIKV
EHAVELDTGAPSEELSSAGEVTKQTVLQKEEERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPPGKPEDSSSVDGQ
SVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWLASERRMSQEGESEEENSQEENSEPEEEEEE
EAEGMESLQKEDEMTDEAVGDSAEKPPTFASPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKLLLLTDEDILERD
PLREQKDLAFAQATLTRVREALQHIPGKTEDFLQVITEFESSTQRRTAVDLYKSLQILLQDWPQLLKDFAAFLLPEQALACGLFEEQQAF
EKSRKFLRQLEICFAENPSHHQKIIKVLQGCADCLPQEITETWS_CLCCPPALWSTQGTVCSGAWLELPETPGHQHLQGGLSEGHDPLGR
GETPG_PRLLLQEDCGGHLPAHLAGE_HTESV_HPVVSGGLWGRDADGPRCSVGAEPTAAGLGVHARGGRC_VRMWPGQLRGL_LGHREP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GON4L_ENST00000437809_chr1_155727682_-_PMVK_ENST00000368467_chr1_154904891_-_5737nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGGGAAACCTCAAATGAATTCTGAAGGGGAGATACCT
TCCCTGCCATCAGGCAGCCAATCTGCAAAACCAGTAAGCCAGCCCAGGAAATCAACCCAGCCAGATGTTTGTGCCTCTCCTCAAGAAAAG
CCACTCAGGACTCTGTTTCACCAACCTGAGGAAGAGATAGAAGATGGTGGACTCTTCATTCCAATGGAAGAACAAGACAATGAAGAAAGT
GAGAAAAGGAGAAAAAAGAAAAAGGGTACCAAGAGGAAACGAGATGGAAGGGGTCAAGAAGGGACCTTGGCATATGACCTGAAACTGGAT
GACATGCTTGACCGTACCTTGGAGGATGGTGCCAAGCAGCACAATCTAACAGCAGTCAATGTCCGAAACATCCTTCATGAAGTAATCACA
AATGAACACGTGGTAGCTATGATGAAAGCAGCCATCAGTGAGACGGAAGATATGCCAATGTTTGAGCCTAAAATGACACGCTCTAAACTG
AAGGAAGTAGTGGAAAAAGGAGTGGTAATTCCAACATGGAATATTTCACCAATTAAGAAGGCCAATGAAATTAAGCCTCCTCAGTTTGTG
GATATCCACCTTGAAGAAGATGATTCCTCAGATGAAGAATACCAGCCGGATGATGAAGAAGAAGATGAAACTGCTGAAGAGAGCTTATTG
GAAAGTGATGTTGAAAGCACTGCTTCATCTCCACGTGGGGCAAAGAAATCCAGATTGAGGCAGTCTTCTGAGATGACTGAAACAGATGAG
GAGAGTGGCATATTATCAGAGGCTGAGAAAGTCACCACACCAGCCATCAGGCACATCAGTGCTGAGGTAGTGCCCATGGGGCCCCCGCCC
CCTCCAAAGCCGAAACAGACCAGAGATAGTACTTTCATGGAGAAGTTACATGCGGTAGATGAGGAGCTGGCTTCCAGTCCAGTCTGCATG
GATTCTTTCCAGCCCATGGATGACAGTCTCATTGCATTTCGAACGCGTTCTAAGATGCCCCTGAAAGATGTTCCCCTGGGCCAATTAGAG
GCAGAGCTCCAAGCTCCAGACATCACTCCAGATATGTATGACCCCAATACGGCAGATGATGAGGACTGGAAGATGTGGCTGGGGGGACTT
ATGAATGATGATGTGGGGAATGAAGATGAAGCAGATGATGATGATGATCCAGAATATAATTTCCTGGAAGACCTCGATGAACCAGACACA
GAGGATTTCCGGACTGACCGGGCAGTGAGAATCACCAAAAAGGAAGTAAATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAG
ATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTA
CGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCA
GCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGA
CTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACT
ACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTG
TTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTC
AAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTT
CCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCAT
TTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAAC
CTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATC
CAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAA
CTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAAT
TTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGG
AAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAA
ACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAG
ACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGG
ACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTT
CGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCT
GCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCT
GTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCC
TCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGAC
ATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACT
GTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGG
ACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGAT
TTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTG
GAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAA
GAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCA
TCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAG
TCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAA
GATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTG
GCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAA
GAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCT
TCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGA
GCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGAT
CCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAA
GACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAA
GACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTT
GAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGC
TGTGCAGACTGCCTTCCCCAGGAGATCACCGAGACTTGGAGCTGATGTCTGTGCTGTCCTCCGGCTCTCTGGTCCACTCAAGGAACAGTA
TGCTCAGGAGCATGGCTTGAACTTCCAGAGACTCCTGGACACCAGCACCTACAAGGAGGCCTTTCGGAAGGACATGATCCGCTGGGGAGA
GGAGAAACGCCAGGCTGACCCAGGCTTCTTTTGCAGGAAGATTGTGGAGGGCATCTCCCAGCCCATCTGGCTGGTGAGTGACACACGGAG
AGTGTCTGACATCCAGTGGTTTCGGGAGGCCTATGGGGCCGTGACGCAGACGGTCCGCGTTGTAGCGTTGGAGCAGAGCCGACAGCAGCG
GGGCTGGGTGTTCACGCCAGGGGTGGACGATGCTGAGTCAGAATGTGGCCTGGACAACTTCGGGGACTTTGACTGGGTCATCGAGAACCA

>In-frame_GON4L_ENST00000368331_chr1_155727682_-_PMVK_ENST00000368467_chr1_154904891_-_5737nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGGGAAACCTCAAATGAATTCTGAAGGGGAGATACCT
TCCCTGCCATCAGGCAGCCAATCTGCAAAACCAGTAAGCCAGCCCAGGAAATCAACCCAGCCAGATGTTTGTGCCTCTCCTCAAGAAAAG
CCACTCAGGACTCTGTTTCACCAACCTGAGGAAGAGATAGAAGATGGTGGACTCTTCATTCCAATGGAAGAACAAGACAATGAAGAAAGT
GAGAAAAGGAGAAAAAAGAAAAAGGGTACCAAGAGGAAACGAGATGGAAGGGGTCAAGAAGGGACCTTGGCATATGACCTGAAACTGGAT
GACATGCTTGACCGTACCTTGGAGGATGGTGCCAAGCAGCACAATCTAACAGCAGTCAATGTCCGAAACATCCTTCATGAAGTAATCACA
AATGAACACGTGGTAGCTATGATGAAAGCAGCCATCAGTGAGACGGAAGATATGCCAATGTTTGAGCCTAAAATGACACGCTCTAAACTG
AAGGAAGTAGTGGAAAAAGGAGTGGTAATTCCAACATGGAATATTTCACCAATTAAGAAGGCCAATGAAATTAAGCCTCCTCAGTTTGTG
GATATCCACCTTGAAGAAGATGATTCCTCAGATGAAGAATACCAGCCGGATGATGAAGAAGAAGATGAAACTGCTGAAGAGAGCTTATTG
GAAAGTGATGTTGAAAGCACTGCTTCATCTCCACGTGGGGCAAAGAAATCCAGATTGAGGCAGTCTTCTGAGATGACTGAAACAGATGAG
GAGAGTGGCATATTATCAGAGGCTGAGAAAGTCACCACACCAGCCATCAGGCACATCAGTGCTGAGGTAGTGCCCATGGGGCCCCCGCCC
CCTCCAAAGCCGAAACAGACCAGAGATAGTACTTTCATGGAGAAGTTACATGCGGTAGATGAGGAGCTGGCTTCCAGTCCAGTCTGCATG
GATTCTTTCCAGCCCATGGATGACAGTCTCATTGCATTTCGAACGCGTTCTAAGATGCCCCTGAAAGATGTTCCCCTGGGCCAATTAGAG
GCAGAGCTCCAAGCTCCAGACATCACTCCAGATATGTATGACCCCAATACGGCAGATGATGAGGACTGGAAGATGTGGCTGGGGGGACTT
ATGAATGATGATGTGGGGAATGAAGATGAAGCAGATGATGATGATGATCCAGAATATAATTTCCTGGAAGACCTCGATGAACCAGACACA
GAGGATTTCCGGACTGACCGGGCAGTGAGAATCACCAAAAAGGAAGTAAATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAG
ATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTA
CGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCA
GCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGA
CTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACT
ACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTG
TTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTC
AAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTT
CCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCAT
TTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAAC
CTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATC
CAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAA
CTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAAT
TTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGG
AAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAA
ACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAG
ACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGG
ACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTT
CGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCT
GCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCT
GTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCC
TCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGAC
ATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACT
GTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGG
ACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGAT
TTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTG
GAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAA
GAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCA
TCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAG
TCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAA
GATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTG
GCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAA
GAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCT
TCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGA
GCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGAT
CCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAA
GACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAA
GACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTT
GAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGC
TGTGCAGACTGCCTTCCCCAGGAGATCACCGAGACTTGGAGCTGATGTCTGTGCTGTCCTCCGGCTCTCTGGTCCACTCAAGGAACAGTA
TGCTCAGGAGCATGGCTTGAACTTCCAGAGACTCCTGGACACCAGCACCTACAAGGAGGCCTTTCGGAAGGACATGATCCGCTGGGGAGA
GGAGAAACGCCAGGCTGACCCAGGCTTCTTTTGCAGGAAGATTGTGGAGGGCATCTCCCAGCCCATCTGGCTGGTGAGTGACACACGGAG
AGTGTCTGACATCCAGTGGTTTCGGGAGGCCTATGGGGCCGTGACGCAGACGGTCCGCGTTGTAGCGTTGGAGCAGAGCCGACAGCAGCG
GGGCTGGGTGTTCACGCCAGGGGTGGACGATGCTGAGTCAGAATGTGGCCTGGACAACTTCGGGGACTTTGACTGGGTCATCGAGAACCA

>In-frame_GON4L_ENST00000271883_chr1_155727682_-_PMVK_ENST00000368467_chr1_154904891_-_5737nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGGGAAACCTCAAATGAATTCTGAAGGGGAGATACCT
TCCCTGCCATCAGGCAGCCAATCTGCAAAACCAGTAAGCCAGCCCAGGAAATCAACCCAGCCAGATGTTTGTGCCTCTCCTCAAGAAAAG
CCACTCAGGACTCTGTTTCACCAACCTGAGGAAGAGATAGAAGATGGTGGACTCTTCATTCCAATGGAAGAACAAGACAATGAAGAAAGT
GAGAAAAGGAGAAAAAAGAAAAAGGGTACCAAGAGGAAACGAGATGGAAGGGGTCAAGAAGGGACCTTGGCATATGACCTGAAACTGGAT
GACATGCTTGACCGTACCTTGGAGGATGGTGCCAAGCAGCACAATCTAACAGCAGTCAATGTCCGAAACATCCTTCATGAAGTAATCACA
AATGAACACGTGGTAGCTATGATGAAAGCAGCCATCAGTGAGACGGAAGATATGCCAATGTTTGAGCCTAAAATGACACGCTCTAAACTG
AAGGAAGTAGTGGAAAAAGGAGTGGTAATTCCAACATGGAATATTTCACCAATTAAGAAGGCCAATGAAATTAAGCCTCCTCAGTTTGTG
GATATCCACCTTGAAGAAGATGATTCCTCAGATGAAGAATACCAGCCGGATGATGAAGAAGAAGATGAAACTGCTGAAGAGAGCTTATTG
GAAAGTGATGTTGAAAGCACTGCTTCATCTCCACGTGGGGCAAAGAAATCCAGATTGAGGCAGTCTTCTGAGATGACTGAAACAGATGAG
GAGAGTGGCATATTATCAGAGGCTGAGAAAGTCACCACACCAGCCATCAGGCACATCAGTGCTGAGGTAGTGCCCATGGGGCCCCCGCCC
CCTCCAAAGCCGAAACAGACCAGAGATAGTACTTTCATGGAGAAGTTACATGCGGTAGATGAGGAGCTGGCTTCCAGTCCAGTCTGCATG
GATTCTTTCCAGCCCATGGATGACAGTCTCATTGCATTTCGAACGCGTTCTAAGATGCCCCTGAAAGATGTTCCCCTGGGCCAATTAGAG
GCAGAGCTCCAAGCTCCAGACATCACTCCAGATATGTATGACCCCAATACGGCAGATGATGAGGACTGGAAGATGTGGCTGGGGGGACTT
ATGAATGATGATGTGGGGAATGAAGATGAAGCAGATGATGATGATGATCCAGAATATAATTTCCTGGAAGACCTCGATGAACCAGACACA
GAGGATTTCCGGACTGACCGGGCAGTGAGAATCACCAAAAAGGAAGTAAATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAG
ATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTA
CGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCA
GCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGA
CTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACT
ACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTG
TTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTC
AAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTT
CCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCAT
TTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAAC
CTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATC
CAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAA
CTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAAT
TTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGG
AAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAA
ACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAG
ACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGG
ACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTT
CGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCT
GCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCT
GTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCC
TCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGAC
ATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACT
GTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGG
ACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGAT
TTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTG
GAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAA
GAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCA
TCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAG
TCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAA
GATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTG
GCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAA
GAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCT
TCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGA
GCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGAT
CCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAA
GACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAA
GACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTT
GAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGC
TGTGCAGACTGCCTTCCCCAGGAGATCACCGAGACTTGGAGCTGATGTCTGTGCTGTCCTCCGGCTCTCTGGTCCACTCAAGGAACAGTA
TGCTCAGGAGCATGGCTTGAACTTCCAGAGACTCCTGGACACCAGCACCTACAAGGAGGCCTTTCGGAAGGACATGATCCGCTGGGGAGA
GGAGAAACGCCAGGCTGACCCAGGCTTCTTTTGCAGGAAGATTGTGGAGGGCATCTCCCAGCCCATCTGGCTGGTGAGTGACACACGGAG
AGTGTCTGACATCCAGTGGTTTCGGGAGGCCTATGGGGCCGTGACGCAGACGGTCCGCGTTGTAGCGTTGGAGCAGAGCCGACAGCAGCG
GGGCTGGGTGTTCACGCCAGGGGTGGACGATGCTGAGTCAGAATGTGGCCTGGACAACTTCGGGGACTTTGACTGGGTCATCGAGAACCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_GON4L_ENST00000437809_chr1_155727682_-_PMVK_ENST00000368467_chr1_154904891_-_6255nt
CTCTCCCGGAGGGGACTCCTCCCACCGCCGAGTTTTCCCGAGAATGAGGCCGCGCCCACTGACGCGCTGTGGTTCCAAAACGAGAAAGTA
CTGAAGGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGC
AATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGG
GATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGC
TCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAG
TCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGG
CCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGGG
AAACCTCAAATGAATTCTGAAGGGGAGATACCTTCCCTGCCATCAGGCAGCCAATCTGCAAAACCAGTAAGCCAGCCCAGGAAATCAACC
CAGCCAGATGTTTGTGCCTCTCCTCAAGAAAAGCCACTCAGGACTCTGTTTCACCAACCTGAGGAAGAGATAGAAGATGGTGGACTCTTC
ATTCCAATGGAAGAACAAGACAATGAAGAAAGTGAGAAAAGGAGAAAAAAGAAAAAGGGTACCAAGAGGAAACGAGATGGAAGGGGTCAA
GAAGGGACCTTGGCATATGACCTGAAACTGGATGACATGCTTGACCGTACCTTGGAGGATGGTGCCAAGCAGCACAATCTAACAGCAGTC
AATGTCCGAAACATCCTTCATGAAGTAATCACAAATGAACACGTGGTAGCTATGATGAAAGCAGCCATCAGTGAGACGGAAGATATGCCA
ATGTTTGAGCCTAAAATGACACGCTCTAAACTGAAGGAAGTAGTGGAAAAAGGAGTGGTAATTCCAACATGGAATATTTCACCAATTAAG
AAGGCCAATGAAATTAAGCCTCCTCAGTTTGTGGATATCCACCTTGAAGAAGATGATTCCTCAGATGAAGAATACCAGCCGGATGATGAA
GAAGAAGATGAAACTGCTGAAGAGAGCTTATTGGAAAGTGATGTTGAAAGCACTGCTTCATCTCCACGTGGGGCAAAGAAATCCAGATTG
AGGCAGTCTTCTGAGATGACTGAAACAGATGAGGAGAGTGGCATATTATCAGAGGCTGAGAAAGTCACCACACCAGCCATCAGGCACATC
AGTGCTGAGGTAGTGCCCATGGGGCCCCCGCCCCCTCCAAAGCCGAAACAGACCAGAGATAGTACTTTCATGGAGAAGTTACATGCGGTA
GATGAGGAGCTGGCTTCCAGTCCAGTCTGCATGGATTCTTTCCAGCCCATGGATGACAGTCTCATTGCATTTCGAACGCGTTCTAAGATG
CCCCTGAAAGATGTTCCCCTGGGCCAATTAGAGGCAGAGCTCCAAGCTCCAGACATCACTCCAGATATGTATGACCCCAATACGGCAGAT
GATGAGGACTGGAAGATGTGGCTGGGGGGACTTATGAATGATGATGTGGGGAATGAAGATGAAGCAGATGATGATGATGATCCAGAATAT
AATTTCCTGGAAGACCTCGATGAACCAGACACAGAGGATTTCCGGACTGACCGGGCAGTGAGAATCACCAAAAAGGAAGTAAATGAGCTG
ATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCTGAG
CCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACATCGGACAGTGAAGGAG
CTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCATCAG
ACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTTGCC
ACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTT
CACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACAT
GTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTGGCC
ACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAGGCT
GAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGCAAA
ACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACCAAACAG
CTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGG
TTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACTGAG
ATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTG
AAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCCAGC
CCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATT
CCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCTCCT
GCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAG
GTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCTCCC
TGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGCGGT
GGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTTGGTTAACCCTACTTCC
TTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCATCC
ACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAATTA
GAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGCCAA
GAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGCATC
CAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGATCC
CCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCTGGA
GAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGATGAA
GGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCAGGG
AAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAAGAA
GAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCAGAA
CTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAGGAG
GAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCAGTT
GGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGCATC
AAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTGCTG
TTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTGCGA
GAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCTGTA
GATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCTCTG
GCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCCTCA
CACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGACTTGGAGCTGATGTCTGTGCTGT
CCTCCGGCTCTCTGGTCCACTCAAGGAACAGTATGCTCAGGAGCATGGCTTGAACTTCCAGAGACTCCTGGACACCAGCACCTACAAGGA
GGCCTTTCGGAAGGACATGATCCGCTGGGGAGAGGAGAAACGCCAGGCTGACCCAGGCTTCTTTTGCAGGAAGATTGTGGAGGGCATCTC
CCAGCCCATCTGGCTGGTGAGTGACACACGGAGAGTGTCTGACATCCAGTGGTTTCGGGAGGCCTATGGGGCCGTGACGCAGACGGTCCG
CGTTGTAGCGTTGGAGCAGAGCCGACAGCAGCGGGGCTGGGTGTTCACGCCAGGGGTGGACGATGCTGAGTCAGAATGTGGCCTGGACAA
CTTCGGGGACTTTGACTGGGTCATCGAGAACCATGGAGTTGAACAGCGCCTGGAGGAGCAGTTGGAGAACCTGATAGAATTTATCCGCTC
CAGACTTTAGTCACTAGGTTCTAGGAGTGAGCTGGGGCCTGCTGAGGTGGGGGTGGGGCTGACTCTGCAAAATGGGGGTGTCCCCCGATC
CTGGCCGAGGTGAGGAACAGACAGGGGGGGTCTAGATTCTGAGGGGGTTGGTGGATATTGGGCAAGGCAGGAAACCTCTGGAGACCTCAT
TTTCTCCATGGGGAAGACAGCCATGCTCTTCAGGAGGAGACTCCAAGGGCAAAGGAGGGTGTCTTGGCTGTGCTTGAAGGCGAAACCCTG
CCATATCCCCAGTGCCAGTCCCCTCAGCCTGTGGTGGCCTTGCATCCTGACTGGATGTTCTCAGCCCCTTGTTCTGGGCAAGAACCCAGA

>In-frame_GON4L_ENST00000368331_chr1_155727682_-_PMVK_ENST00000368467_chr1_154904891_-_6181nt
TTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTC
CCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTC
GGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGA
GGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCAC
CCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAAT
GACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGT
CAAGGAAGAAGGAGGGAAACCTCAAATGAATTCTGAAGGGGAGATACCTTCCCTGCCATCAGGCAGCCAATCTGCAAAACCAGTAAGCCA
GCCCAGGAAATCAACCCAGCCAGATGTTTGTGCCTCTCCTCAAGAAAAGCCACTCAGGACTCTGTTTCACCAACCTGAGGAAGAGATAGA
AGATGGTGGACTCTTCATTCCAATGGAAGAACAAGACAATGAAGAAAGTGAGAAAAGGAGAAAAAAGAAAAAGGGTACCAAGAGGAAACG
AGATGGAAGGGGTCAAGAAGGGACCTTGGCATATGACCTGAAACTGGATGACATGCTTGACCGTACCTTGGAGGATGGTGCCAAGCAGCA
CAATCTAACAGCAGTCAATGTCCGAAACATCCTTCATGAAGTAATCACAAATGAACACGTGGTAGCTATGATGAAAGCAGCCATCAGTGA
GACGGAAGATATGCCAATGTTTGAGCCTAAAATGACACGCTCTAAACTGAAGGAAGTAGTGGAAAAAGGAGTGGTAATTCCAACATGGAA
TATTTCACCAATTAAGAAGGCCAATGAAATTAAGCCTCCTCAGTTTGTGGATATCCACCTTGAAGAAGATGATTCCTCAGATGAAGAATA
CCAGCCGGATGATGAAGAAGAAGATGAAACTGCTGAAGAGAGCTTATTGGAAAGTGATGTTGAAAGCACTGCTTCATCTCCACGTGGGGC
