FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15088

FusionGeneSummary for GON4L_ARHGEF2

check button Fusion gene summary
Fusion gene informationFusion gene name: GON4L_ARHGEF2
Fusion gene ID: 15088
HgeneTgene
Gene symbol

GON4L

ARHGEF2

Gene ID

54856

9181

Gene namegon-4 likeRho/Rac guanine nucleotide exchange factor 2
SynonymsGON-4|GON4|YARPGEF|GEF-H1|GEFH1|LFP40|NEDMHM|P40
Cytomap

1q22

1q22

Type of geneprotein-codingprotein-coding
DescriptionGON-4-like protein2610100B20RikYY1AP related proteinYY1AP-related protein1gon-4 homologrho guanine nucleotide exchange factor 2Rho/Rac guanine nucleotide exchange factor (GEF) 2guanine nucleotide exchange factor H1microtubule-regulated Rho-GEFproliferating cell nucleolar antigen p40
Modification date2018052320180522
UniProtAcc

Q3T8J9

Q92974

Ensembl transtripts involved in fusion geneENST00000437809, ENST00000368331, 
ENST00000271883, ENST00000361040, 
ENST00000471341, 
ENST00000368315, 
ENST00000313695, ENST00000361247, 
ENST00000368316, ENST00000462460, 
ENST00000477754, ENST00000313667, 
Fusion gene scores* DoF score11 X 12 X 10=13205 X 8 X 7=280
# samples 1511
** MAII scorelog2(15/1320*10)=-3.13750352374993
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/280*10)=-1.34792330342031
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: GON4L [Title/Abstract] AND ARHGEF2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneARHGEF2

GO:0032755

positive regulation of interleukin-6 production

21887730

TgeneARHGEF2

GO:0032760

positive regulation of tumor necrosis factor production

21887730

TgeneARHGEF2

GO:0045666

positive regulation of neuron differentiation

28453519

TgeneARHGEF2

GO:0045944

positive regulation of transcription by RNA polymerase II

21887730

TgeneARHGEF2

GO:0050731

positive regulation of peptidyl-tyrosine phosphorylation

21887730

TgeneARHGEF2

GO:0051092

positive regulation of NF-kappaB transcription factor activity

19043560|21887730

TgeneARHGEF2

GO:0055059

asymmetric neuroblast division

28453519

TgeneARHGEF2

GO:0071225

cellular response to muramyl dipeptide

21887730


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-XF-A9T3-01AGON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
TCGALDBRCATCGA-OL-A5D7-01AGON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
TCGARVCESCTCGA-HM-A6W2-01AGON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
TCGALDPCPGTCGA-QR-A6GS-01AGON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000437809ENST00000368315GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000437809ENST00000313695GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000437809ENST00000361247GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000437809ENST00000368316GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000437809ENST00000462460GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5CDS-intronENST00000437809ENST00000477754GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5CDS-intronENST00000437809ENST00000313667GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000368331ENST00000368315GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000368331ENST00000313695GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000368331ENST00000361247GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000368331ENST00000368316GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000368331ENST00000462460GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5CDS-intronENST00000368331ENST00000477754GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5CDS-intronENST00000368331ENST00000313667GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000271883ENST00000368315GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000271883ENST00000313695GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000271883ENST00000361247GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000271883ENST00000368316GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000271883ENST00000462460GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5CDS-intronENST00000271883ENST00000477754GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5CDS-intronENST00000271883ENST00000313667GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000361040ENST00000368315GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000361040ENST00000313695GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000361040ENST00000361247GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000361040ENST00000368316GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
Frame-shitENST00000361040ENST00000462460GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5CDS-intronENST00000361040ENST00000477754GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5CDS-intronENST00000361040ENST00000313667GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5UTR-3CDSENST00000471341ENST00000368315GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5UTR-3CDSENST00000471341ENST00000313695GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5UTR-3CDSENST00000471341ENST00000361247GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5UTR-3CDSENST00000471341ENST00000368316GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5UTR-3CDSENST00000471341ENST00000462460GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5UTR-intronENST00000471341ENST00000477754GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5UTR-intronENST00000471341ENST00000313667GON4Lchr1

