FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15042

FusionGeneSummary for GOLGA4_MLH1

check button Fusion gene summary
Fusion gene informationFusion gene name: GOLGA4_MLH1
Fusion gene ID: 15042
HgeneTgene
Gene symbol

GOLGA4

MLH1

Gene ID

2803

4292

Gene namegolgin A4mutL homolog 1
SynonymsCRPF46|GCP2|GOLG|MU-RMS-40.18|p230COCA2|FCC2|HNPCC|HNPCC2|hMLH1
Cytomap

3p22.2

3p22.2

Type of geneprotein-codingprotein-coding
Descriptiongolgin subfamily A member 4256 kDa golgin72.1 proteincentrosome-related protein F46golgi autoantigen, golgin subfamily a, 4golgin-240golgin-245protein 72.1trans-Golgi p230DNA mismatch repair protein Mlh1mutL homolog 1, colon cancer, nonpolyposis type 2
Modification date2018051920180523
UniProtAcc

Q13439

P40692

Ensembl transtripts involved in fusion geneENST00000361924, ENST00000435830, 
ENST00000444882, ENST00000356847, 
ENST00000536378, ENST00000231790, 
ENST00000458205, ENST00000539477, 
ENST00000455445, ENST00000435176, 
ENST00000492474, 
Fusion gene scores* DoF score12 X 10 X 6=7206 X 7 X 3=126
# samples 138
** MAII scorelog2(13/720*10)=-2.46948528330122
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/126*10)=-0.655351828612554
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: GOLGA4 [Title/Abstract] AND MLH1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
DDR (DNA damage repair) gene involved fusion gene, retained protein feature but frameshift.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneGOLGA4

GO:0043001

Golgi to plasma membrane protein transport

15265687

HgeneGOLGA4

GO:0045773

positive regulation of axon extension

22705394


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-EJ-A46G-01AGOLGA4chr3

37343823

+MLH1chr3

37058997

+
TCGARVSTADTCGA-BR-A4QI-01AGOLGA4chr3

37360685

+MLH1chr3

37061801

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000361924ENST00000536378GOLGA4chr3

37343823

+MLH1chr3

37058997

+
In-frameENST00000361924ENST00000231790GOLGA4chr3

37343823

+MLH1chr3

37058997

+
In-frameENST00000361924ENST00000458205GOLGA4chr3

37343823

+MLH1chr3

37058997

+
In-frameENST00000361924ENST00000539477GOLGA4chr3

37343823

+MLH1chr3

37058997

+
In-frameENST00000361924ENST00000455445GOLGA4chr3

37343823

+MLH1chr3

37058997

+
In-frameENST00000361924ENST00000435176GOLGA4chr3

37343823

+MLH1chr3

37058997

+
5CDS-intronENST00000361924ENST00000492474GOLGA4chr3

37343823

+MLH1chr3

37058997

+
3UTR-3CDSENST00000435830ENST00000536378GOLGA4chr3

37343823

+MLH1chr3

37058997

+
3UTR-3CDSENST00000435830ENST00000231790GOLGA4chr3

37343823

+MLH1chr3

37058997

+
3UTR-3CDSENST00000435830ENST00000458205GOLGA4chr3

37343823

+MLH1chr3

37058997

+
3UTR-3CDSENST00000435830ENST00000539477GOLGA4chr3

37343823

+MLH1chr3

37058997

+
3UTR-3CDSENST00000435830ENST00000455445GOLGA4chr3

37343823

+MLH1chr3

37058997

+
3UTR-3CDSENST00000435830ENST00000435176GOLGA4chr3

37343823

+MLH1chr3

37058997

+
3UTR-intronENST00000435830ENST00000492474GOLGA4chr3

37343823

+MLH1chr3

37058997

+
intron-3CDSENST00000444882ENST00000536378GOLGA4chr3

37343823

+MLH1chr3

37058997

+
intron-3CDSENST00000444882ENST00000231790GOLGA4chr3

37343823

+MLH1chr3

37058997

+
intron-3CDSENST00000444882ENST00000458205GOLGA4chr3

37343823

+MLH1chr3

37058997

+
intron-3CDSENST00000444882ENST00000539477GOLGA4chr3

37343823

+MLH1chr3

37058997

+
intron-3CDSENST00000444882ENST00000455445GOLGA4chr3

37343823

+MLH1chr3

37058997

+
intron-3CDSENST00000444882ENST00000435176GOLGA4chr3

37343823

+MLH1chr3

37058997

+
intron-intronENST00000444882ENST00000492474GOLGA4chr3

37343823

+MLH1chr3

37058997

+
In-frameENST00000356847ENST00000536378GOLGA4chr3

37343823

+MLH1chr3

37058997

+
In-frameENST00000356847ENST00000231790GOLGA4chr3

37343823

+MLH1chr3

37058997

+
In-frameENST00000356847ENST00000458205GOLGA4chr3

37343823

+MLH1chr3

37058997

+
In-frameENST00000356847ENST00000539477GOLGA4chr3

37343823

+MLH1chr3

37058997

+
In-frameENST00000356847ENST00000455445GOLGA4chr3

37343823

+MLH1chr3

37058997

+
In-frameENST00000356847ENST00000435176GOLGA4chr3

37343823

+MLH1chr3

37058997

+
5CDS-intronENST00000356847ENST00000492474GOLGA4chr3

37343823

+MLH1chr3

37058997

+
Frame-shitENST00000361924ENST00000536378GOLGA4chr3

37360685

+MLH1chr3

37061801

+
Frame-shitENST00000361924ENST00000231790GOLGA4chr3

37360685

+MLH1chr3

37061801

+
Frame-shitENST00000361924ENST00000458205GOLGA4chr3

37360685

+MLH1chr3

37061801

+
Frame-shitENST00000361924ENST00000539477GOLGA4chr3

37360685

+MLH1chr3

37061801

+
Frame-shitENST00000361924ENST00000455445GOLGA4chr3

37360685

+MLH1chr3

37061801

+
Frame-shitENST00000361924ENST00000435176GOLGA4chr3

37360685

+MLH1chr3

37061801

+
5CDS-intronENST00000361924ENST00000492474GOLGA4chr3

37360685

+MLH1chr3

37061801

+
3UTR-3CDSENST00000435830ENST00000536378GOLGA4chr3

37360685

+MLH1chr3

37061801

+
3UTR-3CDSENST00000435830ENST00000231790GOLGA4chr3

37360685

+MLH1chr3

37061801

+
3UTR-3CDSENST00000435830ENST00000458205GOLGA4chr3

37360685

+MLH1chr3

37061801

+
3UTR-3CDSENST00000435830ENST00000539477GOLGA4chr3

37360685

+MLH1chr3

37061801

+
3UTR-3CDSENST00000435830ENST00000455445GOLGA4chr3

37360685

+MLH1chr3

37061801

+
3UTR-3CDSENST00000435830ENST00000435176GOLGA4chr3

37360685

+MLH1chr3

37061801

+
3UTR-intronENST00000435830ENST00000492474GOLGA4chr3

37360685

+MLH1chr3

37061801

+
intron-3CDSENST00000444882ENST00000536378GOLGA4chr3

37360685

+MLH1chr3

37061801

+
intron-3CDSENST00000444882ENST00000231790GOLGA4chr3

37360685

+MLH1chr3

37061801

+
intron-3CDSENST00000444882ENST00000458205GOLGA4chr3

37360685

+MLH1chr3

37061801

+
intron-3CDSENST00000444882ENST00000539477GOLGA4chr3

37360685

+MLH1chr3

37061801

+
intron-3CDSENST00000444882ENST00000455445GOLGA4chr3

37360685

+MLH1chr3

37061801

+
intron-3CDSENST00000444882ENST00000435176GOLGA4chr3

37360685

+MLH1chr3

37061801

+
intron-intronENST00000444882ENST00000492474GOLGA4chr3

37360685

+MLH1chr3

37061801

+
Frame-shitENST00000356847ENST00000536378GOLGA4chr3

37360685

+MLH1chr3

37061801

+
Frame-shitENST00000356847ENST00000231790GOLGA4chr3

37360685

+MLH1chr3

37061801

+
Frame-shitENST00000356847ENST00000458205GOLGA4chr3

37360685

+MLH1chr3

37061801

+
Frame-shitENST00000356847ENST00000539477GOLGA4chr3

37360685

+MLH1chr3

37061801

+
Frame-shitENST00000356847ENST00000455445GOLGA4chr3

37360685

+MLH1chr3

37061801

+
Frame-shitENST00000356847ENST00000435176GOLGA4chr3

37360685

+MLH1chr3

37061801

+
5CDS-intronENST00000356847ENST00000492474GOLGA4chr3

37360685

+MLH1chr3

37061801

+

Top

FusionProtFeatures for GOLGA4_MLH1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GOLGA4