AAAGAAATCCAGATTGAGGCAGTCTTCTGAGATGACTGAAACAGATGAGGAGAGTGGCATATTATCAGAGGCTGAGAAAGTCACCACACC
AGCCATCAGGCACATCAGTGCTGAGGTAGTGCCCATGGGGCCCCCGCCCCCTCCAAAGCCGAAACAGACCAGAGATAGTACTTTCATGGA
GAAGTTACATGCGGTAGATGAGGAGCTGGCTTCCAGTCCAGTCTGCATGGATTCTTTCCAGCCCATGGATGACAGTCTCATTGCATTTCG
AACGCGTTCTAAGATGCCCCTGAAAGATGTTCCCCTGGGCCAATTAGAGGCAGAGCTCCAAGCTCCAGACATCACTCCAGATATGTATGA
CCCCAATACGGCAGATGATGAGGACTGGAAGATGTGGCTGGGGGGACTTATGAATGATGATGTGGGGAATGAAGATGAAGCAGATGATGA
TGATGATCCAGAATATAATTTCCTGGAAGACCTCGATGAACCAGACACAGAGGATTTCCGGACTGACCGGGCAGTGAGAATCACCAAAAA
GGAAGTAAATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGA
GGAGTGTGTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACTGGCCAACCTGTTAAATGAACAACA
TCGGACAGTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGAAGTAGAGAAGGTTAAACCCCAGAG
TGAGAAAGTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCAGCAGCACGTTCAGCTCTTGACCCA
AATCCACCTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCTTAAAGAGCTGGGAACCTTTGCTCA
AAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGA
AGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGAATTTCCCTGTTTGCCAAAGCAAGT
GGCTTGGATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGAT
CGTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTTTCCTAATCCTCTAATCAGCAAGTA
CCTTCTAACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTA
TAAGAAGACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCACCTATAGAGAGAGAAGAACA
CCGGCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATAT
GACTGGAACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGAATCTCGGTACCCACTGCTATTGCC
TAAGGGTGTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAGCCCCT
CCTTATCCAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAACTCATTCAGAAGCCCCTCCGAGCAA
AATGGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGA
GAGTTTTGAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAGTCCCAGACTTTGCTCTCTTC
TGCCCCTGTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAGAGAAGAGG
AGTCAAGGCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCACTGTTCCTGCTACCACTGTGAAGAT
TGTGAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCACTACCCTCTT
GGTTAACCCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTTTCTGGCAATTCTGTGAA
TCTTCCTATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGG
CCTAGAACCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGAACATAGCCCAGGGCCTCCACTAGC
AGATGCAGAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGAGGAGGGGAGGCAAGCTCTGGAGCC
GCTCCCTCAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAAGATGGAACCTGAAGAAGCTAGAGA
GGAAATCAGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATTGGACACTGGTGCCCCAAGCGAGGA
GTTGAGCAGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCCAACTAAAACCCCTTCATCTTCTCA
AGAGCCCCCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTCCTCAATGGATCCTGAAGTGAGGCT
TAGTAGCCCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGTTGGGCCAGAAACTGGAGGAGAGAA
GAATGGGCCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAATGTCATCAGCTTCTGAGGAATCTGT
GCTTTCTGTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCATGAGTCAGGAGGGTGAGTCTGAAGA
AGAGAATTCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGAAAGCCTGCAGAAAGAGGATGAAAT
GACGGATGAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCCAGAAGTGGAGACCAGCAGAACTCC
ACCAGGAGAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGGAAGTCGGGCTCGGGCCAGCAAGGA
CACCTCCAAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAAGGACTTGGCCTTTGCCCAAGCTTA
TCTGACCAGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCATCTATGAATTTGAGTCAAGTACCCA
GAGACGGACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTTGAAAGACTTTGCTGCTTTCCTGTT
ACCTGAGCAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTTCCTTCGGCAGCTGGAGATTTGCTT
TGCAGAGAACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCCCCAGGAGATCACCGAGACTTGGAG
CTGATGTCTGTGCTGTCCTCCGGCTCTCTGGTCCACTCAAGGAACAGTATGCTCAGGAGCATGGCTTGAACTTCCAGAGACTCCTGGACA