155823067

-ARHGEF2chr1

155922619

-
5CDS-intronENST00000437809ENST00000368315GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000437809ENST00000313695GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000437809ENST00000361247GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000437809ENST00000368316GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000437809ENST00000462460GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-5UTRENST00000437809ENST00000477754GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000437809ENST00000313667GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000368331ENST00000368315GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000368331ENST00000313695GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000368331ENST00000361247GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000368331ENST00000368316GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000368331ENST00000462460GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-5UTRENST00000368331ENST00000477754GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000368331ENST00000313667GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000271883ENST00000368315GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000271883ENST00000313695GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000271883ENST00000361247GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000271883ENST00000368316GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000271883ENST00000462460GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-5UTRENST00000271883ENST00000477754GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000271883ENST00000313667GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000361040ENST00000368315GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000361040ENST00000313695GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000361040ENST00000361247GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000361040ENST00000368316GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000361040ENST00000462460GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-5UTRENST00000361040ENST00000477754GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5CDS-intronENST00000361040ENST00000313667GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5UTR-intronENST00000471341ENST00000368315GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5UTR-intronENST00000471341ENST00000313695GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5UTR-intronENST00000471341ENST00000361247GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5UTR-intronENST00000471341ENST00000368316GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5UTR-intronENST00000471341ENST00000462460GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5UTR-5UTRENST00000471341ENST00000477754GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
5UTR-intronENST00000471341ENST00000313667GON4Lchr1

155790397

-ARHGEF2chr1

155966418

-
Frame-shitENST00000437809ENST00000368315GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000437809ENST00000313695GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000437809ENST00000361247GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000437809ENST00000368316GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000437809ENST00000462460GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000437809ENST00000477754GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000437809ENST00000313667GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
Frame-shitENST00000368331ENST00000368315GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368331ENST00000313695GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368331ENST00000361247GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368331ENST00000368316GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368331ENST00000462460GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000368331ENST00000477754GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000368331ENST00000313667GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
Frame-shitENST00000271883ENST00000368315GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000271883ENST00000313695GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000271883ENST00000361247GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000271883ENST00000368316GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000271883ENST00000462460GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000271883ENST00000477754GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000271883ENST00000313667GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
Frame-shitENST00000361040ENST00000368315GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000361040ENST00000313695GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000361040ENST00000361247GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000361040ENST00000368316GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000361040ENST00000462460GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000361040ENST00000477754GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000361040ENST00000313667GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5UTR-3CDSENST00000471341ENST00000368315GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5UTR-5UTRENST00000471341ENST00000313695GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5UTR-5UTRENST00000471341ENST00000361247GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5UTR-5UTRENST00000471341ENST00000368316GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5UTR-5UTRENST00000471341ENST00000462460GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5UTR-intronENST00000471341ENST00000477754GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
5UTR-intronENST00000471341ENST00000313667GON4Lchr1

155746186

-ARHGEF2chr1

155939091

-
In-frameENST00000437809ENST00000368315GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000437809ENST00000313695GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000437809ENST00000361247GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000437809ENST00000368316GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000437809ENST00000462460GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5CDS-intronENST00000437809ENST00000477754GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5CDS-intronENST00000437809ENST00000313667GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000368331ENST00000368315GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000368331ENST00000313695GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000368331ENST00000361247GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000368331ENST00000368316GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000368331ENST00000462460GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5CDS-intronENST00000368331ENST00000477754GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5CDS-intronENST00000368331ENST00000313667GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000271883ENST00000368315GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000271883ENST00000313695GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000271883ENST00000361247GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000271883ENST00000368316GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000271883ENST00000462460GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5CDS-intronENST00000271883ENST00000477754GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5CDS-intronENST00000271883ENST00000313667GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000361040ENST00000368315GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000361040ENST00000313695GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000361040ENST00000361247GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000361040ENST00000368316GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
In-frameENST00000361040ENST00000462460GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5CDS-intronENST00000361040ENST00000477754GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5CDS-intronENST00000361040ENST00000313667GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5UTR-3CDSENST00000471341ENST00000368315GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5UTR-3CDSENST00000471341ENST00000313695GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5UTR-3CDSENST00000471341ENST00000361247GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5UTR-3CDSENST00000471341ENST00000368316GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5UTR-3CDSENST00000471341ENST00000462460GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5UTR-intronENST00000471341ENST00000477754GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-
5UTR-intronENST00000471341ENST00000313667GON4Lchr1

155823067

-ARHGEF2chr1

155932509

-

Top

FusionProtFeatures for GON4L_ARHGEF2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GON4L