Q13439

MLH1

P40692

Involved in vesicular trafficking at the Golgi apparatuslevel. May play a role in delivery of transport vesiclescontaining GPI-linked proteins from the trans-Golgi networkthrough its interaction with MACF1. Involved in endosome-to-Golgitrafficking (PubMed:29084197). {ECO:0000269|PubMed:15265687,ECO:0000269|PubMed:29084197}. Heterodimerizes with PMS2 to form MutL alpha, acomponent of the post-replicative DNA mismatch repair system(MMR). DNA repair is initiated by MutS alpha (MSH2-MSH6) or MutSbeta (MSH2-MSH3) binding to a dsDNA mismatch, then MutL alpha isrecruited to the heteroduplex. Assembly of the MutL-MutS-heteroduplex ternary complex in presence of RFC and PCNA issufficient to activate endonuclease activity of PMS2. Itintroduces single-strand breaks near the mismatch and thusgenerates new entry points for the exonuclease EXO1 to degrade thestrand containing the mismatch. DNA methylation would preventcleavage and therefore assure that only the newly mutated DNAstrand is going to be corrected. MutL alpha (MLH1-PMS2) interactsphysically with the clamp loader subunits of DNA polymerase III,suggesting that it may play a role to recruit the DNA polymeraseIII to the site of the MMR. Also implicated in DNA damagesignaling, a process which induces cell cycle arrest and can leadto apoptosis in case of major DNA damages. Heterodimerizes withMLH3 to form MutL gamma which plays a role in meiosis.{ECO:0000269|PubMed:16873062, ECO:0000269|PubMed:18206974,ECO:0000269|PubMed:20020535, ECO:0000269|PubMed:21120944,ECO:0000269|PubMed:9311737}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMLH1chr3:37343823chr3:37058997ENST00000455445+819100_10422516Nucleotide bindingATP
TgeneMLH1chr3:37343823chr3:37058997ENST00000455445+81982_8422516Nucleotide bindingATP
TgeneMLH1chr3:37343823chr3:37058997ENST00000458205+920100_10422516Nucleotide bindingATP
TgeneMLH1chr3:37343823chr3:37058997ENST00000458205+92082_8422516Nucleotide bindingATP
TgeneMLH1chr3:37343823chr3:37058997ENST00000539477+718100_10422516Nucleotide bindingATP
TgeneMLH1chr3:37343823chr3:37058997ENST00000539477+71882_8422516Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGOLGA4chr3:37343823chr3:37058997ENST00000356847+1123133_21854332244Coiled coilOntology_term=ECO:0000255
HgeneGOLGA4chr3:37343823chr3:37058997ENST00000361924+1024133_21854112306Coiled coilOntology_term=ECO:0000255
HgeneGOLGA4chr3:37343823chr3:37058997ENST00000356847+1123252_20964332244Compositional biasNote=Glu-rich
HgeneGOLGA4chr3:37343823chr3:37058997ENST00000361924+1024252_20964112306Compositional biasNote=Glu-rich
HgeneGOLGA4chr3:37343823chr3:37058997ENST00000356847+11232168_22154332244DomainGRIP
HgeneGOLGA4chr3:37343823chr3:37058997ENST00000361924+10242168_22154112306DomainGRIP
TgeneMLH1chr3:37343823chr3:37058997ENST00000231790+819100_104263757Nucleotide bindingATP
TgeneMLH1chr3:37343823chr3:37058997ENST00000231790+81982_84263757Nucleotide bindingATP
TgeneMLH1chr3:37343823chr3:37058997ENST00000435176+819100_104165659Nucleotide bindingATP
TgeneMLH1chr3:37343823chr3:37058997ENST00000435176+81982_84165659Nucleotide bindingATP


Top

FusionGeneSequence for GOLGA4_MLH1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000536378_chr3_37058997_+_850aa
MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRESGDTQSFAQKLQLRVPSVESLFRSPIKESLFRSSSK
ESLVRTSSRESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKTSELVTATQMLQREKKKLQGILSQ
SQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQTISVLQTQVSLLKQRLRNGPMNVDVLKPLPQLEPQAEVFTKEENPESDGEP
VVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHMAEKTKLITQLRDAKNLIEQLEQ
DKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERADRLVESTSLRKAIETVTAATLPKNTHPFLYLSLEISPQN
VDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVTAHQMVRTDSREQK
LDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMV
EDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILITDFANFG
VLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADTFSLEIDEEGNLIGLPLLIDNTVPPLEGLPIFILRLAT

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000231790_chr3_37058997_+_905aa
MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRESGDTQSFAQKLQLRVPSVESLFRSPIKESLFRSSSK
ESLVRTSSRESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKTSELVTATQMLQREKKKLQGILSQ
SQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQTISVLQTQVSLLKQRLRNGPMNVDVLKPLPQLEPQAEVFTKEENPESDGEP
VVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHMAEKTKLITQLRDAKNLIEQLEQ
DKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERADRLVESTSLRKAIETVTAATLPKNTHPFLYLSLEISPQN
VDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVTAHQMVRTDSREQK
LDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMV
EDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILITDFANFG
VLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADTFSLEIDEEGNLIGLPLLIDNTVPPLEGLPIFILRLAT
EVNWDEEKECFESLSKECAMFTSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVTKALRSHILPPKHFTEDGNILQLANLPDLYKV

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000458205_chr3_37058997_+_905aa
MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRESGDTQSFAQKLQLRVPSVESLFRSPIKESLFRSSSK
ESLVRTSSRESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKTSELVTATQMLQREKKKLQGILSQ
SQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQTISVLQTQVSLLKQRLRNGPMNVDVLKPLPQLEPQAEVFTKEENPESDGEP
VVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHMAEKTKLITQLRDAKNLIEQLEQ
DKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERADRLVESTSLRKAIETVTAATLPKNTHPFLYLSLEISPQN
VDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVTAHQMVRTDSREQK
LDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMV
EDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILITDFANFG
VLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADTFSLEIDEEGNLIGLPLLIDNTVPPLEGLPIFILRLAT
EVNWDEEKECFESLSKECAMFTSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVTKALRSHILPPKHFTEDGNILQLANLPDLYKV

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000539477_chr3_37058997_+_905aa
MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRESGDTQSFAQKLQLRVPSVESLFRSPIKESLFRSSSK
ESLVRTSSRESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKTSELVTATQMLQREKKKLQGILSQ
SQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQTISVLQTQVSLLKQRLRNGPMNVDVLKPLPQLEPQAEVFTKEENPESDGEP
VVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHMAEKTKLITQLRDAKNLIEQLEQ
DKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERADRLVESTSLRKAIETVTAATLPKNTHPFLYLSLEISPQN
VDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVTAHQMVRTDSREQK
LDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMV
EDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILITDFANFG
VLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADTFSLEIDEEGNLIGLPLLIDNTVPPLEGLPIFILRLAT
EVNWDEEKECFESLSKECAMFTSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVTKALRSHILPPKHFTEDGNILQLANLPDLYKV

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000455445_chr3_37058997_+_905aa
MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRESGDTQSFAQKLQLRVPSVESLFRSPIKESLFRSSSK
ESLVRTSSRESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKTSELVTATQMLQREKKKLQGILSQ
SQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQTISVLQTQVSLLKQRLRNGPMNVDVLKPLPQLEPQAEVFTKEENPESDGEP
VVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHMAEKTKLITQLRDAKNLIEQLEQ
DKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERADRLVESTSLRKAIETVTAATLPKNTHPFLYLSLEISPQN
VDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVTAHQMVRTDSREQK
LDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMV
EDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILITDFANFG
VLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADTFSLEIDEEGNLIGLPLLIDNTVPPLEGLPIFILRLAT
EVNWDEEKECFESLSKECAMFTSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVTKALRSHILPPKHFTEDGNILQLANLPDLYKV

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000435176_chr3_37058997_+_905aa
MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRESGDTQSFAQKLQLRVPSVESLFRSPIKESLFRSSSK
ESLVRTSSRESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKTSELVTATQMLQREKKKLQGILSQ
SQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQTISVLQTQVSLLKQRLRNGPMNVDVLKPLPQLEPQAEVFTKEENPESDGEP
VVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHMAEKTKLITQLRDAKNLIEQLEQ
DKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERADRLVESTSLRKAIETVTAATLPKNTHPFLYLSLEISPQN
VDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVTAHQMVRTDSREQK
LDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMV
EDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILITDFANFG
VLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADTFSLEIDEEGNLIGLPLLIDNTVPPLEGLPIFILRLAT
EVNWDEEKECFESLSKECAMFTSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVTKALRSHILPPKHFTEDGNILQLANLPDLYKV

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000536378_chr3_37058997_+_872aa
MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRENASTHASKSPDSVNGSEPSIPQSGDTQSFAQKLQLR
VPSVESLFRSPIKESLFRSSSKESLVRTSSRESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKTS
ELVTATQMLQREKKKLQGILSQSQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQTISVLQTQVSLLKQRLRNGPMNVDVLKPL
PQLEPQAEVFTKEENPESDGEPVVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHM
AEKTKLITQLRDAKNLIEQLEQDKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERADRLVESTSLRKAIETVT
AATLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSS
TSGSSDKVTAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSE
KRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLL
NTTKLSEELFYQILITDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADTFSLEIDEEGNLIGLP

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000231790_chr3_37058997_+_927aa
MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRENASTHASKSPDSVNGSEPSIPQSGDTQSFAQKLQLR
VPSVESLFRSPIKESLFRSSSKESLVRTSSRESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKTS
ELVTATQMLQREKKKLQGILSQSQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQTISVLQTQVSLLKQRLRNGPMNVDVLKPL
PQLEPQAEVFTKEENPESDGEPVVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHM
AEKTKLITQLRDAKNLIEQLEQDKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERADRLVESTSLRKAIETVT
AATLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSS
TSGSSDKVTAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSE
KRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLL
NTTKLSEELFYQILITDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADTFSLEIDEEGNLIGLP
LLIDNTVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFTSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVTKALRSHILP

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000458205_chr3_37058997_+_927aa
MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRENASTHASKSPDSVNGSEPSIPQSGDTQSFAQKLQLR
VPSVESLFRSPIKESLFRSSSKESLVRTSSRESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKTS
ELVTATQMLQREKKKLQGILSQSQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQTISVLQTQVSLLKQRLRNGPMNVDVLKPL
PQLEPQAEVFTKEENPESDGEPVVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHM
AEKTKLITQLRDAKNLIEQLEQDKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERADRLVESTSLRKAIETVT
AATLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSS
TSGSSDKVTAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSE
KRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLL
NTTKLSEELFYQILITDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADTFSLEIDEEGNLIGLP
LLIDNTVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFTSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVTKALRSHILP

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000539477_chr3_37058997_+_927aa
MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRENASTHASKSPDSVNGSEPSIPQSGDTQSFAQKLQLR
VPSVESLFRSPIKESLFRSSSKESLVRTSSRESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKTS
ELVTATQMLQREKKKLQGILSQSQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQTISVLQTQVSLLKQRLRNGPMNVDVLKPL
PQLEPQAEVFTKEENPESDGEPVVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHM
AEKTKLITQLRDAKNLIEQLEQDKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERADRLVESTSLRKAIETVT
AATLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSS
TSGSSDKVTAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSE
KRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLL
NTTKLSEELFYQILITDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADTFSLEIDEEGNLIGLP
LLIDNTVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFTSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVTKALRSHILP

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000455445_chr3_37058997_+_927aa
MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRENASTHASKSPDSVNGSEPSIPQSGDTQSFAQKLQLR
VPSVESLFRSPIKESLFRSSSKESLVRTSSRESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKTS
ELVTATQMLQREKKKLQGILSQSQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQTISVLQTQVSLLKQRLRNGPMNVDVLKPL
PQLEPQAEVFTKEENPESDGEPVVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHM
AEKTKLITQLRDAKNLIEQLEQDKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERADRLVESTSLRKAIETVT
AATLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSS
TSGSSDKVTAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSE
KRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLL
NTTKLSEELFYQILITDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADTFSLEIDEEGNLIGLP
LLIDNTVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFTSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVTKALRSHILP

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000435176_chr3_37058997_+_927aa
MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRENASTHASKSPDSVNGSEPSIPQSGDTQSFAQKLQLR
VPSVESLFRSPIKESLFRSSSKESLVRTSSRESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKTS
ELVTATQMLQREKKKLQGILSQSQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKDQTISVLQTQVSLLKQRLRNGPMNVDVLKPL
PQLEPQAEVFTKEENPESDGEPVVEDGTSVKTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHM
AEKTKLITQLRDAKNLIEQLEQDKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQGEELREQKEKSERADRLVESTSLRKAIETVT
AATLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSS
TSGSSDKVTAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSE
KRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLL
NTTKLSEELFYQILITDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADTFSLEIDEEGNLIGLP
LLIDNTVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFTSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVTKALRSHILP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000536378_chr3_37058997_+_2550nt
ATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGTCCTCCAATTCTTCA
ACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGTCAGGTGACACACAGTCT
TTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTTCTAAA
GAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTGATATG
GATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAAGCTTA
AGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAAGTCAG
AGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGGAGTTT
GATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCCCGATG
AATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAGAGCCA
GTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTAAGGAA
ACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAGAACTA
GAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTGAACAA
GATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTAGTCGC
ATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTTCCTTG
AGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCCAGAAT
GTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCGAGAGC
AAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTAAATCC
ACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAACAGAAG
CTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTAGTGGC
AGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATACAACA
AAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAATGGTG
GAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGGAAGAA
ATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGGCACAG
CATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATTTTGGT
GTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAGATGGT
CCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTGATGAG
GAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAGCCACT
GAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACATATCT

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000231790_chr3_37058997_+_2715nt
ATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGTCCTCCAATTCTTCA
ACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGTCAGGTGACACACAGTCT
TTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTTCTAAA
GAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTGATATG
GATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAAGCTTA
AGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAAGTCAG
AGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGGAGTTT
GATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCCCGATG
AATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAGAGCCA
GTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTAAGGAA
ACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAGAACTA
GAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTGAACAA
GATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTAGTCGC
ATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTTCCTTG
AGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCCAGAAT
GTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCGAGAGC
AAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTAAATCC
ACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAACAGAAG
CTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTAGTGGC
AGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATACAACA
AAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAATGGTG
GAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGGAAGAA
ATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGGCACAG
CATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATTTTGGT
GTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAGATGGT
CCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTGATGAG
GAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAGCCACT
GAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACATATCT
GAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCTATAAA
GCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTGATCTATACAAAGTC

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000458205_chr3_37058997_+_2715nt
ATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGTCCTCCAATTCTTCA
ACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGTCAGGTGACACACAGTCT
TTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTTCTAAA
GAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTGATATG
GATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAAGCTTA
AGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAAGTCAG
AGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGGAGTTT
GATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCCCGATG
AATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAGAGCCA
GTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTAAGGAA
ACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAGAACTA
GAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTGAACAA
GATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTAGTCGC
ATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTTCCTTG
AGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCCAGAAT
GTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCGAGAGC
AAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTAAATCC
ACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAACAGAAG
CTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTAGTGGC
AGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATACAACA
AAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAATGGTG
GAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGGAAGAA
ATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGGCACAG
CATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATTTTGGT
GTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAGATGGT
CCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTGATGAG
GAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAGCCACT
GAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACATATCT
GAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCTATAAA
GCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTGATCTATACAAAGTC

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000539477_chr3_37058997_+_2715nt
ATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGTCCTCCAATTCTTCA
ACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGTCAGGTGACACACAGTCT
TTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTTCTAAA
GAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTGATATG
GATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAAGCTTA
AGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAAGTCAG
AGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGGAGTTT
GATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCCCGATG
AATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAGAGCCA
GTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTAAGGAA
ACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAGAACTA
GAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTGAACAA
GATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTAGTCGC
ATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTTCCTTG
AGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCCAGAAT
GTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCGAGAGC
AAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTAAATCC
ACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAACAGAAG
CTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTAGTGGC
AGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATACAACA
AAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAATGGTG
GAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGGAAGAA
ATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGGCACAG
CATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATTTTGGT
GTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAGATGGT
CCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTGATGAG
GAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAGCCACT
GAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACATATCT
GAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCTATAAA
GCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTGATCTATACAAAGTC

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000455445_chr3_37058997_+_2715nt
ATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGTCCTCCAATTCTTCA
ACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGTCAGGTGACACACAGTCT
TTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTTCTAAA
GAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTGATATG
GATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAAGCTTA
AGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAAGTCAG
AGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGGAGTTT
GATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCCCGATG
AATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAGAGCCA
GTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTAAGGAA
ACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAGAACTA
GAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTGAACAA
GATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTAGTCGC
ATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTTCCTTG
AGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCCAGAAT
GTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCGAGAGC
AAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTAAATCC
ACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAACAGAAG
CTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTAGTGGC
AGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATACAACA
AAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAATGGTG
GAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGGAAGAA
ATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGGCACAG
CATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATTTTGGT
GTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAGATGGT
CCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTGATGAG
GAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAGCCACT
GAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACATATCT
GAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCTATAAA
GCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTGATCTATACAAAGTC

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000435176_chr3_37058997_+_2715nt
ATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGTCCTCCAATTCTTCA
ACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGTCAGGTGACACACAGTCT
TTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTTCTAAA
GAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTGATATG
GATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAAGCTTA
AGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAAGTCAG
AGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGGAGTTT
GATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCCCGATG
AATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAGAGCCA
GTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTAAGGAA
ACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAGAACTA
GAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTGAACAA
GATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTAGTCGC
ATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTTCCTTG
AGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCCAGAAT
GTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCGAGAGC
AAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTAAATCC
ACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAACAGAAG
CTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTAGTGGC
AGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATACAACA
AAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAATGGTG
GAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGGAAGAA
ATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGGCACAG
CATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATTTTGGT
GTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAGATGGT
CCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTGATGAG
GAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAGCCACT
GAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACATATCT
GAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCTATAAA
GCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTGATCTATACAAAGTC

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000536378_chr3_37058997_+_2616nt
ATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGTCCTCCAATTCTTCA
ACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGAATGCATCTACTCATGCC
TCGAAATCTCCTGACAGTGTTAATGGAAGTGAACCAAGCATTCCTCAGTCAGGTGACACACAGTCTTTTGCACAGAAGCTCCAGCTCCGG
GTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTTCTAAAGAGTCTTTGGTACGAACATCTTCC
AGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTGATATGGATAGCGAGGCTGAAGACTTGGTA
GGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAAGCTTAAGTAGCTACAGGGGAAAATATTCT
GAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAAGTCAGAGTCAGGATAAATCACTTCGGAGA
ATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGGAGTTTGATGCATCTTTAGAGGAGAAAGAT
CAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCCCGATGAATGTTGATGTACTGAAACCACTT
CCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAGAGCCAGTAGTGGAAGATGGAACTTCTGTA
AAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTAAGGAAACAATTCAGTCACATAAGGAACAA
TGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAGAACTAGAAAAGATAAAGGACCTTCATATG
GCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTGAACAAGATAAGGGAATGGTAATCGCAGAG
ACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTAGTCGCATCAAACAGATGACTACCCAGGGA
GAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTTCCTTGAGAAAAGCCATAGAAACAGTGTAT
GCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCCAGAATGTGGATGTTAATGTGCACCCCACA
AAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCGAGAGCAAGCTCCTGGGCTCCAATTCCTCC
AGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTAAATCCACAACAAGTCTGACCTCGTCTTCT
ACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAACAGAAGCTTGATGCATTTCTGCAGCCTCTG
AGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTAGTGGCAGGGCTAGGCAGCAAGATGAGGAG
ATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATACAACAAAGGGGACTTCAGAAATGTCAGAG
AAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAATGGTGGAAGATGATTCCCGAAAGGAAATG
ACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGGAAGAAATTAATGAGCAGGGACATGAGGTT
CTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGGCACAGCATCAAACCAAGTTATACCTTCTC
AACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATTTTGGTGTTCTCAGGTTATCGGAGCCAGCA
CCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAGATGGTCCCAAAGAAGGACTTGCTGAATAC
ATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTGATGAGGAAGGGAACCTGATTGGATTACCC
CTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAGCCACTGAGGTGAATTGGGACGAAGAAAAG
GAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACATATCTGAGGAGTCGACCCTCTCAGGCCAG