CCAGCACCTACAAGGAGGCCTTTCGGAAGGACATGATCCGCTGGGGAGAGGAGAAACGCCAGGCTGACCCAGGCTTCTTTTGCAGGAAGA
TTGTGGAGGGCATCTCCCAGCCCATCTGGCTGGTGAGTGACACACGGAGAGTGTCTGACATCCAGTGGTTTCGGGAGGCCTATGGGGCCG
TGACGCAGACGGTCCGCGTTGTAGCGTTGGAGCAGAGCCGACAGCAGCGGGGCTGGGTGTTCACGCCAGGGGTGGACGATGCTGAGTCAG
AATGTGGCCTGGACAACTTCGGGGACTTTGACTGGGTCATCGAGAACCATGGAGTTGAACAGCGCCTGGAGGAGCAGTTGGAGAACCTGA
TAGAATTTATCCGCTCCAGACTTTAGTCACTAGGTTCTAGGAGTGAGCTGGGGCCTGCTGAGGTGGGGGTGGGGCTGACTCTGCAAAATG
GGGGTGTCCCCCGATCCTGGCCGAGGTGAGGAACAGACAGGGGGGGTCTAGATTCTGAGGGGGTTGGTGGATATTGGGCAAGGCAGGAAA
CCTCTGGAGACCTCATTTTCTCCATGGGGAAGACAGCCATGCTCTTCAGGAGGAGACTCCAAGGGCAAAGGAGGGTGTCTTGGCTGTGCT
TGAAGGCGAAACCCTGCCATATCCCCAGTGCCAGTCCCCTCAGCCTGTGGTGGCCTTGCATCCTGACTGGATGTTCTCAGCCCCTTGTTC

>In-frame_GON4L_ENST00000271883_chr1_155727682_-_PMVK_ENST00000368467_chr1_154904891_-_6295nt
TGGCGCATAGTGTTAGGCGCATGCTCCTTGATGCACTGCGGCGCGGCGCTCCGAGGCTCGGGGACGCGCACGCAATTCGCTGTTGTTGGC
TGACTTCCGGTGGTGCCAAAGCCGTTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAA
GAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATC
TGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGA
TGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGA
TGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTAC
TGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTT
TTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGGGAAACCTCAAATGAATTCTGAAGGGGAGATACCTTCCCTGCCATCAGGCAG
CCAATCTGCAAAACCAGTAAGCCAGCCCAGGAAATCAACCCAGCCAGATGTTTGTGCCTCTCCTCAAGAAAAGCCACTCAGGACTCTGTT
TCACCAACCTGAGGAAGAGATAGAAGATGGTGGACTCTTCATTCCAATGGAAGAACAAGACAATGAAGAAAGTGAGAAAAGGAGAAAAAA
GAAAAAGGGTACCAAGAGGAAACGAGATGGAAGGGGTCAAGAAGGGACCTTGGCATATGACCTGAAACTGGATGACATGCTTGACCGTAC
CTTGGAGGATGGTGCCAAGCAGCACAATCTAACAGCAGTCAATGTCCGAAACATCCTTCATGAAGTAATCACAAATGAACACGTGGTAGC
TATGATGAAAGCAGCCATCAGTGAGACGGAAGATATGCCAATGTTTGAGCCTAAAATGACACGCTCTAAACTGAAGGAAGTAGTGGAAAA
AGGAGTGGTAATTCCAACATGGAATATTTCACCAATTAAGAAGGCCAATGAAATTAAGCCTCCTCAGTTTGTGGATATCCACCTTGAAGA
AGATGATTCCTCAGATGAAGAATACCAGCCGGATGATGAAGAAGAAGATGAAACTGCTGAAGAGAGCTTATTGGAAAGTGATGTTGAAAG
CACTGCTTCATCTCCACGTGGGGCAAAGAAATCCAGATTGAGGCAGTCTTCTGAGATGACTGAAACAGATGAGGAGAGTGGCATATTATC
AGAGGCTGAGAAAGTCACCACACCAGCCATCAGGCACATCAGTGCTGAGGTAGTGCCCATGGGGCCCCCGCCCCCTCCAAAGCCGAAACA
GACCAGAGATAGTACTTTCATGGAGAAGTTACATGCGGTAGATGAGGAGCTGGCTTCCAGTCCAGTCTGCATGGATTCTTTCCAGCCCAT
GGATGACAGTCTCATTGCATTTCGAACGCGTTCTAAGATGCCCCTGAAAGATGTTCCCCTGGGCCAATTAGAGGCAGAGCTCCAAGCTCC
AGACATCACTCCAGATATGTATGACCCCAATACGGCAGATGATGAGGACTGGAAGATGTGGCTGGGGGGACTTATGAATGATGATGTGGG
GAATGAAGATGAAGCAGATGATGATGATGATCCAGAATATAATTTCCTGGAAGACCTCGATGAACCAGACACAGAGGATTTCCGGACTGA
CCGGGCAGTGAGAATCACCAAAAAGGAAGTAAATGAGCTGATGGAAGAGCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACAT
GGAAGATGATGGCCCAGAAGAGGAGGAGTGTGTAGCTGAGCCTCGTCCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACCACT
GGCCAACCTGTTAAATGAACAACATCGGACAGTGAAGGAGCTATTTGAACAGCTGAAGATGAAGAAATCTTCAGCCAAACAGCTGCAGGA
AGTAGAGAAGGTTAAACCCCAGAGTGAGAAAGTTCATCAGACTCTGATTCTGGACCCAGCACAGAGGAAGAGACTCCAGCAGCAGATGCA
GCAGCACGTTCAGCTCTTGACCCAAATCCACCTTCTTGCCACCTGCAACCCCAACCTCAATCCGGAGGCCACTACCACCAGGATATTTCT
TAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTT
GATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCGAATGA
ATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATTCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAA
GGCAAAGAATCCCCAGGATAAGATCGTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGAACTGAGTT
TCCTAATCCTCTAATCAGCAAGTACCTTCTAACCTGCAAAACTGCCCACCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGC
TCCTGACAACATCATTAAATTTTATAAGAAGACCAAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAA
GCCACCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATCCAGGAAGAACTGCGGCACATGGCTGA
TGGTGCTAGAGAGGTAGGAAATATGACTGGAACCACTGAGATCAACTCAGATCGAAGCCTAGAAAAAGACAATTTGGAGTTGGGGAGTGA
ATCTCGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTGAAACTGAAGCCAGTTGCCACCCGTTTCCCCAGGAAGGCTTGGAGACAGAA