Q3T8J9

ARHGEF2

Q92974

Activates Rho-GTPases by promoting the exchange of GDPfor GTP. May be involved in epithelial barrier permeability, cellmotility and polarization, dendritic spine morphology, antigenpresentation, leukemic cell differentiation, cell cycleregulation, innate immune response, and cancer. Binds Rac-GTPases,but does not seem to promote nucleotide exchange activity towardRac-GTPases, which was uniquely reported in PubMed:9857026. Maystimulate instead the cortical activity of Rac. Inactive towardCDC42, TC10, or Ras-GTPases. Forms an intracellular sensing systemalong with NOD1 for the detection of microbial effectors duringcell invasion by pathogens. Required for RHOA and RIP2 dependentNF-kappaB signaling pathways activation upon S.flexneri cellinvasion. Involved not only in sensing peptidoglycan (PGN)-derivedmuropeptides through NOD1 that is independent of its GEF activity,but also in the activation of NF-kappaB by Shigella effectorproteins (IpgB2 and OspB) which requires its GEF activity and theactivation of RhoA. Involved in innate immune signalingtransduction pathway promoting cytokine IL6/interleukin-6 and TNF-alpha secretion in macrophage upon stimulation by bacterialpeptidoglycans; acts as a signaling intermediate between NOD2receptor and RIPK2 kinase. Contributes to the tyrosinephosphorylation of RIPK2 through Src tyrosine kinase leading toNF-kappaB activation by NOD2. Overexpression activates Rho-, butnot Rac-GTPases, and increases paracellular permeability (Bysimilarity). Involved in neuronal progenitor cell division anddifferentiation (PubMed:28453519). Involved in the migration ofprecerebellar neurons (By similarity).{ECO:0000250|UniProtKB:Q60875, ECO:0000250|UniProtKB:Q865S3,ECO:0000269|PubMed:19043560, ECO:0000269|PubMed:21887730,ECO:0000269|PubMed:28453519, ECO:0000269|PubMed:9857026}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000313667-722587_611324986Coiled coilOntology_term=ECO:0000255
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000313667-722798_867324986Coiled coilOntology_term=ECO:0000255
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000313695-722587_611297959Coiled coilOntology_term=ECO:0000255
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000313695-722798_867297959Coiled coilOntology_term=ECO:0000255
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000361247-722587_611325987Coiled coilOntology_term=ECO:0000255
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000361247-722798_867325987Coiled coilOntology_term=ECO:0000255
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000368316-1126587_611297959Coiled coilOntology_term=ECO:0000255
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000368316-1126798_867297959Coiled coilOntology_term=ECO:0000255
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000313667-722472_571324986DomainPH
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000313695-722472_571297959DomainPH
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000361247-722472_571325987DomainPH
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000368316-1126472_571297959DomainPH

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGON4Lchr1:155823067chr1:155932509ENST00000271883-2321449_15691682241Compositional biasNote=Glu-rich
HgeneGON4Lchr1:155823067chr1:155932509ENST00000271883-232245_2481682241Compositional biasNote=Poly-Lys
HgeneGON4Lchr1:155823067chr1:155932509ENST00000271883-232448_4541682241Compositional biasNote=Poly-Pro
HgeneGON4Lchr1:155823067chr1:155932509ENST00000271883-232517_5761682241Compositional biasNote=Asp-rich
HgeneGON4Lchr1:155823067chr1:155932509ENST00000361040-2211449_15691681530Compositional biasNote=Glu-rich
HgeneGON4Lchr1:155823067chr1:155932509ENST00000361040-221245_2481681530Compositional biasNote=Poly-Lys
HgeneGON4Lchr1:155823067chr1:155932509ENST00000361040-221448_4541681530Compositional biasNote=Poly-Pro
HgeneGON4Lchr1:155823067chr1:155932509ENST00000361040-221517_5761681530Compositional biasNote=Asp-rich
HgeneGON4Lchr1:155823067chr1:155932509ENST00000368331-2321449_15691682242Compositional biasNote=Glu-rich
HgeneGON4Lchr1:155823067chr1:155932509ENST00000368331-232245_2481682242Compositional biasNote=Poly-Lys
HgeneGON4Lchr1:155823067chr1:155932509ENST00000368331-232448_4541682242Compositional biasNote=Poly-Pro
HgeneGON4Lchr1:155823067chr1:155932509ENST00000368331-232517_5761682242Compositional biasNote=Asp-rich
HgeneGON4Lchr1:155823067chr1:155932509ENST00000437809-2321449_15691682241Compositional biasNote=Glu-rich
HgeneGON4Lchr1:155823067chr1:155932509ENST00000437809-232245_2481682241Compositional biasNote=Poly-Lys
HgeneGON4Lchr1:155823067chr1:155932509ENST00000437809-232448_4541682241Compositional biasNote=Poly-Pro
HgeneGON4Lchr1:155823067chr1:155932509ENST00000437809-232517_5761682241Compositional biasNote=Asp-rich
HgeneGON4Lchr1:155823067chr1:155932509ENST00000271883-2321624_16961682241DomainPAH 1
HgeneGON4Lchr1:155823067chr1:155932509ENST00000271883-2321706_17771682241DomainPAH 2
HgeneGON4Lchr1:155823067chr1:155932509ENST00000271883-2322148_22011682241DomainMyb-like
HgeneGON4Lchr1:155823067chr1:155932509ENST00000361040-2211624_16961681530DomainPAH 1
HgeneGON4Lchr1:155823067chr1:155932509ENST00000361040-2211706_17771681530DomainPAH 2
HgeneGON4Lchr1:155823067chr1:155932509ENST00000361040-2212148_22011681530DomainMyb-like
HgeneGON4Lchr1:155823067chr1:155932509ENST00000368331-2321624_16961682242DomainPAH 1
HgeneGON4Lchr1:155823067chr1:155932509ENST00000368331-2321706_17771682242DomainPAH 2
HgeneGON4Lchr1:155823067chr1:155932509ENST00000368331-2322148_22011682242DomainMyb-like
HgeneGON4Lchr1:155823067chr1:155932509ENST00000437809-2321624_16961682241DomainPAH 1
HgeneGON4Lchr1:155823067chr1:155932509ENST00000437809-2321706_17771682241DomainPAH 2
HgeneGON4Lchr1:155823067chr1:155932509ENST00000437809-2322148_22011682241DomainMyb-like
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000313667-722235_432324986DomainDH
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000313695-722235_432297959DomainDH
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000361247-722235_432325987DomainDH
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000368316-1126235_432297959DomainDH
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000313667-72239_86324986Zinc fingerPhorbol-ester/DAG-type
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000313695-72239_86297959Zinc fingerPhorbol-ester/DAG-type
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000361247-72239_86325987Zinc fingerPhorbol-ester/DAG-type
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000368316-112639_86297959Zinc fingerPhorbol-ester/DAG-type


