FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15067

FusionGeneSummary for GOLIM4_RNF175

check button Fusion gene summary
Fusion gene informationFusion gene name: GOLIM4_RNF175
Fusion gene ID: 15067
HgeneTgene
Gene symbol

GOLIM4

RNF175

Gene ID

27333

285533

Gene namegolgi integral membrane protein 4ring finger protein 175
SynonymsGIMPC|GOLPH4|GPP130|P138-
Cytomap

3q26.2

4q31.3

Type of geneprotein-codingprotein-coding
DescriptionGolgi integral membrane protein 4130 kDa golgi-localized phosphoproteincis Golgi-localized calcium-binding proteingolgi integral membrane protein, cisgolgi phosphoprotein 4golgi phosphoprotein of 130 kDagolgi-localized phosphoprotein of 130 kDatypeRING finger protein 175
Modification date2018051920180523
UniProtAcc

O00461

Q8N4F7

Ensembl transtripts involved in fusion geneENST00000470487, ENST00000309027, 
ENST00000347063, ENST00000274068, 
ENST00000506505, 
Fusion gene scores* DoF score10 X 5 X 9=4501 X 1 X 1=1
# samples 101
** MAII scorelog2(10/450*10)=-2.16992500144231
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: GOLIM4 [Title/Abstract] AND RNF175 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-52-7622-01AGOLIM4chr3

167812887

-RNF175chr4

154636814

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000470487ENST00000347063GOLIM4chr3

167812887

-RNF175chr4

154636814

-
Frame-shiftENST00000470487ENST00000274068GOLIM4chr3

167812887

-RNF175chr4

154636814

-
5CDS-intronENST00000470487ENST00000506505GOLIM4chr3

167812887

-RNF175chr4

154636814

-
In-frameENST00000309027ENST00000347063GOLIM4chr3

167812887

-RNF175chr4

154636814

-
Frame-shiftENST00000309027ENST00000274068GOLIM4chr3

167812887

-RNF175chr4

154636814

-
5CDS-intronENST00000309027ENST00000506505GOLIM4chr3

167812887

-RNF175chr4

154636814

-

Top

FusionProtFeatures for GOLIM4_RNF175


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GOLIM4

O00461

RNF175

Q8N4F7

Plays a role in endosome to Golgi protein trafficking;mediates protein transport along the late endosome-bypass pathwayfrom the early endosome to the Golgi.{ECO:0000269|PubMed:15331763}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGOLIM4chr3:167812887chr4:154636814ENST00000470487-1162_1262697Topological domainCytoplasmic
HgeneGOLIM4chr3:167812887chr4:154636814ENST00000470487-11613_3362697TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneRNF175chr3:167812887chr4:154636814ENST00000347063-59227_277210329Zinc fingerRING-type%3B atypical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGOLIM4chr3:167812887chr4:154636814ENST00000470487-11635_24462697Coiled coilOntology_term=ECO:0000255
HgeneGOLIM4chr3:167812887chr4:154636814ENST00000470487-116311_68162697Compositional biasNote=Glu-rich
HgeneGOLIM4chr3:167812887chr4:154636814ENST00000470487-116404_51362697Compositional biasNote=Gln-rich
HgeneGOLIM4chr3:167812887chr4:154636814ENST00000470487-116176_24862697RegionNote=Golgi targeting
HgeneGOLIM4chr3:167812887chr4:154636814ENST00000470487-11638_10762697RegionNote=Golgi targeting
HgeneGOLIM4chr3:167812887chr4:154636814ENST00000470487-11680_17562697RegionNote=Endosome targeting
HgeneGOLIM4chr3:167812887chr4:154636814ENST00000470487-11634_69662697Topological domainLumenal
TgeneRNF175chr3:167812887chr4:154636814ENST00000347063-59104_121210329TransmembraneHelical
TgeneRNF175chr3:167812887chr4:154636814ENST00000347063-59149_169210329TransmembraneHelical
TgeneRNF175chr3:167812887chr4:154636814ENST00000347063-59180_200210329TransmembraneHelical
TgeneRNF175chr3:167812887chr4:154636814ENST00000347063-5951_71210329TransmembraneHelical
TgeneRNF175chr3:167812887chr4:154636814ENST00000347063-5983_103210329TransmembraneHelical


Top

FusionGeneSequence for GOLIM4_RNF175


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GOLIM4_ENST00000470487_chr3_167812887_-_RNF175_ENST00000347063_chr4_154636814_-_181aa
MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVLQCQPVAYKELIGQYLCSLWAEDHCGA
XXRRAHXKHLPAFLXSCLSXILHPRLVYRWEKADLPLLQRESXFEEDDQXSLGAHTFSVWTNPGLASLFGGLATCGDRNSSRHYLFTRAG