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000231790_chr3_37058997_+_2781nt
ATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGTCCTCCAATTCTTCA
ACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGAATGCATCTACTCATGCC
TCGAAATCTCCTGACAGTGTTAATGGAAGTGAACCAAGCATTCCTCAGTCAGGTGACACACAGTCTTTTGCACAGAAGCTCCAGCTCCGG
GTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTTCTAAAGAGTCTTTGGTACGAACATCTTCC
AGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTGATATGGATAGCGAGGCTGAAGACTTGGTA
GGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAAGCTTAAGTAGCTACAGGGGAAAATATTCT
GAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAAGTCAGAGTCAGGATAAATCACTTCGGAGA
ATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGGAGTTTGATGCATCTTTAGAGGAGAAAGAT
CAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCCCGATGAATGTTGATGTACTGAAACCACTT
CCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAGAGCCAGTAGTGGAAGATGGAACTTCTGTA
AAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTAAGGAAACAATTCAGTCACATAAGGAACAA
TGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAGAACTAGAAAAGATAAAGGACCTTCATATG
GCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTGAACAAGATAAGGGAATGGTAATCGCAGAG
ACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTAGTCGCATCAAACAGATGACTACCCAGGGA
GAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTTCCTTGAGAAAAGCCATAGAAACAGTGTAT
GCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCCAGAATGTGGATGTTAATGTGCACCCCACA
AAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCGAGAGCAAGCTCCTGGGCTCCAATTCCTCC
AGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTAAATCCACAACAAGTCTGACCTCGTCTTCT
ACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAACAGAAGCTTGATGCATTTCTGCAGCCTCTG
AGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTAGTGGCAGGGCTAGGCAGCAAGATGAGGAG
ATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATACAACAAAGGGGACTTCAGAAATGTCAGAG
AAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAATGGTGGAAGATGATTCCCGAAAGGAAATG
ACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGGAAGAAATTAATGAGCAGGGACATGAGGTT
CTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGGCACAGCATCAAACCAAGTTATACCTTCTC
AACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATTTTGGTGTTCTCAGGTTATCGGAGCCAGCA
CCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAGATGGTCCCAAAGAAGGACTTGCTGAATAC
ATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTGATGAGGAAGGGAACCTGATTGGATTACCC
CTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAGCCACTGAGGTGAATTGGGACGAAGAAAAG
GAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACATATCTGAGGAGTCGACCCTCTCAGGCCAG
CAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCTATAAAGCCTTGCGCTCACACATTCTGCCT

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000458205_chr3_37058997_+_2781nt
ATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGTCCTCCAATTCTTCA
ACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGAATGCATCTACTCATGCC
TCGAAATCTCCTGACAGTGTTAATGGAAGTGAACCAAGCATTCCTCAGTCAGGTGACACACAGTCTTTTGCACAGAAGCTCCAGCTCCGG
GTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTTCTAAAGAGTCTTTGGTACGAACATCTTCC
AGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTGATATGGATAGCGAGGCTGAAGACTTGGTA
GGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAAGCTTAAGTAGCTACAGGGGAAAATATTCT
GAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAAGTCAGAGTCAGGATAAATCACTTCGGAGA
ATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGGAGTTTGATGCATCTTTAGAGGAGAAAGAT
CAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCCCGATGAATGTTGATGTACTGAAACCACTT
CCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAGAGCCAGTAGTGGAAGATGGAACTTCTGTA
AAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTAAGGAAACAATTCAGTCACATAAGGAACAA
TGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAGAACTAGAAAAGATAAAGGACCTTCATATG
GCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTGAACAAGATAAGGGAATGGTAATCGCAGAG
ACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTAGTCGCATCAAACAGATGACTACCCAGGGA
GAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTTCCTTGAGAAAAGCCATAGAAACAGTGTAT
GCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCCAGAATGTGGATGTTAATGTGCACCCCACA
AAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCGAGAGCAAGCTCCTGGGCTCCAATTCCTCC
AGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTAAATCCACAACAAGTCTGACCTCGTCTTCT
ACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAACAGAAGCTTGATGCATTTCTGCAGCCTCTG
AGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTAGTGGCAGGGCTAGGCAGCAAGATGAGGAG
ATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATACAACAAAGGGGACTTCAGAAATGTCAGAG
AAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAATGGTGGAAGATGATTCCCGAAAGGAAATG
ACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGGAAGAAATTAATGAGCAGGGACATGAGGTT
CTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGGCACAGCATCAAACCAAGTTATACCTTCTC
AACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATTTTGGTGTTCTCAGGTTATCGGAGCCAGCA
CCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAGATGGTCCCAAAGAAGGACTTGCTGAATAC
ATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTGATGAGGAAGGGAACCTGATTGGATTACCC
CTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAGCCACTGAGGTGAATTGGGACGAAGAAAAG
GAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACATATCTGAGGAGTCGACCCTCTCAGGCCAG
CAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCTATAAAGCCTTGCGCTCACACATTCTGCCT

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000539477_chr3_37058997_+_2781nt
ATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGTCCTCCAATTCTTCA
ACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGAATGCATCTACTCATGCC
TCGAAATCTCCTGACAGTGTTAATGGAAGTGAACCAAGCATTCCTCAGTCAGGTGACACACAGTCTTTTGCACAGAAGCTCCAGCTCCGG
GTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTTCTAAAGAGTCTTTGGTACGAACATCTTCC
AGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTGATATGGATAGCGAGGCTGAAGACTTGGTA
GGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAAGCTTAAGTAGCTACAGGGGAAAATATTCT
GAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAAGTCAGAGTCAGGATAAATCACTTCGGAGA
ATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGGAGTTTGATGCATCTTTAGAGGAGAAAGAT
CAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCCCGATGAATGTTGATGTACTGAAACCACTT
CCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAGAGCCAGTAGTGGAAGATGGAACTTCTGTA
AAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTAAGGAAACAATTCAGTCACATAAGGAACAA
TGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAGAACTAGAAAAGATAAAGGACCTTCATATG
GCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTGAACAAGATAAGGGAATGGTAATCGCAGAG
ACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTAGTCGCATCAAACAGATGACTACCCAGGGA
GAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTTCCTTGAGAAAAGCCATAGAAACAGTGTAT
GCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCCAGAATGTGGATGTTAATGTGCACCCCACA
AAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCGAGAGCAAGCTCCTGGGCTCCAATTCCTCC
AGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTAAATCCACAACAAGTCTGACCTCGTCTTCT
ACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAACAGAAGCTTGATGCATTTCTGCAGCCTCTG
AGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTAGTGGCAGGGCTAGGCAGCAAGATGAGGAG
ATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATACAACAAAGGGGACTTCAGAAATGTCAGAG
AAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAATGGTGGAAGATGATTCCCGAAAGGAAATG
ACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGGAAGAAATTAATGAGCAGGGACATGAGGTT
CTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGGCACAGCATCAAACCAAGTTATACCTTCTC
AACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATTTTGGTGTTCTCAGGTTATCGGAGCCAGCA
CCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAGATGGTCCCAAAGAAGGACTTGCTGAATAC
ATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTGATGAGGAAGGGAACCTGATTGGATTACCC
CTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAGCCACTGAGGTGAATTGGGACGAAGAAAAG
GAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACATATCTGAGGAGTCGACCCTCTCAGGCCAG
CAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCTATAAAGCCTTGCGCTCACACATTCTGCCT

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000455445_chr3_37058997_+_2781nt
ATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGTCCTCCAATTCTTCA
ACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGAATGCATCTACTCATGCC
TCGAAATCTCCTGACAGTGTTAATGGAAGTGAACCAAGCATTCCTCAGTCAGGTGACACACAGTCTTTTGCACAGAAGCTCCAGCTCCGG
GTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTTCTAAAGAGTCTTTGGTACGAACATCTTCC
AGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTGATATGGATAGCGAGGCTGAAGACTTGGTA
GGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAAGCTTAAGTAGCTACAGGGGAAAATATTCT
GAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAAGTCAGAGTCAGGATAAATCACTTCGGAGA
ATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGGAGTTTGATGCATCTTTAGAGGAGAAAGAT
CAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCCCGATGAATGTTGATGTACTGAAACCACTT
CCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAGAGCCAGTAGTGGAAGATGGAACTTCTGTA
AAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTAAGGAAACAATTCAGTCACATAAGGAACAA
TGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAGAACTAGAAAAGATAAAGGACCTTCATATG
GCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTGAACAAGATAAGGGAATGGTAATCGCAGAG
ACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTAGTCGCATCAAACAGATGACTACCCAGGGA
GAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTTCCTTGAGAAAAGCCATAGAAACAGTGTAT
GCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCCAGAATGTGGATGTTAATGTGCACCCCACA
AAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCGAGAGCAAGCTCCTGGGCTCCAATTCCTCC
AGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTAAATCCACAACAAGTCTGACCTCGTCTTCT
ACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAACAGAAGCTTGATGCATTTCTGCAGCCTCTG
AGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTAGTGGCAGGGCTAGGCAGCAAGATGAGGAG
ATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATACAACAAAGGGGACTTCAGAAATGTCAGAG
AAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAATGGTGGAAGATGATTCCCGAAAGGAAATG
ACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGGAAGAAATTAATGAGCAGGGACATGAGGTT
CTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGGCACAGCATCAAACCAAGTTATACCTTCTC
AACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATTTTGGTGTTCTCAGGTTATCGGAGCCAGCA
CCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAGATGGTCCCAAAGAAGGACTTGCTGAATAC
ATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTGATGAGGAAGGGAACCTGATTGGATTACCC
CTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAGCCACTGAGGTGAATTGGGACGAAGAAAAG
GAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACATATCTGAGGAGTCGACCCTCTCAGGCCAG
CAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCTATAAAGCCTTGCGCTCACACATTCTGCCT