Top

FusionGeneSequence for GON4L_ARHGEF2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000368315_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000313695_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000361247_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000368316_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000462460_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000368315_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000313695_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000361247_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000368316_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000462460_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000368315_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000313695_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000361247_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000368316_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000462460_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000368315_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000313695_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000361247_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000368316_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000462460_chr1_155932509_-_830aa
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFEVQSLQDAGNQLGMEDTSLSSGMLTQNTNVP
ILEGVDVAISQGITLPSLESFHPLNIHIGKGKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGVLRS_CGADV_D
LLGVLQPPQQGLKAL_GAVRPRQTLPAIHPESDPPRRAQAARGTGVHPAGDSAHHQVPVTHQPHPAAFPRDRGGAPGPDHSTGASEGAAV
QCGRGTLSAGERGPSAGDLQPHGPSGPNPSAWQGPLWPRGTSEAQTHPRWLPALEDSDGALQRCASAADDRCTGVSPGKGPEVHLSYPGQ
AFSGIAAESNRTRHCQPGERDVSDQRSPT_DVRGAHSIPG_PEHLDPGHSAERAHMPIQGGLPPD_DRG_GLPAAN_DGVAAEGPGTGGA
AAREGRAVC_DDPFPGRRGWWQWDGPAHPAQGPFPL_VP_VPSWRAAAAGCHP_GGGSERPAGGARSGTALDTPRASPALGTRQRW_HES
WGHCQW_GQNLQWLH_TLQS_LRL_PEGSKWKSAEITARGGVTAIGQSLWTSTWPTGSCGPAGHSDGSPVP_GP_AAGEAVPSQLSGWGG
WQGWGCPCGP_KAGHGTGITAAATCAAAGGATALPAAR_RTGNRSWQPGGPAPGE_AGPGTAGA_GRRGSKAAGRPGPDRATPS_GPLGP
QTCGSSAAQPPRRRCPVLEFQPPTAQPRH_PPGSTCHYSLCPSKL_GPREAGTGEPRRAAARQQ_P_HWQRGGR_QPSVSAPQSTRLYQN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000368315_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000313695_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000361247_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000368316_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000462460_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000368315_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000313695_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000361247_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000368316_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000462460_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000368315_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000313695_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000361247_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000368316_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000462460_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000368315_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000313695_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000361247_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000368316_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000462460_chr1_155932509_-_2491nt
ATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCA
GCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAA
GTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCA
ATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAA
GGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTT
ACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGAC
CTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCG
GAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACT
CATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTC
CAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGT
GCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCG
CTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAA
GCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGA
GATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGA
GGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCT
GCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCC
CAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGA
CCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCC
TGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAA
TGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGC
CCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGC
TGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGA
GCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGC
ACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCG
CAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGA
CCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCT
GCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000368315_chr1_155932509_-_3717nt
CTCTCCCGGAGGGGACTCCTCCCACCGCCGAGTTTTCCCGAGAATGAGGCCGCGCCCACTGACGCGCTGTGGTTCCAAAACGAGAAAGTA
CTGAAGGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGC
AATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGG
GATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGC
TCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAG
TCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGG
CCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTT
CTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTA
CGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCT
GGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGAC
CACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTA
CAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGA
TGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAA
GGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAA
AGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCAT
TCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGA
GTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGA
TGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCA
GGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCC
CTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAG
AGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTA
TGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAA
GCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATT
ACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGA
GGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGAC
CGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAG
TTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGA
GAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTC
TCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAG
CTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAG
GGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCC
ACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTA
TTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAA
CACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGG
CTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTG
CTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAAT
GGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACG
TGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAA
TGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAA
TCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTG
CCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAAAAAAAAATTCAGGGAAAATTAAAAA

>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000313695_chr1_155932509_-_3702nt
CTCTCCCGGAGGGGACTCCTCCCACCGCCGAGTTTTCCCGAGAATGAGGCCGCGCCCACTGACGCGCTGTGGTTCCAAAACGAGAAAGTA
CTGAAGGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGC
AATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGG
GATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGC
TCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAG
TCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGG
CCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTT
CTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTA
CGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCT
GGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGAC
CACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTA
CAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGA
TGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAA
GGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAA
AGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCAT
TCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGA
GTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGA
TGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCA
GGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCC
CTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAG
AGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTA
TGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAA
GCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATT
ACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGA
GGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGAC
CGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAG
TTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGA
GAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTC
TCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAG
CTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAG
GGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCC
ACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTA
TTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAA
CACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGG
CTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTG
CTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAAT
GGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACG
TGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAA
TGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAA
TCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTG
CCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAAAAAAAAATTCAGGGAAAATTAAAAA

>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000361247_chr1_155932509_-_3702nt
CTCTCCCGGAGGGGACTCCTCCCACCGCCGAGTTTTCCCGAGAATGAGGCCGCGCCCACTGACGCGCTGTGGTTCCAAAACGAGAAAGTA
CTGAAGGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGC
AATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGG
GATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGC
TCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAG
TCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGG
CCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTT
CTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTA
CGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCT
GGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGAC
CACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTA
CAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGA
TGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAA
GGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAA
AGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCAT
TCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGA
GTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGA
TGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCA
GGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCC
CTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAG
AGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTA
TGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAA
GCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATT
ACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGA
GGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGAC
CGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAG
TTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGA
GAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTC
TCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAG
CTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAG
GGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCC
ACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTA
TTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAA
CACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGG
CTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTG
CTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAAT
GGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACG
TGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAA
TGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAA
TCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTG
CCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAAAAAAAAATTCAGGGAAAATTAAAAA

>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000368316_chr1_155932509_-_3701nt
CTCTCCCGGAGGGGACTCCTCCCACCGCCGAGTTTTCCCGAGAATGAGGCCGCGCCCACTGACGCGCTGTGGTTCCAAAACGAGAAAGTA
CTGAAGGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGC
AATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGG
GATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGC
TCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAG
TCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGG
CCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTT
CTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTA
CGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCT
GGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGAC
CACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTA
CAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGA
TGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAA
GGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAA
AGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCAT
TCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGA
GTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGA
TGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCA
GGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCC
CTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAG
AGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTA
TGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAA
GCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATT
ACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGA
GGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGAC
CGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAG
TTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGA
GAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTC
TCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAG
CTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAG
GGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCC
ACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTA
TTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAA
CACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGG
CTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTG
CTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAAT
GGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACG
TGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAA
TGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAA
TCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTG
CCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAAAAAAAAATTCAGGGAAAATTAAAAA

>In-frame_GON4L_ENST00000437809_chr1_155823067_-_ARHGEF2_ENST00000462460_chr1_155932509_-_3701nt
CTCTCCCGGAGGGGACTCCTCCCACCGCCGAGTTTTCCCGAGAATGAGGCCGCGCCCACTGACGCGCTGTGGTTCCAAAACGAGAAAGTA
CTGAAGGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGC
AATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGG
GATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGC
TCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAG
TCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGG
CCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTT
CTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTA
CGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCT
GGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGAC
CACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTA
CAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGA
TGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAA
GGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAA
AGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCAT
TCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGA
GTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGA
TGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCA
GGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCC
CTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAG
AGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTA
TGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAA
GCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATT
ACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGA
GGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGAC
CGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAG
TTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGA
GAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTC
TCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAG
CTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAG
GGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCC
ACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTA
TTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAA
CACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGG
CTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTG
CTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAAT
GGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACG
TGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAA
TGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAA
TCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTG
CCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAAAAAAAAATTCAGGGAAAATTAAAAA

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000368315_chr1_155932509_-_3643nt
TTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTC
CCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTC
GGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGA
GGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCAC
CCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAAT
GACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGT
CAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGC
TCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTAC
AGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGG
AGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCC
GTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGC
GCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGG
TGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACA
TTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCA
CCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGC
GGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATT
TCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTG
GCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCC
GAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCT
CCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGC
GATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCC
CTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGG
CCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCG
AAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGG
CCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCG
ATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAA
ACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAG
GTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGG
CTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCA
ATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAG
CTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGG
AAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGA
GGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATC
CGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCC
CCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGG
TTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTAC
CAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGA
GGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCT
AGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTT
TTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAAAAAAAAATT

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000313695_chr1_155932509_-_3628nt
TTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTC
CCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTC
GGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGA
GGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCAC
CCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAAT
GACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGT
CAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGC
TCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTAC
AGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGG
AGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCC
GTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGC
GCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGG
TGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACA
TTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCA
CCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGC
GGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATT
TCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTG
GCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCC
GAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCT
CCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGC
GATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCC
CTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGG
CCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCG
AAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGG
CCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCG
ATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAA
ACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAG
GTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGG
CTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCA
ATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAG
CTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGG
AAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGA
GGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATC
CGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCC
CCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGG
TTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTAC
CAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGA
GGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCT
AGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTT
TTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAAAAAAAAATT

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000361247_chr1_155932509_-_3628nt
TTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTC
CCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTC
GGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGA
GGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCAC
CCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAAT
GACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGT
CAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGC
TCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTAC
AGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGG
AGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCC
GTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGC
GCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGG
TGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACA
TTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCA
CCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGC
GGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATT
TCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTG
GCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCC
GAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCT
CCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGC
GATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCC
CTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGG
CCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCG
AAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGG
CCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCG
ATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAA
ACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAG
GTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGG
CTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCA
ATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAG
CTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGG
AAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGA
GGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATC
CGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCC
CCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGG
TTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTAC
CAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGA
GGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCT
AGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTT
TTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAAAAAAAAATT

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000368316_chr1_155932509_-_3627nt
TTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTC
CCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTC
GGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGA
GGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCAC
CCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAAT
GACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGT
CAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGC
TCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTAC
AGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGG
AGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCC
GTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGC
GCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGG
TGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACA
TTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCA
CCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGC
GGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATT
TCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTG
GCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCC
GAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCT
CCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGC
GATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCC
CTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGG
CCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCG
AAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGG
CCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCG
ATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAA
ACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAG
GTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGG
CTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCA
ATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAG
CTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGG
AAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGA
GGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATC
CGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCC
CCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGG
TTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTAC
CAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGA
GGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCT
AGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTT
TTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAAAAAAAAATT

>In-frame_GON4L_ENST00000368331_chr1_155823067_-_ARHGEF2_ENST00000462460_chr1_155932509_-_3627nt
TTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAGAGAAGAACTACAGTGACAGAGTC
CCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCTGACCAGGTTAAGGACTTGAGTTC
GGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGATGCAGGAAATCAGCTTGGTATGGA
GGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGATGTGGCCATCTCTCAGGGAATCAC
CCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACTGGCTCAAAGAGAGGGAAAAAAAT
GACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTTTCAGGAGAGCCTAGTGAAGAAGT
CAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGC
TCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTAC
AGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGG
AGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCC
GTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGC
GCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGG
TGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACA
TTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCA
CCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGC
GGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATT
TCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTG
GCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCC
GAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCT
CCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGC
GATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCC
CTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGG
CCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCG
AAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGG
CCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCG
ATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAA
ACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAG
GTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGG
CTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCA
ATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAG
CTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGG
AAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGA
GGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATC
CGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCC
CCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGG
TTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTAC
CAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGA
GGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCT
AGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTT
TTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAAAAAAAAATT

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000368315_chr1_155932509_-_3757nt
TGGCGCATAGTGTTAGGCGCATGCTCCTTGATGCACTGCGGCGCGGCGCTCCGAGGCTCGGGGACGCGCACGCAATTCGCTGTTGTTGGC
TGACTTCCGGTGGTGCCAAAGCCGTTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAA
GAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATC
TGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGA
TGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGA
TGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTAC
TGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTT
TTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCA
GCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCG
CCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGC
AGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTA
TTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCT
TTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAG
TGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGC
TGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACA
CAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTG
AGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCG
GGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCT
CTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAG
GAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATG
GTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGAT
CACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGA
TGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTG
CCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGC
GGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGG
CCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTC
GGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTG
TCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACC
CTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGG
AGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTG
AGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTT
GGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTC
ATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACAT
GGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCC
CTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCA
GGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGC
TTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTT
GTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTA
TCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTC
CCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAA
CCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCA

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000313695_chr1_155932509_-_3742nt
TGGCGCATAGTGTTAGGCGCATGCTCCTTGATGCACTGCGGCGCGGCGCTCCGAGGCTCGGGGACGCGCACGCAATTCGCTGTTGTTGGC
TGACTTCCGGTGGTGCCAAAGCCGTTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAA
GAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATC
TGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGA
TGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGA
TGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTAC
TGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTT
TTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCA
GCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCG
CCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGC
AGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTA
TTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCT
TTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAG
TGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGC
TGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACA
CAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTG
AGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCG
GGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCT
CTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAG
GAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATG
GTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGAT
CACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGA
TGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTG
CCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGC
GGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGG
CCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTC
GGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTG
TCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACC
CTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGG
AGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTG
AGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTT
GGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTC
ATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACAT
GGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCC
CTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCA
GGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGC
TTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTT
GTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTA
TCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTC
CCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAA
CCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCA

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000361247_chr1_155932509_-_3742nt
TGGCGCATAGTGTTAGGCGCATGCTCCTTGATGCACTGCGGCGCGGCGCTCCGAGGCTCGGGGACGCGCACGCAATTCGCTGTTGTTGGC
TGACTTCCGGTGGTGCCAAAGCCGTTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAA
GAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATC
TGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGA
TGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGA
TGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTAC
TGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTT
TTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCA
GCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCG
CCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGC
AGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTA
TTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCT
TTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAG
TGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGC
TGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACA
CAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTG
AGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCG
GGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCT
CTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAG
GAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATG
GTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGAT
CACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGA
TGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTG
CCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGC
GGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGG
CCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTC
GGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTG
TCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACC
CTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGG
AGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTG
AGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTT
GGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTC
ATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACAT
GGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCC
CTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCA
GGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGC
TTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTT
GTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTA
TCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTC
CCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAA
CCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCA

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000368316_chr1_155932509_-_3741nt
TGGCGCATAGTGTTAGGCGCATGCTCCTTGATGCACTGCGGCGCGGCGCTCCGAGGCTCGGGGACGCGCACGCAATTCGCTGTTGTTGGC
TGACTTCCGGTGGTGCCAAAGCCGTTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAA
GAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATC
TGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGA
TGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGA
TGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTAC
TGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTT
TTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCA
GCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCG
CCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGC
AGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTA
TTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCT
TTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAG
TGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGC
TGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACA
CAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTG
AGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCG
GGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCT
CTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAG
GAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATG
GTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGAT
CACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGA
TGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTG
CCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGC
GGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGG
CCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTC
GGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTG
TCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACC
CTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGG
AGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTG
AGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTT
GGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTC
ATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACAT
GGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCC
CTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCA
GGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGC
TTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTT
GTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTA
TCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTC
CCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAA
CCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCA

>In-frame_GON4L_ENST00000271883_chr1_155823067_-_ARHGEF2_ENST00000462460_chr1_155932509_-_3741nt
TGGCGCATAGTGTTAGGCGCATGCTCCTTGATGCACTGCGGCGCGGCGCTCCGAGGCTCGGGGACGCGCACGCAATTCGCTGTTGTTGGC
TGACTTCCGGTGGTGCCAAAGCCGTTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAA
GAGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATC
TGACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGA
TGCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGA
TGTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTAC
TGGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTT
TTCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCA
GCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCG
CCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGC
AGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTA
TTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCT
TTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAG
TGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGC
TGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACA
CAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTG
AGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCG
GGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCT
CTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAG
GAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATG
GTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGAT
CACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGA
TGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTG
CCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGC
GGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGG
CCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTC
GGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTG
TCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACC
CTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGG
AGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTG
AGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTT
GGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTC
ATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACAT
GGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCC
CTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCA
GGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGC
TTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTT
GTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTA
TCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTC
CCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAA
CCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCA

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000368315_chr1_155932509_-_3666nt
GACTTCCGGTGGTGCCAAAGCCGTTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAG
AGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCT
GACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGAT
GCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGAT
GTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACT
GGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTT
TCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAG
CCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGC
CGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCA
GCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTAT
TTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTT
TGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGT
GCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCT
GCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACAC
AGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGA
GACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGG
GCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTC
TGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGG
AGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGG
TGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATC
ACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGAT
GGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGC
CCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCG
GCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGC
CGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCG
GCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGT
CACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCC
TGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGA
GACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGA
GGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTG
GATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCA
TGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATG
GGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCC
TAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAG
GGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCT
TCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTG
TTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTAT
CTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCC
CCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAAC
CTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAA

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000313695_chr1_155932509_-_3651nt
GACTTCCGGTGGTGCCAAAGCCGTTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAG
AGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCT
GACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGAT
GCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGAT
GTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACT
GGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTT
TCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAG
CCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGC
CGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCA
GCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTAT
TTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTT
TGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGT
GCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCT
GCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACAC
AGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGA
GACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGG
GCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTC
TGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGG
AGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGG
TGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATC
ACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGAT
GGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGC
CCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCG
GCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGC
CGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCG
GCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGT
CACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCC
TGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGA
GACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGA
GGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTG
GATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCA
TGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATG
GGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCC
TAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAG
GGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCT
TCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTG
TTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTAT
CTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCC
CCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAAC
CTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAA

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000361247_chr1_155932509_-_3651nt
GACTTCCGGTGGTGCCAAAGCCGTTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAG
AGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCT
GACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGAT
GCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGAT
GTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACT
GGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTT
TCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAG
CCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGC
CGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCA
GCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTAT
TTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTT
TGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGT
GCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCT
GCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACAC
AGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGA
GACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGG
GCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTC
TGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGG
AGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGG
TGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATC
ACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGAT
GGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGC
CCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCG
GCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGC
CGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCG
GCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGT
CACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCC
TGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGA
GACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGA
GGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTG
GATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCA
TGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATG
GGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCC
TAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAG
GGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCT
TCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTG
TTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTAT
CTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCC
CCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAAC
CTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAA

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000368316_chr1_155932509_-_3650nt
GACTTCCGGTGGTGCCAAAGCCGTTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAG
AGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCT
GACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGAT
GCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGAT
GTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACT
GGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTT
TCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAG
CCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGC
CGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCA
GCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTAT
TTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTT
TGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGT
GCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCT
GCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACAC
AGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGA
GACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGG
GCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTC
TGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGG
AGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGG
TGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATC
ACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGAT
GGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGC
CCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCG
GCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGC
CGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCG
GCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGT
CACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCC
TGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGA
GACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGA
GGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTG
GATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCA
TGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATG
GGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCC
TAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAG
GGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCT
TCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTG
TTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTAT
CTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCC
CCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAAC
CTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAA

>In-frame_GON4L_ENST00000361040_chr1_155823067_-_ARHGEF2_ENST00000462460_chr1_155932509_-_3650nt
GACTTCCGGTGGTGCCAAAGCCGTTTCCGTGGAATCAGGCCGGCTGAATGGAACAAAAGTGGGACTTTTAAAATGTTGCCCTGTAAGAAG
AGAAGAACTACAGTGACAGAGTCCCTACAGCATAAAGGCAATCAAGAGGAAAACAACGTAGACCTAGAATCAGCCGTTAAACCAGAATCT
GACCAGGTTAAGGACTTGAGTTCGGTGTCACTATCCTGGGATCCAAGTCATGGCAGAGTAGCTGGCTTCGAAGTACAGTCTTTGCAGGAT
GCAGGAAATCAGCTTGGTATGGAGGATACATCTCTGAGCTCTGGAATGCTCACCCAGAACACAAATGTACCAATTCTAGAAGGTGTTGAT
GTGGCCATCTCTCAGGGAATCACCCTACCTTCCTTGGAGTCTTTTCACCCCCTTAATATACACATTGGTAAAGGAAAACTCCACGCTACT
GGCTCAAAGAGAGGGAAAAAAATGACACTCAGGCCTGGGCCAGTTACCCAAGAAGACAGATGTGATCATCTTACCCTAAAGGAGCCTTTT
TCAGGAGAGCCTAGTGAAGAAGTCAAGGAAGAAGGAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAG
CCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGC
CGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCA
GCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTAT
TTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTT
TGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGT
GCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCT
GCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACAC
AGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGA
GACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGG
GCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTC
TGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGG
AGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGG
TGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATC
ACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGAT
GGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGC
CCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCG
GCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGC
CGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCG
GCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGT
CACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCC
TGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGA
GACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGA
GGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTG
GATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCA
TGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATG
GGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCC
TAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAG
GGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCT
TCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTG
TTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTAT
CTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCC
CCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAAC
CTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAA


Top

FusionGenePPI for GON4L_ARHGEF2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GON4LDHX16, PNKD, HIST1H2BA, KRAS, HIST1H2BG, CRAMP1L, H2AFX, ASB3, TRIM25ARHGEF2MYC, PAK1, YWHAQ, RAC1, RHOA, PLCG1, MARK2, TAF10, MAPK1, YWHAG, MARK4, YWHAH, ELAVL1, USP21, YWHAZ, NOTCH1, VCP, PEX14, MMS19, FBXO6, ANKRD28, PPP6C, PPP6R1, YWHAB, RPA3, RPA2, RPA1, CEP250, RPP25L, MOV10, NXF1, CCDC8, EGFR, WDR83, FGL1, NTRK1, COPS7A, KLC2, PRDX1, PSME3, CEP170, CNTRL, SCLT1, DCTN1, PPP2R1A, FOXO3, SNW1, CDC5L, PPP2CA, PPP2CB, PAK7, UBE2A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000313667-722131_161324986DYNLT1
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000313695-722131_161297959DYNLT1
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000361247-722131_161325987DYNLT1
TgeneARHGEF2chr1:155823067chr1:155932509ENST00000368316-1126131_161297959DYNLT1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GON4L_ARHGEF2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GON4L_ARHGEF2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGON4LC3714756Intellectual Disability1CTD_human