GCGTTCATCAGTCCTGAAGCCCCTCCTTATCCAACCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCGATCAAC
TCATTCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACTGTTTTACAGACAGTTCCAGGTGTCCC
TCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAGTCTCCTGCAGCACTGCCTGCTGTGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTC
TGAGTCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAGGTAATGCTGCCCTCCCTTGCCCCTTCTAAGTTTCGAAAGCCATATGTGAG
ACGGAGACCCTCAAAGAGAAGAGGAGTCAAGGCCTCTCCCTGTATGAAACCTGCCCCTGTTATCCACCACCCTGCATCTGTTATCTTCAC
TGTTCCTGCTACCACTGTGAAGATTGTGAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAATGCGGCTGTGGCCCAGAGTCCCCA
GACTATTCCCATCACTACCCTCTTGGTTAACCCTACTTCCTTCCCCTGTCCATTGAACCAGTCCCTTGTGGCCTCCTCTGTCTCACCCTT
AATTGTTTCTGGCAATTCTGTGAATCTTCCTATACCATCCACCCCTGAAGATAAGGCCCACGTGAATGTGGACATTGCTTGTGCTGTGGC
TGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAATTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCGAAAGTGGA
ACATAGCCCAGGGCCTCCACTAGCAGATGCAGAGTGCCAAGAAGGATTGTCAGAGAATAGTGCCTGTCGCTGGACCGTTGTGAAAACAGA
GGAGGGGAGGCAAGCTCTGGAGCCGCTCCCTCAGGGCATCCAGGAGTCTCTAAACAACCCTACCCCTGGGGATTTAGAGGAAATTGTCAA
GATGGAACCTGAAGAAGCTAGAGAGGAAATCAGTGGATCCCCTGAGCGTGATATTTGTGATGACATCAAAGTGGAACATGCTGTGGAATT
GGACACTGGTGCCCCAAGCGAGGAGTTGAGCAGTGCTGGAGAAGTAACGAAACAGACAGTCTTACAGAAGGAAGAGGAGAGGAGTCAGCC
AACTAAAACCCCTTCATCTTCTCAAGAGCCCCCTGATGAAGGAACCTCAGGGACAGATGTGAACAAAGGATCATCAAAGAATGCTTTGTC
CTCAATGGATCCTGAAGTGAGGCTTAGTAGCCCCCCAGGGAAGCCAGAAGATTCATCCAGTGTTGATGGTCAGTCAGTGGGGACTCCAGT
TGGGCCAGAAACTGGAGGAGAGAAGAATGGGCCAGAAGAAGAGGAAGAAGAGGACTTTGATGACCTCACCCAAGATGAGGAAGATGAAAT
GTCATCAGCTTCTGAGGAATCTGTGCTTTCTGTCCCAGAACTCCAGGAAACAATGGAGAAACTGACTTGGCTGGCATCTGAAAGGCGCAT
GAGTCAGGAGGGTGAGTCTGAAGAAGAGAATTCTCAGGAGGAGAACTCTGAGCCAGAAGAAGAGGAGGAAGAAGAAGCAGAAGGAATGGA
AAGCCTGCAGAAAGAGGATGAAATGACGGATGAAGCAGTTGGAGACTCTGCTGAGAAGCCTCCTACTTTTGCTTCACCTGAGACTGCTCC
AGAAGTGGAGACCAGCAGAACTCCACCAGGAGAGAGCATCAAAGCTGCTGGAAAAGGCCGGAACAATCATCGAGCTCGCAACAAGCGGGG
AAGTCGGGCTCGGGCCAGCAAGGACACCTCCAAGCTGCTGTTGCTGTATGATGAGGACATTCTCGAGCGAGATCCACTCAGGGAGCAGAA
GGACTTGGCCTTTGCCCAAGCTTATCTGACCAGGGTGCGAGAAGCCCTACAACATATCCCTGGCAAGTATGAAGACTTCCTTCAAGTCAT
CTATGAATTTGAGTCAAGTACCCAGAGACGGACGGCTGTAGATCTCTACAAAAGCCTGCAAATTCTGCTCCAAGACTGGCCTCAGCTGTT
GAAAGACTTTGCTGCTTTCCTGTTACCTGAGCAAGCTCTGGCCTGTGGATTATTTGAGGAGCAGCAGGCTTTTGAGAAGAGCCGCAAGTT
CCTTCGGCAGCTGGAGATTTGCTTTGCAGAGAACCCCTCACACCACCAGAAGATTATCAAGGTCCTCCAAGGCTGTGCAGACTGCCTTCC
CCAGGAGATCACCGAGACTTGGAGCTGATGTCTGTGCTGTCCTCCGGCTCTCTGGTCCACTCAAGGAACAGTATGCTCAGGAGCATGGCT
TGAACTTCCAGAGACTCCTGGACACCAGCACCTACAAGGAGGCCTTTCGGAAGGACATGATCCGCTGGGGAGAGGAGAAACGCCAGGCTG
ACCCAGGCTTCTTTTGCAGGAAGATTGTGGAGGGCATCTCCCAGCCCATCTGGCTGGTGAGTGACACACGGAGAGTGTCTGACATCCAGT
GGTTTCGGGAGGCCTATGGGGCCGTGACGCAGACGGTCCGCGTTGTAGCGTTGGAGCAGAGCCGACAGCAGCGGGGCTGGGTGTTCACGC
CAGGGGTGGACGATGCTGAGTCAGAATGTGGCCTGGACAACTTCGGGGACTTTGACTGGGTCATCGAGAACCATGGAGTTGAACAGCGCC
TGGAGGAGCAGTTGGAGAACCTGATAGAATTTATCCGCTCCAGACTTTAGTCACTAGGTTCTAGGAGTGAGCTGGGGCCTGCTGAGGTGG
GGGTGGGGCTGACTCTGCAAAATGGGGGTGTCCCCCGATCCTGGCCGAGGTGAGGAACAGACAGGGGGGGTCTAGATTCTGAGGGGGTTG
GTGGATATTGGGCAAGGCAGGAAACCTCTGGAGACCTCATTTTCTCCATGGGGAAGACAGCCATGCTCTTCAGGAGGAGACTCCAAGGGC
AAAGGAGGGTGTCTTGGCTGTGCTTGAAGGCGAAACCCTGCCATATCCCCAGTGCCAGTCCCCTCAGCCTGTGGTGGCCTTGCATCCTGA


Top

FusionGenePPI for GON4L_PMVK


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GON4LDHX16, PNKD, HIST1H2BA, KRAS, HIST1H2BG, CRAMP1L, H2AFX, ASB3, TRIM25PMVKCENPH, PITPNA, RGS20, TBPL1, MPDU1, SSB, MLF2, RASGRF2, WDR92, ARL6IP6, MBD5, SCNM1, SLC25A35, SLC25A32, SNRNP27, FGB, GTF2E2, C4orf26, SETD3, NPPA, FSD1, FYTTD1, NKD2, RDH12, SDHA, MCPH1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GON4L_PMVK


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GON4L_PMVK


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGON4LC3714756Intellectual Disability1CTD_human