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000435176_chr3_37058997_+_2781nt
ATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGTCCTCCAATTCTTCA
ACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGAATGCATCTACTCATGCC
TCGAAATCTCCTGACAGTGTTAATGGAAGTGAACCAAGCATTCCTCAGTCAGGTGACACACAGTCTTTTGCACAGAAGCTCCAGCTCCGG
GTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTTCTAAAGAGTCTTTGGTACGAACATCTTCC
AGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTGATATGGATAGCGAGGCTGAAGACTTGGTA
GGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAAGCTTAAGTAGCTACAGGGGAAAATATTCT
GAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAAGTCAGAGTCAGGATAAATCACTTCGGAGA
ATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGGAGTTTGATGCATCTTTAGAGGAGAAAGAT
CAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCCCGATGAATGTTGATGTACTGAAACCACTT
CCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAGAGCCAGTAGTGGAAGATGGAACTTCTGTA
AAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTAAGGAAACAATTCAGTCACATAAGGAACAA
TGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAGAACTAGAAAAGATAAAGGACCTTCATATG
GCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTGAACAAGATAAGGGAATGGTAATCGCAGAG
ACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTAGTCGCATCAAACAGATGACTACCCAGGGA
GAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTTCCTTGAGAAAAGCCATAGAAACAGTGTAT
GCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCCAGAATGTGGATGTTAATGTGCACCCCACA
AAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCGAGAGCAAGCTCCTGGGCTCCAATTCCTCC
AGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTAAATCCACAACAAGTCTGACCTCGTCTTCT
ACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAACAGAAGCTTGATGCATTTCTGCAGCCTCTG
AGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTAGTGGCAGGGCTAGGCAGCAAGATGAGGAG
ATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATACAACAAAGGGGACTTCAGAAATGTCAGAG
AAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAATGGTGGAAGATGATTCCCGAAAGGAAATG
ACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGGAAGAAATTAATGAGCAGGGACATGAGGTT
CTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGGCACAGCATCAAACCAAGTTATACCTTCTC
AACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATTTTGGTGTTCTCAGGTTATCGGAGCCAGCA
CCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAGATGGTCCCAAAGAAGGACTTGCTGAATAC
ATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTGATGAGGAAGGGAACCTGATTGGATTACCC
CTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAGCCACTGAGGTGAATTGGGACGAAGAAAAG
GAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACATATCTGAGGAGTCGACCCTCTCAGGCCAG
CAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCTATAAAGCCTTGCGCTCACACATTCTGCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000536378_chr3_37058997_+_3194nt
ATGTGCGGGACCCGACATTGTGCTTGTCCCATCCGGTGCTCCGTAGTTAGCCTCTGTGAGCTCCACGTAGGCCGCGCAAGCGCCCTTGGC
GCACAGTTCACCTGCTGCCGTTGTCGTCGCCGCCGCGGCTCCCGGGGCTGGATGGGGGGCCGAGGCCAGCCAGTGGCACCCGGAAGAAAG
AGACGCGGCGGCGGCGACGCCGACACCCTCAGGACGAGTGTCCGGACTTGCCCACAGCCTCAAGGAGGAGACGGCGAGGCCCGGCCCCCG
CTGTCCCTGGTGTAAAGAAGTCGCCGTAGCCGTCGCGGCCGGGACTCCCCGGGCTCTCGCCCTTCAGGTTTCGTTGACACTCAGGACCGT
ACGTACGCTGCGCCATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGT
CCTCCAATTCTTCAACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGTCAG
GTGACACACAGTCTTTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCC
GGTCTTCTTCTAAAGAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATC
CACCCTCTGATATGGATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAA
TGGAACGAAGCTTAAGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAG
GTATATTAAGTCAGAGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATC
TGCAAGAGGAGTTTGATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTAC
GAAATGGCCCGATGAATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAA
GTGATGGAGAGCCAGTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTA
AGCGTTGTAAGGAAACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAA
GACTTCAAGAACTAGAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTG
AACAGCTTGAACAAGATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTC
AACTCCGTAGTCGCATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAG
AATCAACTTCCTTGAGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAA
TCAGTCCCCAGAATGTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGC
AGCACATCGAGAGCAAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGG
AGATGGTTAAATCCACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATT
CCCGGGAACAGAAGCTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAG
ATATTTCTAGTGGCAGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGG
AGGGGGATACAACAAAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTG
ATGTGGAAATGGTGGAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGA
GTCTCCAGGAAGAAATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGT
GGGCCTTGGCACAGCATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATT
TTGCCAATTTTGGTGTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGA
CAGAGGAAGATGGTCCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTT
TGGAAATTGATGAGGAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTC
TTCGACTAGCCACTGAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGA
AGCAGTACATATCTGAGGAGTCGACCCTCTCAGGCCAGCAGTGACCCAGATGCTGATTTCCCAAGGTCAAGGATGTCTGAAGACAATGTG
CCAATGTGCCCAGATTCTTCTAGTTAAGGATCTACTTGAGTCTCAGCCCTTATGCTGTTTTTGTTTTCCAAGCTGGGATATGAAAAAGCA
GAAAACCCAATAGGGTAACATTAATCCAAGTCAACATAGCAACCAGTATCTTACCTAATGGCCCTTCTCCTGCTGACTCCAAGACCTGAG

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000231790_chr3_37058997_+_3354nt
ATGTGCGGGACCCGACATTGTGCTTGTCCCATCCGGTGCTCCGTAGTTAGCCTCTGTGAGCTCCACGTAGGCCGCGCAAGCGCCCTTGGC
GCACAGTTCACCTGCTGCCGTTGTCGTCGCCGCCGCGGCTCCCGGGGCTGGATGGGGGGCCGAGGCCAGCCAGTGGCACCCGGAAGAAAG
AGACGCGGCGGCGGCGACGCCGACACCCTCAGGACGAGTGTCCGGACTTGCCCACAGCCTCAAGGAGGAGACGGCGAGGCCCGGCCCCCG
CTGTCCCTGGTGTAAAGAAGTCGCCGTAGCCGTCGCGGCCGGGACTCCCCGGGCTCTCGCCCTTCAGGTTTCGTTGACACTCAGGACCGT
ACGTACGCTGCGCCATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGT
CCTCCAATTCTTCAACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGTCAG
GTGACACACAGTCTTTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCC
GGTCTTCTTCTAAAGAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATC
CACCCTCTGATATGGATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAA
TGGAACGAAGCTTAAGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAG
GTATATTAAGTCAGAGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATC
TGCAAGAGGAGTTTGATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTAC
GAAATGGCCCGATGAATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAA
GTGATGGAGAGCCAGTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTA
AGCGTTGTAAGGAAACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAA
GACTTCAAGAACTAGAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTG
AACAGCTTGAACAAGATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTC
AACTCCGTAGTCGCATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAG
AATCAACTTCCTTGAGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAA
TCAGTCCCCAGAATGTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGC
AGCACATCGAGAGCAAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGG
AGATGGTTAAATCCACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATT
CCCGGGAACAGAAGCTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAG
ATATTTCTAGTGGCAGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGG
AGGGGGATACAACAAAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTG
ATGTGGAAATGGTGGAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGA
GTCTCCAGGAAGAAATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGT
GGGCCTTGGCACAGCATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATT
TTGCCAATTTTGGTGTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGA
CAGAGGAAGATGGTCCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTT
TGGAAATTGATGAGGAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTC
TTCGACTAGCCACTGAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGA
AGCAGTACATATCTGAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAAC
ACATTGTCTATAAAGCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTG
ATCTATACAAAGTCTTTGAGAGGTGTTAAATATGGTTATTTATGCACTGTGGGATGTGTTCTTCTTTCTCTGTATTCCGATACAAAGTGT
TGTATCAAAGTGTGATATACAAAGTGTACCAACATAAGTGTTGGTAGCACTTAAGACTTATACTTGCCTTCTGATAGTATTCCTTTATAC
ACAGTGGATTGATTATAAATAAATAGATGTGTCTTAACATAATTTCTTATTTAATTTTATTATGTATATATTGTGTCAGTTCAGATGCCA

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000458205_chr3_37058997_+_3282nt
ATGTGCGGGACCCGACATTGTGCTTGTCCCATCCGGTGCTCCGTAGTTAGCCTCTGTGAGCTCCACGTAGGCCGCGCAAGCGCCCTTGGC
GCACAGTTCACCTGCTGCCGTTGTCGTCGCCGCCGCGGCTCCCGGGGCTGGATGGGGGGCCGAGGCCAGCCAGTGGCACCCGGAAGAAAG
AGACGCGGCGGCGGCGACGCCGACACCCTCAGGACGAGTGTCCGGACTTGCCCACAGCCTCAAGGAGGAGACGGCGAGGCCCGGCCCCCG
CTGTCCCTGGTGTAAAGAAGTCGCCGTAGCCGTCGCGGCCGGGACTCCCCGGGCTCTCGCCCTTCAGGTTTCGTTGACACTCAGGACCGT
ACGTACGCTGCGCCATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGT
CCTCCAATTCTTCAACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGTCAG
GTGACACACAGTCTTTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCC
GGTCTTCTTCTAAAGAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATC
CACCCTCTGATATGGATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAA
TGGAACGAAGCTTAAGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAG
GTATATTAAGTCAGAGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATC
TGCAAGAGGAGTTTGATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTAC
GAAATGGCCCGATGAATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAA
GTGATGGAGAGCCAGTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTA
AGCGTTGTAAGGAAACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAA
GACTTCAAGAACTAGAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTG
AACAGCTTGAACAAGATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTC
AACTCCGTAGTCGCATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAG
AATCAACTTCCTTGAGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAA
TCAGTCCCCAGAATGTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGC
AGCACATCGAGAGCAAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGG
AGATGGTTAAATCCACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATT
CCCGGGAACAGAAGCTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAG
ATATTTCTAGTGGCAGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGG
AGGGGGATACAACAAAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTG
ATGTGGAAATGGTGGAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGA
GTCTCCAGGAAGAAATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGT
GGGCCTTGGCACAGCATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATT
TTGCCAATTTTGGTGTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGA
CAGAGGAAGATGGTCCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTT
TGGAAATTGATGAGGAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTC
TTCGACTAGCCACTGAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGA
AGCAGTACATATCTGAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAAC
ACATTGTCTATAAAGCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTG
ATCTATACAAAGTCTTTGAGAGGTGTTAAATATGGTTATTTATGCACTGTGGGATGTGTTCTTCTTTCTCTGTATTCCGATACAAAGTGT
TGTATCAAAGTGTGATATACAAAGTGTACCAACATAAGTGTTGGTAGCACTTAAGACTTATACTTGCCTTCTGATAGTATTCCTTTATAC