>In-frame_GOLIM4_ENST00000309027_chr3_167812887_-_RNF175_ENST00000347063_chr4_154636814_-_181aa
MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVLQCQPVAYKELIGQYLCSLWAEDHCGA
XXRRAHXKHLPAFLXSCLSXILHPRLVYRWEKADLPLLQRESXFEEDDQXSLGAHTFSVWTNPGLASLFGGLATCGDRNSSRHYLFTRAG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GOLIM4_ENST00000470487_chr3_167812887_-_RNF175_ENST00000347063_chr4_154636814_-_544nt
ATGGGAAACGGGATGTGCTCCCGAAAGCAGAAGCGGATTTTCCAGACGCTGCTGCTGCTGACCGTCGTGTTCGGCTTTCTCTACGGCGCG
ATGCTCTACTACGAGCTGCAGACGCAGCTGCGGAAAGCCGAGGCGGTGGCGCTCAAGTACCAGCAGCACCAGGAGTCCCTCTCCGCCCAG
TTACAAGTTCTACAGTGTCAGCCGGTTGCCTACAAGGAGCTTATCGGACAATATCTGTGCAGTCTGTGGGCAGAAGATCATTGTGGAGCT
TGATGAAGAAGGGCTCATTGAAAACACCTACCAGCTTTCCTGTAATCATGTCTTTCATGAATTCTGCATCCGAGGTTGGTGTATCGTTGG
GAAAAAGCAGACTTGCCCTTACTGCAAAGAGAAAGTTGATTTGAAGAGGATGATCAGTAATCCCTGGGAGCGCACACATTTTCTGTATGG
ACAAATCCTGGATTGGCTTCGTTATTTGGTGGCCTGGCAACCTGTGGTGATAGGAATAGTTCAAGGCATTATCTATTCACTAGGGCTGGA

>In-frame_GOLIM4_ENST00000309027_chr3_167812887_-_RNF175_ENST00000347063_chr4_154636814_-_544nt
ATGGGAAACGGGATGTGCTCCCGAAAGCAGAAGCGGATTTTCCAGACGCTGCTGCTGCTGACCGTCGTGTTCGGCTTTCTCTACGGCGCG
ATGCTCTACTACGAGCTGCAGACGCAGCTGCGGAAAGCCGAGGCGGTGGCGCTCAAGTACCAGCAGCACCAGGAGTCCCTCTCCGCCCAG
TTACAAGTTCTACAGTGTCAGCCGGTTGCCTACAAGGAGCTTATCGGACAATATCTGTGCAGTCTGTGGGCAGAAGATCATTGTGGAGCT
TGATGAAGAAGGGCTCATTGAAAACACCTACCAGCTTTCCTGTAATCATGTCTTTCATGAATTCTGCATCCGAGGTTGGTGTATCGTTGG
GAAAAAGCAGACTTGCCCTTACTGCAAAGAGAAAGTTGATTTGAAGAGGATGATCAGTAATCCCTGGGAGCGCACACATTTTCTGTATGG
ACAAATCCTGGATTGGCTTCGTTATTTGGTGGCCTGGCAACCTGTGGTGATAGGAATAGTTCAAGGCATTATCTATTCACTAGGGCTGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_GOLIM4_ENST00000470487_chr3_167812887_-_RNF175_ENST00000347063_chr4_154636814_-_1478nt
AATGAGCAAGGAGGCCGAGTGGGACTTCCTCCCGGAATCCCGTTGGCCAGAATAGCCGGGCCGTGGGTGACACGTAAGTTGGGCAGGAGG
TGGCGGGGCGGCAGAGGCACCAGCCGACCCGTCAGTGACACCGCTGTGCCGTCCCCAAAACCAGCCGAGACAGCTGGCCCCCACCCTTCC
ACCCATTGGGCAGGCCGCACGGGGGCGCGGCCCGGAGTCCTGGTCCCTTTGTTGGGCGCGCACCCCCTCCCTTAGGTGGCAACAAAGTCG
TGCAGTGGGAGCCGCCGCGATAGGGCGGGGAGTGGCCAGGGCGGGACTCCAAGAACTGCCCGGGGGCAGCGGGGCCAAAAAGTGGGAAGA
AGGAAAAAAGGCAGGAGGCATCTGGGGACAGGCGCGAGGGCAGCCGGCTCTGAAGTATGCGGAGGGCCTCCTCCCGGCCCCGGGCATTCG
CGGAGAACGAGCCTCGCAGAAGTTTGGCTGCAGCTGCCCGGGCGGCGTCGATGGCTGCGCGCCCCGCGCCGCGCGGGGGCTGAGCGGGCG
CCACTTCCCCTCCGGGCCGGCTTTTGTGTCTGGCATCTCCTCCTCATGCTGCGTCTGGCCACCTACTGCGGCGGCCGCTGCTGAGACGCT
CGCTCGGACCAAGGGGAGGAGACGGCGGGGGCGGCCGCGGCTTTGGGTCCAGGCGGGACTATGGGAAACGGGATGTGCTCCCGAAAGCAG
AAGCGGATTTTCCAGACGCTGCTGCTGCTGACCGTCGTGTTCGGCTTTCTCTACGGCGCGATGCTCTACTACGAGCTGCAGACGCAGCTG
CGGAAAGCCGAGGCGGTGGCGCTCAAGTACCAGCAGCACCAGGAGTCCCTCTCCGCCCAGTTACAAGTTCTACAGTGTCAGCCGGTTGCC
TACAAGGAGCTTATCGGACAATATCTGTGCAGTCTGTGGGCAGAAGATCATTGTGGAGCTTGATGAAGAAGGGCTCATTGAAAACACCTA
CCAGCTTTCCTGTAATCATGTCTTTCATGAATTCTGCATCCGAGGTTGGTGTATCGTTGGGAAAAAGCAGACTTGCCCTTACTGCAAAGA
GAAAGTTGATTTGAAGAGGATGATCAGTAATCCCTGGGAGCGCACACATTTTCTGTATGGACAAATCCTGGATTGGCTTCGTTATTTGGT
GGCCTGGCAACCTGTGGTGATAGGAATAGTTCAAGGCATTATCTATTCACTAGGGCTGGAATAGGACAGCAGACCCCAGAAGCAACATAC
TGCATGGTTGAAATCCTTGGTCCAACATTTAATATTAATTTTTTTAATTTTAGAGATGATCCCAAGTGTTTAGAAAACTAAGTAAACTTT
GTTGTCAAGCAATTTGTCCATGTGGAAAGAATTTAAAGAGAAGCTGAACAATGGAATAAACAAATAAAGCATGTTTTTTCATCTTTCCCA