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000539477_chr3_37058997_+_3278nt
ATGTGCGGGACCCGACATTGTGCTTGTCCCATCCGGTGCTCCGTAGTTAGCCTCTGTGAGCTCCACGTAGGCCGCGCAAGCGCCCTTGGC
GCACAGTTCACCTGCTGCCGTTGTCGTCGCCGCCGCGGCTCCCGGGGCTGGATGGGGGGCCGAGGCCAGCCAGTGGCACCCGGAAGAAAG
AGACGCGGCGGCGGCGACGCCGACACCCTCAGGACGAGTGTCCGGACTTGCCCACAGCCTCAAGGAGGAGACGGCGAGGCCCGGCCCCCG
CTGTCCCTGGTGTAAAGAAGTCGCCGTAGCCGTCGCGGCCGGGACTCCCCGGGCTCTCGCCCTTCAGGTTTCGTTGACACTCAGGACCGT
ACGTACGCTGCGCCATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGT
CCTCCAATTCTTCAACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGTCAG
GTGACACACAGTCTTTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCC
GGTCTTCTTCTAAAGAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATC
CACCCTCTGATATGGATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAA
TGGAACGAAGCTTAAGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAG
GTATATTAAGTCAGAGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATC
TGCAAGAGGAGTTTGATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTAC
GAAATGGCCCGATGAATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAA
GTGATGGAGAGCCAGTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTA
AGCGTTGTAAGGAAACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAA
GACTTCAAGAACTAGAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTG
AACAGCTTGAACAAGATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTC
AACTCCGTAGTCGCATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAG
AATCAACTTCCTTGAGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAA
TCAGTCCCCAGAATGTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGC
AGCACATCGAGAGCAAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGG
AGATGGTTAAATCCACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATT
CCCGGGAACAGAAGCTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAG
ATATTTCTAGTGGCAGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGG
AGGGGGATACAACAAAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTG
ATGTGGAAATGGTGGAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGA
GTCTCCAGGAAGAAATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGT
GGGCCTTGGCACAGCATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATT
TTGCCAATTTTGGTGTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGA
CAGAGGAAGATGGTCCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTT
TGGAAATTGATGAGGAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTC
TTCGACTAGCCACTGAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGA
AGCAGTACATATCTGAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAAC
ACATTGTCTATAAAGCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTG
ATCTATACAAAGTCTTTGAGAGGTGTTAAATATGGTTATTTATGCACTGTGGGATGTGTTCTTCTTTCTCTGTATTCCGATACAAAGTGT
TGTATCAAAGTGTGATATACAAAGTGTACCAACATAAGTGTTGGTAGCACTTAAGACTTATACTTGCCTTCTGATAGTATTCCTTTATAC

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000455445_chr3_37058997_+_3142nt
ATGTGCGGGACCCGACATTGTGCTTGTCCCATCCGGTGCTCCGTAGTTAGCCTCTGTGAGCTCCACGTAGGCCGCGCAAGCGCCCTTGGC
GCACAGTTCACCTGCTGCCGTTGTCGTCGCCGCCGCGGCTCCCGGGGCTGGATGGGGGGCCGAGGCCAGCCAGTGGCACCCGGAAGAAAG
AGACGCGGCGGCGGCGACGCCGACACCCTCAGGACGAGTGTCCGGACTTGCCCACAGCCTCAAGGAGGAGACGGCGAGGCCCGGCCCCCG
CTGTCCCTGGTGTAAAGAAGTCGCCGTAGCCGTCGCGGCCGGGACTCCCCGGGCTCTCGCCCTTCAGGTTTCGTTGACACTCAGGACCGT
ACGTACGCTGCGCCATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGT
CCTCCAATTCTTCAACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGTCAG
GTGACACACAGTCTTTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCC
GGTCTTCTTCTAAAGAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATC
CACCCTCTGATATGGATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAA
TGGAACGAAGCTTAAGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAG
GTATATTAAGTCAGAGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATC
TGCAAGAGGAGTTTGATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTAC
GAAATGGCCCGATGAATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAA
GTGATGGAGAGCCAGTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTA
AGCGTTGTAAGGAAACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAA
GACTTCAAGAACTAGAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTG
AACAGCTTGAACAAGATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTC
AACTCCGTAGTCGCATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAG
AATCAACTTCCTTGAGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAA
TCAGTCCCCAGAATGTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGC
AGCACATCGAGAGCAAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGG
AGATGGTTAAATCCACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATT
CCCGGGAACAGAAGCTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAG
ATATTTCTAGTGGCAGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGG
AGGGGGATACAACAAAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTG
ATGTGGAAATGGTGGAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGA
GTCTCCAGGAAGAAATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGT
GGGCCTTGGCACAGCATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATT
TTGCCAATTTTGGTGTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGA
CAGAGGAAGATGGTCCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTT
TGGAAATTGATGAGGAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTC
TTCGACTAGCCACTGAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGA
AGCAGTACATATCTGAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAAC
ACATTGTCTATAAAGCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTG

>In-frame_GOLGA4_ENST00000361924_chr3_37343823_+_MLH1_ENST00000435176_chr3_37058997_+_3280nt
ATGTGCGGGACCCGACATTGTGCTTGTCCCATCCGGTGCTCCGTAGTTAGCCTCTGTGAGCTCCACGTAGGCCGCGCAAGCGCCCTTGGC
GCACAGTTCACCTGCTGCCGTTGTCGTCGCCGCCGCGGCTCCCGGGGCTGGATGGGGGGCCGAGGCCAGCCAGTGGCACCCGGAAGAAAG
AGACGCGGCGGCGGCGACGCCGACACCCTCAGGACGAGTGTCCGGACTTGCCCACAGCCTCAAGGAGGAGACGGCGAGGCCCGGCCCCCG
CTGTCCCTGGTGTAAAGAAGTCGCCGTAGCCGTCGCGGCCGGGACTCCCCGGGCTCTCGCCCTTCAGGTTTCGTTGACACTCAGGACCGT
ACGTACGCTGCGCCATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGGCTCCTGCTCAGGCGT
CCTCCAATTCTTCAACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACACCCAATAGAGAGTCAG
GTGACACACAGTCTTTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCC
GGTCTTCTTCTAAAGAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATC
CACCCTCTGATATGGATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAA
TGGAACGAAGCTTAAGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAG
GTATATTAAGTCAGAGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATC
TGCAAGAGGAGTTTGATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTAC
GAAATGGCCCGATGAATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAA
GTGATGGAGAGCCAGTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTA
AGCGTTGTAAGGAAACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAA
GACTTCAAGAACTAGAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTG
AACAGCTTGAACAAGATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTC
AACTCCGTAGTCGCATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAG
AATCAACTTCCTTGAGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAA
TCAGTCCCCAGAATGTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGC
AGCACATCGAGAGCAAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGG
AGATGGTTAAATCCACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATT
CCCGGGAACAGAAGCTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAG
ATATTTCTAGTGGCAGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGG
AGGGGGATACAACAAAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTG
ATGTGGAAATGGTGGAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGA
GTCTCCAGGAAGAAATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGT
GGGCCTTGGCACAGCATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATT
TTGCCAATTTTGGTGTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGA
CAGAGGAAGATGGTCCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTT
TGGAAATTGATGAGGAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTC
TTCGACTAGCCACTGAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGA
AGCAGTACATATCTGAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAAC
ACATTGTCTATAAAGCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTG
ATCTATACAAAGTCTTTGAGAGGTGTTAAATATGGTTATTTATGCACTGTGGGATGTGTTCTTCTTTCTCTGTATTCCGATACAAAGTGT
TGTATCAAAGTGTGATATACAAAGTGTACCAACATAAGTGTTGGTAGCACTTAAGACTTATACTTGCCTTCTGATAGTATTCCTTTATAC

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000536378_chr3_37058997_+_3185nt
GCAAGCGCCCTTGGCGCACAGTTCACCTGCTGCCGTTGTCGTCGCCGCCGCGGCTCCCGGGGCTGGATGGGGGGCCGAGGCCAGCCAGTG
GCACCCGGAAGAAAGAGACGCGGCGGCGGCGACGCCGACACCCTCAGGACGAGTGTCCGGACTTGCCCACAGCCTCAAGGAGGAGACGGC
GAGGCCCGGCCCCCGCTGTCCCTGGTGTAAAGAAGTCGCCGTAGCCGTCGCGGCCGGGACTCCCCGGGCTCTCGCCCTTCAGGTTTCGTT
GACACTCAGGACCGTACGTACGCTGCGCCATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGG
CTCCTGCTCAGGCGTCCTCCAATTCTTCAACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACAC
CCAATAGAGAGAATGCATCTACTCATGCCTCGAAATCTCCTGACAGTGTTAATGGAAGTGAACCAAGCATTCCTCAGTCAGGTGACACAC
AGTCTTTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTT
CTAAAGAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTG
ATATGGATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAA
GCTTAAGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAA
GTCAGAGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGG
AGTTTGATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCC
CGATGAATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAG
AGCCAGTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTA
AGGAAACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAG
AACTAGAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTG
AACAAGATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTA
GTCGCATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTT
CCTTGAGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCC
AGAATGTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCG
AGAGCAAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTA
AATCCACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAAC
AGAAGCTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTA
GTGGCAGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATA
CAACAAAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAA
TGGTGGAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGG
AAGAAATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGG
CACAGCATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATT
TTGGTGTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAG
ATGGTCCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTG
ATGAGGAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAG
CCACTGAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACA
TATCTGAGGAGTCGACCCTCTCAGGCCAGCAGTGACCCAGATGCTGATTTCCCAAGGTCAAGGATGTCTGAAGACAATGTGCCAATGTGC
CCAGATTCTTCTAGTTAAGGATCTACTTGAGTCTCAGCCCTTATGCTGTTTTTGTTTTCCAAGCTGGGATATGAAAAAGCAGAAAACCCA
ATAGGGTAACATTAATCCAAGTCAACATAGCAACCAGTATCTTACCTAATGGCCCTTCTCCTGCTGACTCCAAGACCTGAGCAGCTTCCT

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000231790_chr3_37058997_+_3345nt
GCAAGCGCCCTTGGCGCACAGTTCACCTGCTGCCGTTGTCGTCGCCGCCGCGGCTCCCGGGGCTGGATGGGGGGCCGAGGCCAGCCAGTG
GCACCCGGAAGAAAGAGACGCGGCGGCGGCGACGCCGACACCCTCAGGACGAGTGTCCGGACTTGCCCACAGCCTCAAGGAGGAGACGGC
GAGGCCCGGCCCCCGCTGTCCCTGGTGTAAAGAAGTCGCCGTAGCCGTCGCGGCCGGGACTCCCCGGGCTCTCGCCCTTCAGGTTTCGTT
GACACTCAGGACCGTACGTACGCTGCGCCATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGG
CTCCTGCTCAGGCGTCCTCCAATTCTTCAACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACAC
CCAATAGAGAGAATGCATCTACTCATGCCTCGAAATCTCCTGACAGTGTTAATGGAAGTGAACCAAGCATTCCTCAGTCAGGTGACACAC
AGTCTTTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTT
CTAAAGAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTG
ATATGGATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAA
GCTTAAGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAA
GTCAGAGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGG
AGTTTGATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCC
CGATGAATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAG
AGCCAGTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTA
AGGAAACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAG
AACTAGAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTG
AACAAGATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTA
GTCGCATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTT
CCTTGAGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCC
AGAATGTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCG
AGAGCAAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTA
AATCCACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAAC
AGAAGCTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTA
GTGGCAGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATA
CAACAAAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAA
TGGTGGAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGG
AAGAAATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGG
CACAGCATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATT
TTGGTGTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAG
ATGGTCCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTG
ATGAGGAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAG
CCACTGAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACA
TATCTGAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCT
ATAAAGCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTGATCTATACA
AAGTCTTTGAGAGGTGTTAAATATGGTTATTTATGCACTGTGGGATGTGTTCTTCTTTCTCTGTATTCCGATACAAAGTGTTGTATCAAA
GTGTGATATACAAAGTGTACCAACATAAGTGTTGGTAGCACTTAAGACTTATACTTGCCTTCTGATAGTATTCCTTTATACACAGTGGAT
TGATTATAAATAAATAGATGTGTCTTAACATAATTTCTTATTTAATTTTATTATGTATATATTGTGTCAGTTCAGATGCCAAAAAGAGGT

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000458205_chr3_37058997_+_3273nt
GCAAGCGCCCTTGGCGCACAGTTCACCTGCTGCCGTTGTCGTCGCCGCCGCGGCTCCCGGGGCTGGATGGGGGGCCGAGGCCAGCCAGTG
GCACCCGGAAGAAAGAGACGCGGCGGCGGCGACGCCGACACCCTCAGGACGAGTGTCCGGACTTGCCCACAGCCTCAAGGAGGAGACGGC
GAGGCCCGGCCCCCGCTGTCCCTGGTGTAAAGAAGTCGCCGTAGCCGTCGCGGCCGGGACTCCCCGGGCTCTCGCCCTTCAGGTTTCGTT
GACACTCAGGACCGTACGTACGCTGCGCCATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGG
CTCCTGCTCAGGCGTCCTCCAATTCTTCAACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACAC
CCAATAGAGAGAATGCATCTACTCATGCCTCGAAATCTCCTGACAGTGTTAATGGAAGTGAACCAAGCATTCCTCAGTCAGGTGACACAC
AGTCTTTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTT
CTAAAGAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTG
ATATGGATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAA
GCTTAAGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAA
GTCAGAGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGG
AGTTTGATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCC
CGATGAATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAG
AGCCAGTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTA
AGGAAACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAG
AACTAGAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTG
AACAAGATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTA
GTCGCATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTT
CCTTGAGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCC
AGAATGTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCG
AGAGCAAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTA
AATCCACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAAC
AGAAGCTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTA
GTGGCAGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATA
CAACAAAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAA
TGGTGGAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGG
AAGAAATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGG
CACAGCATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATT
TTGGTGTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAG
ATGGTCCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTG
ATGAGGAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAG
CCACTGAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACA
TATCTGAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCT
ATAAAGCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTGATCTATACA
AAGTCTTTGAGAGGTGTTAAATATGGTTATTTATGCACTGTGGGATGTGTTCTTCTTTCTCTGTATTCCGATACAAAGTGTTGTATCAAA
GTGTGATATACAAAGTGTACCAACATAAGTGTTGGTAGCACTTAAGACTTATACTTGCCTTCTGATAGTATTCCTTTATACACAGTGGAT

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000539477_chr3_37058997_+_3269nt
GCAAGCGCCCTTGGCGCACAGTTCACCTGCTGCCGTTGTCGTCGCCGCCGCGGCTCCCGGGGCTGGATGGGGGGCCGAGGCCAGCCAGTG
GCACCCGGAAGAAAGAGACGCGGCGGCGGCGACGCCGACACCCTCAGGACGAGTGTCCGGACTTGCCCACAGCCTCAAGGAGGAGACGGC
GAGGCCCGGCCCCCGCTGTCCCTGGTGTAAAGAAGTCGCCGTAGCCGTCGCGGCCGGGACTCCCCGGGCTCTCGCCCTTCAGGTTTCGTT
GACACTCAGGACCGTACGTACGCTGCGCCATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGG
CTCCTGCTCAGGCGTCCTCCAATTCTTCAACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACAC
CCAATAGAGAGAATGCATCTACTCATGCCTCGAAATCTCCTGACAGTGTTAATGGAAGTGAACCAAGCATTCCTCAGTCAGGTGACACAC
AGTCTTTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTT
CTAAAGAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTG
ATATGGATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAA
GCTTAAGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAA
GTCAGAGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGG
AGTTTGATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCC
CGATGAATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAG
AGCCAGTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTA
AGGAAACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAG
AACTAGAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTG
AACAAGATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTA
GTCGCATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTT
CCTTGAGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCC
AGAATGTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCG
AGAGCAAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTA
AATCCACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAAC
AGAAGCTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTA
GTGGCAGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATA
CAACAAAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAA
TGGTGGAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGG
AAGAAATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGG
CACAGCATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATT
TTGGTGTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAG
ATGGTCCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTG
ATGAGGAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAG
CCACTGAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACA
TATCTGAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCT
ATAAAGCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTGATCTATACA
AAGTCTTTGAGAGGTGTTAAATATGGTTATTTATGCACTGTGGGATGTGTTCTTCTTTCTCTGTATTCCGATACAAAGTGTTGTATCAAA
GTGTGATATACAAAGTGTACCAACATAAGTGTTGGTAGCACTTAAGACTTATACTTGCCTTCTGATAGTATTCCTTTATACACAGTGGAT

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000455445_chr3_37058997_+_3133nt
GCAAGCGCCCTTGGCGCACAGTTCACCTGCTGCCGTTGTCGTCGCCGCCGCGGCTCCCGGGGCTGGATGGGGGGCCGAGGCCAGCCAGTG
GCACCCGGAAGAAAGAGACGCGGCGGCGGCGACGCCGACACCCTCAGGACGAGTGTCCGGACTTGCCCACAGCCTCAAGGAGGAGACGGC
GAGGCCCGGCCCCCGCTGTCCCTGGTGTAAAGAAGTCGCCGTAGCCGTCGCGGCCGGGACTCCCCGGGCTCTCGCCCTTCAGGTTTCGTT
GACACTCAGGACCGTACGTACGCTGCGCCATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGG
CTCCTGCTCAGGCGTCCTCCAATTCTTCAACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACAC
CCAATAGAGAGAATGCATCTACTCATGCCTCGAAATCTCCTGACAGTGTTAATGGAAGTGAACCAAGCATTCCTCAGTCAGGTGACACAC
AGTCTTTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTT
CTAAAGAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTG
ATATGGATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAA
GCTTAAGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAA
GTCAGAGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGG
AGTTTGATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCC
CGATGAATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAG
AGCCAGTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTA
AGGAAACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAG
AACTAGAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTG
AACAAGATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTA
GTCGCATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTT
CCTTGAGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCC
AGAATGTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCG
AGAGCAAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTA
AATCCACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAAC
AGAAGCTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTA
GTGGCAGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATA
CAACAAAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAA
TGGTGGAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGG
AAGAAATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGG
CACAGCATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATT
TTGGTGTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAG
ATGGTCCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTG
ATGAGGAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAG
CCACTGAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACA
TATCTGAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCT
ATAAAGCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTGATCTATACA

>In-frame_GOLGA4_ENST00000356847_chr3_37343823_+_MLH1_ENST00000435176_chr3_37058997_+_3271nt
GCAAGCGCCCTTGGCGCACAGTTCACCTGCTGCCGTTGTCGTCGCCGCCGCGGCTCCCGGGGCTGGATGGGGGGCCGAGGCCAGCCAGTG
GCACCCGGAAGAAAGAGACGCGGCGGCGGCGACGCCGACACCCTCAGGACGAGTGTCCGGACTTGCCCACAGCCTCAAGGAGGAGACGGC
GAGGCCCGGCCCCCGCTGTCCCTGGTGTAAAGAAGTCGCCGTAGCCGTCGCGGCCGGGACTCCCCGGGCTCTCGCCCTTCAGGTTTCGTT
GACACTCAGGACCGTACGTACGCTGCGCCATGTTCAAGAAACTGAAGCAAAAGATCAGCGAGGAGCAGCAGCAGCTCCAGCAGGCGCTGG
CTCCTGCTCAGGCGTCCTCCAATTCTTCAACACCAACAAGAATGAGGAGCAGGACATCTTCATTTACAGAGCAACTTGATGAAGGTACAC
CCAATAGAGAGAATGCATCTACTCATGCCTCGAAATCTCCTGACAGTGTTAATGGAAGTGAACCAAGCATTCCTCAGTCAGGTGACACAC
AGTCTTTTGCACAGAAGCTCCAGCTCCGGGTGCCCTCCGTGGAGTCTTTGTTTCGAAGTCCGATAAAGGAATCTCTATTCCGGTCTTCTT
CTAAAGAGTCTTTGGTACGAACATCTTCCAGAGAATCCCTGAATCGACTTGACCTGGACAGTTCTACTGCCAGTTTTGATCCACCCTCTG
ATATGGATAGCGAGGCTGAAGACTTGGTAGGGAATTCAGACAGTCTCAACAAAGAACAGTTGATTCAGCGGTTGCGAAGAATGGAACGAA
GCTTAAGTAGCTACAGGGGAAAATATTCTGAGCTTGTTACAGCTTATCAGATGCTTCAGAGAGAGAAGAAAAAGCTACAAGGTATATTAA
GTCAGAGTCAGGATAAATCACTTCGGAGAATAGCAGAATTAAGAGAGGAGCTCCAAATGGACCAGCAGGCAAAGAAACATCTGCAAGAGG
AGTTTGATGCATCTTTAGAGGAGAAAGATCAGTATATCAGTGTTCTCCAAACTCAGGTTTCTCTACTGAAACAACGATTACGAAATGGCC
CGATGAATGTTGATGTACTGAAACCACTTCCTCAGCTGGAACCACAGGCTGAAGTCTTCACTAAAGAAGAGAATCCAGAAAGTGATGGAG
AGCCAGTAGTGGAAGATGGAACTTCTGTAAAAACACTGGAAACACTCCAGCAAAGAGTGAAGCGTCAAGAGAACCTACTTAAGCGTTGTA
AGGAAACAATTCAGTCACATAAGGAACAATGTACACTATTAACTAGTGAAAAAGAAGCTCTGCAAGAACAACTGGATGAAAGACTTCAAG
AACTAGAAAAGATAAAGGACCTTCATATGGCCGAGAAGACTAAACTTATCACTCAGTTGCGTGATGCAAAGAACTTAATTGAACAGCTTG
AACAAGATAAGGGAATGGTAATCGCAGAGACAAAACGTCAGATGCATGAAACCCTGGAAATGAAAGAAGAAGAAATTGCTCAACTCCGTA
GTCGCATCAAACAGATGACTACCCAGGGAGAGGAATTACGGGAACAGAAAGAAAAGTCCGAAAGAGCTGATCGTCTGGTAGAATCAACTT
CCTTGAGAAAAGCCATAGAAACAGTGTATGCAGCCTATTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTAGAAATCAGTCCCC
AGAATGTGGATGTTAATGTGCACCCCACAAAGCATGAAGTTCACTTCCTGCACGAGGAGAGCATCCTGGAGCGGGTGCAGCAGCACATCG
AGAGCAAGCTCCTGGGCTCCAATTCCTCCAGGATGTACTTCACCCAGACTTTGCTACCAGGACTTGCTGGCCCCTCTGGGGAGATGGTTA
AATCCACAACAAGTCTGACCTCGTCTTCTACTTCTGGAAGTAGTGATAAGGTCTATGCCCACCAGATGGTTCGTACAGATTCCCGGGAAC
AGAAGCTTGATGCATTTCTGCAGCCTCTGAGCAAACCCCTGTCCAGTCAGCCCCAGGCCATTGTCACAGAGGATAAGACAGATATTTCTA
GTGGCAGGGCTAGGCAGCAAGATGAGGAGATGCTTGAACTCCCAGCCCCTGCTGAAGTGGCTGCCAAAAATCAGAGCTTGGAGGGGGATA
CAACAAAGGGGACTTCAGAAATGTCAGAGAAGAGAGGACCTACTTCCAGCAACCCCAGAAAGAGACATCGGGAAGATTCTGATGTGGAAA
TGGTGGAAGATGATTCCCGAAAGGAAATGACTGCAGCTTGTACCCCCCGGAGAAGGATCATTAACCTCACTAGTGTTTTGAGTCTCCAGG
AAGAAATTAATGAGCAGGGACATGAGGTTCTCCGGGAGATGTTGCATAACCACTCCTTCGTGGGCTGTGTGAATCCTCAGTGGGCCTTGG
CACAGCATCAAACCAAGTTATACCTTCTCAACACCACCAAGCTTAGTGAAGAACTGTTCTACCAGATACTCATTTATGATTTTGCCAATT
TTGGTGTTCTCAGGTTATCGGAGCCAGCACCGCTCTTTGACCTTGCCATGCTTGCCTTAGATAGTCCAGAGAGTGGCTGGACAGAGGAAG
ATGGTCCCAAAGAAGGACTTGCTGAATACATTGTTGAGTTTCTGAAGAAGAAGGCTGAGATGCTTGCAGACTATTTCTCTTTGGAAATTG
ATGAGGAAGGGAACCTGATTGGATTACCCCTTCTGATTGACAACTATGTGCCCCCTTTGGAGGGACTGCCTATCTTCATTCTTCGACTAG
CCACTGAGGTGAATTGGGACGAAGAAAAGGAATGTTTTGAAAGCCTCAGTAAAGAATGCGCTATGTTCTATTCCATCCGGAAGCAGTACA
TATCTGAGGAGTCGACCCTCTCAGGCCAGCAGAGTGAAGTGCCTGGCTCCATTCCAAACTCCTGGAAGTGGACTGTGGAACACATTGTCT
ATAAAGCCTTGCGCTCACACATTCTGCCTCCTAAACATTTCACAGAAGATGGAAATATCCTGCAGCTTGCTAACCTGCCTGATCTATACA
AAGTCTTTGAGAGGTGTTAAATATGGTTATTTATGCACTGTGGGATGTGTTCTTCTTTCTCTGTATTCCGATACAAAGTGTTGTATCAAA
GTGTGATATACAAAGTGTACCAACATAAGTGTTGGTAGCACTTAAGACTTATACTTGCCTTCTGATAGTATTCCTTTATACACAGTGGAT


Top

FusionGenePPI for GOLGA4_MLH1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GOLGA4ARL1, ARL3, TRAF3IP1, EXOC1, TNIK, APP, TP63, NOL11, ZER1, SMYD2, LIMD1, CIRH1A, UBR7, HNRNPD, VHL, GEMIN5, TMEM63B, VWA9, PPM1H, PTPRN2, CCDC53, RALBP1, BMP1, NECAB2, TKT, ATP5G3, SERPINB5MLH1AP2B1, TRIM29, ZC3H11A, FRMD6, UBOX5, BLM, ATM, BRCA1, MRE11A, MSH2, MSH6, NBN, RAD50, RFC1, MYC, PMS2, MLH3, PMS1, MSH4, EXO1, MBD4, BRIP1, MSH3, SMC1A, XRN1, PSD3, UBC, UBAP2L, YLPM1, PRKDC, KPNA2, KPNB1, RUVBL1, RUVBL2, FAN1, PPP2R1A, PPP2R2A, PPP2R2B, PPP3CB, PPP3CC, PPP2R2D, AIFM1, PIK3C2A, AMOT, ATAD3A, DOCK7, PYGB, ATP5A1, ATAD3B, WDR61, BARD1, BACH1, FANCD2, POLH, SPRTN, DDX47, TRIM23, PARP12, RAD23B, RAPGEFL1, ANXA6, ARAF, CAPN5, CTSB, GABARAP, MAP2K6, NDRG1, PTPRH, STAP2, TXN2, ZER1, FLNB, ACTG1, ACTG2, ANXA2, CKAP4, DES, MYL6, PARVA, SPTAN1, TMSB4X, FBXO32, SQSTM1, EIF2A, EEF1G, EEF2, NT5C3B, APRT, LGALS4, MUC2, IGKC, FCGBP, ABHD16A, ABCC3, AGR2, ALDOA, ASS1, ELP6, CAB39L, CKB, EXOC3, GSTP1, ACER3, PTGDS, SEC61A1, SELENBP1, SERPINF1, VAMP8, PCNA, MMS19, TXN, ATF2, ORC4, MYOG, PSMA1, CXorf57, SPERT, API5, SPTBN2, USP5, ZNF224, NTRK1, CAPZA2, LYST, CTTN, HDLBP, SLC25A1, PSMD6, FKBP8, INO80, PLXNA3, ELMO2, NANP, CASP3, SNW1, AES, CCDC33, CDCA7L, CEP76, KIAA1377, LY96, MAGEA8, ZBED1, HDAC6, MCM9, MCM8


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneGOLGA4chr3:37343823chr3:37058997ENST00000356847+1123133_2034332244MACF1
HgeneGOLGA4chr3:37343823chr3:37058997ENST00000361924+1024133_2034112306MACF1
TgeneMLH1chr3:37343823chr3:37058997ENST00000231790+819410_650263757EXO1
TgeneMLH1chr3:37343823chr3:37058997ENST00000435176+819410_650165659EXO1
TgeneMLH1chr3:37343823chr3:37058997ENST00000455445+819410_65022516EXO1
TgeneMLH1chr3:37343823chr3:37058997ENST00000458205+920410_65022516EXO1
TgeneMLH1chr3:37343823chr3:37058997ENST00000539477+718410_65022516EXO1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GOLGA4_MLH1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GOLGA4_MLH1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGOLGA4C0033578Prostatic Neoplasms1CTD_human
HgeneGOLGA4C0037274Dermatologic disorders1CTD_human
HgeneGOLGA4C0311375Arsenic Poisoning1CTD_human
TgeneMLH1C1333991Hereditary Non-Polyposis Colon Cancer Type 252CTD_human;UNIPROT
TgeneMLH1C1527249Colorectal Cancer6UNIPROT
TgeneMLH1C0009405Hereditary Nonpolyposis Colorectal Neoplasms5CTD_human
TgeneMLH1C0009404Colorectal Neoplasms3CTD_human
TgeneMLH1C0265325Turcot syndrome (disorder)2CTD_human;ORPHANET;UNIPROT
TgeneMLH1C0009375Colonic Neoplasms1CTD_human
TgeneMLH1C0024299Lymphoma1CTD_human;HPO
TgeneMLH1C0027627Neoplasm Metastasis1CTD_human
TgeneMLH1C0033578Prostatic Neoplasms1CTD_human
TgeneMLH1C0919267ovarian neoplasm1CTD_human