>In-frame_GOLIM4_ENST00000309027_chr3_167812887_-_RNF175_ENST00000347063_chr4_154636814_-_847nt
GCTCGGACCAAGGGGAGGAGACGGCGGGGGCGGCCGCGGCTTTGGGTCCAGGCGGGACTATGGGAAACGGGATGTGCTCCCGAAAGCAGA
AGCGGATTTTCCAGACGCTGCTGCTGCTGACCGTCGTGTTCGGCTTTCTCTACGGCGCGATGCTCTACTACGAGCTGCAGACGCAGCTGC
GGAAAGCCGAGGCGGTGGCGCTCAAGTACCAGCAGCACCAGGAGTCCCTCTCCGCCCAGTTACAAGTTCTACAGTGTCAGCCGGTTGCCT
ACAAGGAGCTTATCGGACAATATCTGTGCAGTCTGTGGGCAGAAGATCATTGTGGAGCTTGATGAAGAAGGGCTCATTGAAAACACCTAC
CAGCTTTCCTGTAATCATGTCTTTCATGAATTCTGCATCCGAGGTTGGTGTATCGTTGGGAAAAAGCAGACTTGCCCTTACTGCAAAGAG
AAAGTTGATTTGAAGAGGATGATCAGTAATCCCTGGGAGCGCACACATTTTCTGTATGGACAAATCCTGGATTGGCTTCGTTATTTGGTG
GCCTGGCAACCTGTGGTGATAGGAATAGTTCAAGGCATTATCTATTCACTAGGGCTGGAATAGGACAGCAGACCCCAGAAGCAACATACT
GCATGGTTGAAATCCTTGGTCCAACATTTAATATTAATTTTTTTAATTTTAGAGATGATCCCAAGTGTTTAGAAAACTAAGTAAACTTTG
TTGTCAAGCAATTTGTCCATGTGGAAAGAATTTAAAGAGAAGCTGAACAATGGAATAAACAAATAAAGCATGTTTTTTCATCTTTCCCAT


Top

FusionGenePPI for GOLIM4_RNF175


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GOLIM4ELAVL1, TXN2, DDX5, FUS, HLA-DPA1, SPACA1, SYNE4, B3GAT3, HAUS7, SLC39A4, POMK, NTRK1, CDC42, EPHA2, KRAS, PTPN1, IQGAP1, VAPA, ATP6AP2, FGFR1OP, AP4S1, AP4E1, GOLT1B, CCDC132, PARD6B, MMGT1, PTPN2, PTPN4, TRDN, DCAF12, PTPRU, CD79B, ATP2B2, CSGALNACT2, UST, RAET1E, KCNS3, GDPD5, BATF3, FUT1, MRAP2, FCGRT, PTPRORNF175KRTAP10-7, KRTAP10-3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GOLIM4_RNF175


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GOLIM4_RNF175


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource