FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14889

FusionGeneSummary for GNAS_SMAP2

check button Fusion gene summary
Fusion gene informationFusion gene name: GNAS_SMAP2
Fusion gene ID: 14889
HgeneTgene
Gene symbol

GNAS

SMAP2

Gene ID

2778

64744

Gene nameGNAS complex locussmall ArfGAP2
SynonymsAHO|C20orf45|GNAS1|GPSA|GSA|GSP|NESP|PITA3|POH|SCG6|SgVISMAP1L
Cytomap

20q13.32

1p34.2

Type of geneprotein-codingprotein-coding
Descriptionprotein ALEXprotein GNASprotein SCG6 (secretogranin VI)G protein subunit alpha Sadenylate cyclase-stimulating G alpha proteinalternative gene product encoded by XL-exonextra large alphas proteinguanine nucleotide binding protein (G protein), alpha stromal membrane-associated protein 2stromal membrane-associated GTPase-activating protein 2
Modification date2018052320180522
UniProtAcc

Q5JWF2

Q8WU79

Ensembl transtripts involved in fusion geneENST00000313949, ENST00000371098, 
ENST00000371075, ENST00000371100, 
ENST00000371099, ENST00000371102, 
ENST00000464624, ENST00000306120, 
ENST00000371095, ENST00000371085, 
ENST00000354359, ENST00000265620, 
ENST00000306090, ENST00000371081, 
ENST00000539317, ENST00000487871, 
Fusion gene scores* DoF score34 X 18 X 17=104045 X 5 X 3=75
# samples 465
** MAII scorelog2(46/10404*10)=-4.49936063299862
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: GNAS [Title/Abstract] AND SMAP2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-H7-7774-01AGNASchr20

57486241

+SMAP2chr1

40878688

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000313949ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
5CDS-intronENST00000313949ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+
intron-3CDSENST00000371098ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
intron-intronENST00000371098ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+
Frame-shitENST00000371075ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
5CDS-intronENST00000371075ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+
In-frameENST00000371100ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
5CDS-intronENST00000371100ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+
intron-3CDSENST00000371099ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
intron-intronENST00000371099ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+
In-frameENST00000371102ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
5CDS-intronENST00000371102ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+
Frame-shitENST00000464624ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
5CDS-intronENST00000464624ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+
intron-3CDSENST00000306120ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
intron-intronENST00000306120ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+
In-frameENST00000371095ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
5CDS-intronENST00000371095ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+
In-frameENST00000371085ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
5CDS-intronENST00000371085ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+
In-frameENST00000354359ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
5CDS-intronENST00000354359ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+
In-frameENST00000265620ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
5CDS-intronENST00000265620ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+
In-frameENST00000306090ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
5CDS-intronENST00000306090ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+
intron-3CDSENST00000371081ENST00000539317GNASchr20

57486241

+SMAP2chr1

40878688

+
intron-intronENST00000371081ENST00000487871GNASchr20

57486241

+SMAP2chr1

40878688

+

Top

FusionProtFeatures for GNAS_SMAP2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GNAS

Q5JWF2

SMAP2

Q8WU79

Guanine nucleotide-binding proteins (G proteins)function as transducers in numerous signaling pathways controlledby G protein-coupled receptors (GPCRs). Signaling involves theactivation of adenylyl cyclases, resulting in increased levels ofthe signaling molecule cAMP. GNAS functions downstream of severalGPCRs, including beta-adrenergic receptors. XLas isoforms interactwith the same set of receptors as GNAS isoforms (By similarity).{ECO:0000250|UniProtKB:Q6R0H7}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for GNAS_SMAP2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GNAS_ENST00000371100_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_1455aa
MGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGA
HGSYSPPPEEAMPFEAEQPSLGGFWPTLEQPGFPSGVHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRGCSQLLLQ
VPDLAPGGPGAAGVPGAPPEEPQALRPAKAGSRGGYSPPPEETMPFELDGEGFGDDSPPPGLSRVIAQVDGSSQFAAVAASSAVRLTPAA
NAPPLWVPGAIGSPSQEAVRPPSNFTGSSPWMEISGPPFEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAE
MEGAADAAEGGKVPSPGYGSPAAGAASADTAARAAPAAPADPDSGATPEDPDSGTAPADPDSGAFAADPDSGAAPAAPADPDSGAAPDAP
ADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQAADP
PTPRPTRASAWRGKSESSRGRRVYYDEGVASSDDDSSGDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQPKA
SRSLKVKKVPLAEKRRQMRKEALEKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDP
QAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSN
EYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVI
REDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLR
ISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPE
XFCETPFSLQLAXMFQIXKAXGGLQKKEKRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKEKEKDDKWKRGS
EPVPEKKLEPVVFEKVKMPQKKEDPQLPRKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTA
GSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPG
ASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQAGYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGN

>In-frame_GNAS_ENST00000371102_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_1441aa
MGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGA
HGSYSPPPEEAMPFEAEQPSLGGFWPTLEQPGFPSGVHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRGCSQLLLQ
VPDLAPGGPGAAGVPGAPPEEPQALRPAKAGSRGGYSPPPEETMPFELDGEGFGDDSPPPGLSRVIAQVDGSSQFAAVAASSAVRLTPAA
NAPPLWVPGAIGSPSQEAVRPPSNFTGSSPWMEISGPPFEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAE
MEGAADAAEGGKVPSPGYGSPAAGAASADTAARAAPAAPADPDSGATPEDPDSGTAPADPDSGAFAADPDSGAAPAAPADPDSGAAPDAP
ADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQAADP
PTPRPTRASAWRGKSESSRGRRVYYDEGVASSDDDSSGDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQPKA
SRSLKVKKVPLAEKRRQMRKEALEKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGDSEKATK
VQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDK
IDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALN
LFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYP
HFTCAVDTENIRRVFNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPEXFCETPFSLQLAXM
FQIXKAXGGLQKKEKRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKEKEKDDKWKRGSEPVPEKKLEPVVFE
KVKMPQKKEDPQLPRKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTAGSAGSVPENLNLFP
EPGSKSEEIGKKQLSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPAGY
MGGMQASMMGVPNGMMTTQQAGYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAANQTLSPQMWK

>In-frame_GNAS_ENST00000371095_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_798aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIE
TIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSD
QDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRT
ISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRR
VFNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPEXFCETPFSLQLAXMFQIXKAXGGLQKK
EKRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKEKEKDDKWKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQL
PRKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQ
LSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPAGYMGGMQASMMGVPN

>In-frame_GNAS_ENST00000371085_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_812aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKAT
KVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLD
KIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEAL
NLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY
PHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPEXFCETPFSLQLAX
MFQIXKAXGGLQKKEKRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKEKEKDDKWKRGSEPVPEKKLEPVVF
EKVKMPQKKEDPQLPRKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTAGSAGSVPENLNLF
PEPGSKSEEIGKKQLSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPAG
YMGGMQASMMGVPNGMMTTQQAGYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAANQTLSPQMW

>In-frame_GNAS_ENST00000354359_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_813aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGSEKA
TKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFL
DKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEA
LNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYC
YPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPEXFCETPFSLQLA
XMFQIXKAXGGLQKKEKRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKEKEKDDKWKRGSEPVPEKKLEPVV
FEKVKMPQKKEDPQLPRKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTAGSAGSVPENLNL
FPEPGSKSEEIGKKQLSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPA
GYMGGMQASMMGVPNGMMTTQQAGYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAANQTLSPQM

>In-frame_GNAS_ENST00000265620_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_797aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGDEKATKVQDIKNNLKEAIET
IVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQ
DLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTI
SVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRV
FNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPEXFCETPFSLQLAXMFQIXKAXGGLQKKE
KRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKEKEKDDKWKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLP
RKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQL
SKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPAGYMGGMQASMMGVPNG

>In-frame_GNAS_ENST00000306090_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_796aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIE
TIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSD
QDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRT
ISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRR
VFNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPEXFCETPFSLQLAXMFQIXKAXGGLQKK
EKRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKEKDDKWKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLPR
KSSPKSTAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLS
KDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPAGYMGGMQASMMGVPNGM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GNAS_ENST00000371100_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_4365nt
ATGGGCGTGCGCAACTGCCTCTACGGCAATAATATGTCAGGACAACGCGATATCCCCCCTGAAATCGGGGAACAGCCCGAGCAACCACCT
TTGGAGGCCCCAGGGGCAGCTGCCCCCGGTGCTGGGCCTAGCCCAGCCGAAGAGATGGAGACCGAACCGCCTCACAACGAGCCCATCCCC
GTCGAGAATGATGGCGAGGCCTGTGGACCCCCAGAGGTCTCCAGACCCAACTTTCAGGTCCTCAACCCGGCATTCAGGGAAGCTGGAGCC
CATGGAAGCTACAGCCCACCTCCTGAGGAAGCAATGCCCTTCGAGGCTGAACAGCCCAGCTTGGGAGGCTTCTGGCCTACACTGGAGCAG
CCTGGATTCCCCAGTGGGGTCCATGCAGGCCTTGAGGCCTTCGGCCCAGCACTCATGGAGCCCGGAGCCTTCAGTGGTGCCAGACCAGGC
CTGGGAGGATACAGCCCTCCACCAGAAGAAGCTATGCCCTTTGAGTTTGACCAGCCTGCCCAGAGAGGCTGCAGTCAACTTCTCTTACAG
GTCCCAGACCTTGCTCCAGGAGGCCCAGGTGCTGCAGGGGTCCCCGGAGCTCCTCCCGAGGAGCCCCAAGCCCTCAGGCCTGCAAAGGCT
GGCTCCAGAGGAGGCTACAGCCCTCCCCCTGAGGAGACTATGCCATTTGAGCTTGATGGAGAAGGATTTGGGGACGACAGCCCACCCCCG
GGGCTTTCCCGAGTTATCGCACAAGTCGACGGCAGCAGCCAGTTCGCGGCAGTCGCGGCCTCGAGTGCGGTCCGCCTCACTCCCGCCGCG
AACGCGCCTCCCCTCTGGGTCCCAGGCGCCATCGGCAGCCCATCCCAAGAGGCTGTCAGACCTCCTTCTAACTTCACGGGCAGCAGCCCC
TGGATGGAGATCTCCGGACCCCCGTTCGAGATTGGCAGCGCCCCCGCTGGGGTCGACGACACTCCCGTCAACATGGACAGCCCCCCAATC
GCGCTTGACGGCCCGCCCATCAAGGTCTCCGGAGCCCCAGATAAGAGAGAGCGAGCAGAGAGACCCCCAGTTGAGGAGGAAGCAGCAGAG
ATGGAAGGAGCCGCTGATGCCGCGGAGGGAGGAAAAGTACCCTCTCCGGGGTACGGATCCCCTGCCGCCGGGGCAGCCTCAGCGGATACC
GCTGCCAGGGCAGCCCCTGCAGCCCCAGCCGATCCTGACTCCGGGGCAACCCCAGAAGATCCCGACTCCGGGACAGCACCAGCCGATCCT
GACTCCGGGGCATTCGCAGCCGATCCCGACTCCGGGGCAGCCCCTGCCGCCCCAGCCGATCCCGACTCCGGGGCGGCCCCTGACGCCCCA
GCCGATCCCGACTCCGGGGCGGCCCCTGACGCCCCAGCCGATCCAGATGCCGGGGCGGCCCCTGAGGCTCCCGCCGCCCCTGCGGCTGCT
GAGACCCGGGCAGCCCATGTCGCCCCAGCTGCGCCAGACGCAGGGGCTCCCACTGCCCCAGCCGCTTCTGCCACCCGGGCAGCCCAAGTC
CGCCGGGCGGCCTCTGCAGCCCCTGCCTCCGGGGCCAGACGCAAGATCCATCTCAGACCCCCCAGCCCCGAGATCCAGGCTGCCGATCCG
CCTACTCCGCGGCCTACTCGCGCGTCTGCCTGGCGGGGCAAGTCCGAGAGCAGCCGCGGCCGCCGCGTGTACTACGATGAAGGGGTGGCC
AGCAGCGACGATGACTCCAGCGGAGACGAGTCCGACGATGGGACCTCCGGATGCCTCCGCTGGTTTCAGCATCGGCGAAATCGCCGCCGC
CGAAAGCCCCAGCGCAACTTACTCCGCAACTTTCTCGTGCAAGCCTTCGGGGGCTGCTTCGGTCGATCTGAGAGTCCCCAGCCCAAAGCC
TCGCGCTCTCTCAAGGTCAAGAAGGTACCCCTGGCGGAGAAGCGCAGACAGATGCGCAAAGAAGCCCTGGAGAAGCGGGCCCAGAAGCGC
GCAGAGAAGAAACGCAGTAAGCTCATCGACAAACAACTCCAGGACGAAAAGATGGGCTACATGTGTACGCACCGCCTGCTGCTTCTAGGT
GCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAATGGAGAGGGCGGCGAAGAGGACCCG
CAGGCTGCAAGGAGCAACAGCGATGGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTG
GCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTG
CCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAAC
GAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTG
CTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAG
CGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATC
CGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTG
ATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGC
TACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGG
ATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAAC
GACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCA
CAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAG
TGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGG
CCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAA
TATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAAAGATGACAAGTGGAAAAGAGGGAGC
GAACCAGTTCCAGAAAAAAAATTGGAACCTGTTGTTTTTGAGAAGGTGAAAATGCCACAGAAAAAAGAAGACCCACAGCTACCTCGGAAA
AGCTCCCCGAAATCCACAGCGCCTGTCATGGATTTGTTGGGCCTTGATGCTCCTGTGGCCTGCTCCATTGCAAATAGTAAGACCAGCAAT
ACCCTAGAGAAGGATTTAGATCTGTTGGCCTCTGTTCCATCCCCTTCTTCTTCCGGTTCCAGAAAGGTTGTAGGTTCCATGCCAACTGCA
GGGAGTGCCGGCTCTGTTCCTGAAAATCTGAACCTGTTTCCGGAGCCAGGGAGCAAATCAGAAGAAATAGGCAAGAAACAGCTCTCTAAA
GACTCCATTCTTTCACTGTATGGATCCCAGACGCCTCAAATGCCTACTCAAGCAATGTTCATGGCTCCCGCTCAGATGGCATATCCCACA
GCCTACCCCAGCTTCCCCGGGGTTACACCTCCTAACAGCATAATGGGGAGCATGATGCCTCCACCAGTAGGCATGGTTGCTCAGCCAGGA
GCTTCTGGGATGGTTGCCCCCATGGCCATGCCTGCAGGCTATATGGGTGGCATGCAGGCATCAATGATGGGTGTGCCGAATGGAATGATG
ACCACCCAGCAGGCTGGCTACATGGCAGGCATGGCAGCTATGCCCCAGACTGTGTATGGGGTCCAGCCAGCTCAGCAGCTGCAATGGAAC
CTTACTCAGATGACCCAGCAGATGGCTGGGATGAACTTCTATGGAGCCAATGGCATGATGAACTATGGACAGTCAATGAGTGGCGGAAAT

>In-frame_GNAS_ENST00000371102_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_4323nt
ATGGGCGTGCGCAACTGCCTCTACGGCAATAATATGTCAGGACAACGCGATATCCCCCCTGAAATCGGGGAACAGCCCGAGCAACCACCT
TTGGAGGCCCCAGGGGCAGCTGCCCCCGGTGCTGGGCCTAGCCCAGCCGAAGAGATGGAGACCGAACCGCCTCACAACGAGCCCATCCCC
GTCGAGAATGATGGCGAGGCCTGTGGACCCCCAGAGGTCTCCAGACCCAACTTTCAGGTCCTCAACCCGGCATTCAGGGAAGCTGGAGCC
CATGGAAGCTACAGCCCACCTCCTGAGGAAGCAATGCCCTTCGAGGCTGAACAGCCCAGCTTGGGAGGCTTCTGGCCTACACTGGAGCAG
CCTGGATTCCCCAGTGGGGTCCATGCAGGCCTTGAGGCCTTCGGCCCAGCACTCATGGAGCCCGGAGCCTTCAGTGGTGCCAGACCAGGC
CTGGGAGGATACAGCCCTCCACCAGAAGAAGCTATGCCCTTTGAGTTTGACCAGCCTGCCCAGAGAGGCTGCAGTCAACTTCTCTTACAG
GTCCCAGACCTTGCTCCAGGAGGCCCAGGTGCTGCAGGGGTCCCCGGAGCTCCTCCCGAGGAGCCCCAAGCCCTCAGGCCTGCAAAGGCT
GGCTCCAGAGGAGGCTACAGCCCTCCCCCTGAGGAGACTATGCCATTTGAGCTTGATGGAGAAGGATTTGGGGACGACAGCCCACCCCCG
GGGCTTTCCCGAGTTATCGCACAAGTCGACGGCAGCAGCCAGTTCGCGGCAGTCGCGGCCTCGAGTGCGGTCCGCCTCACTCCCGCCGCG
AACGCGCCTCCCCTCTGGGTCCCAGGCGCCATCGGCAGCCCATCCCAAGAGGCTGTCAGACCTCCTTCTAACTTCACGGGCAGCAGCCCC
TGGATGGAGATCTCCGGACCCCCGTTCGAGATTGGCAGCGCCCCCGCTGGGGTCGACGACACTCCCGTCAACATGGACAGCCCCCCAATC
GCGCTTGACGGCCCGCCCATCAAGGTCTCCGGAGCCCCAGATAAGAGAGAGCGAGCAGAGAGACCCCCAGTTGAGGAGGAAGCAGCAGAG
ATGGAAGGAGCCGCTGATGCCGCGGAGGGAGGAAAAGTACCCTCTCCGGGGTACGGATCCCCTGCCGCCGGGGCAGCCTCAGCGGATACC
GCTGCCAGGGCAGCCCCTGCAGCCCCAGCCGATCCTGACTCCGGGGCAACCCCAGAAGATCCCGACTCCGGGACAGCACCAGCCGATCCT
GACTCCGGGGCATTCGCAGCCGATCCCGACTCCGGGGCAGCCCCTGCCGCCCCAGCCGATCCCGACTCCGGGGCGGCCCCTGACGCCCCA
GCCGATCCCGACTCCGGGGCGGCCCCTGACGCCCCAGCCGATCCAGATGCCGGGGCGGCCCCTGAGGCTCCCGCCGCCCCTGCGGCTGCT
GAGACCCGGGCAGCCCATGTCGCCCCAGCTGCGCCAGACGCAGGGGCTCCCACTGCCCCAGCCGCTTCTGCCACCCGGGCAGCCCAAGTC
CGCCGGGCGGCCTCTGCAGCCCCTGCCTCCGGGGCCAGACGCAAGATCCATCTCAGACCCCCCAGCCCCGAGATCCAGGCTGCCGATCCG
CCTACTCCGCGGCCTACTCGCGCGTCTGCCTGGCGGGGCAAGTCCGAGAGCAGCCGCGGCCGCCGCGTGTACTACGATGAAGGGGTGGCC
AGCAGCGACGATGACTCCAGCGGAGACGAGTCCGACGATGGGACCTCCGGATGCCTCCGCTGGTTTCAGCATCGGCGAAATCGCCGCCGC
CGAAAGCCCCAGCGCAACTTACTCCGCAACTTTCTCGTGCAAGCCTTCGGGGGCTGCTTCGGTCGATCTGAGAGTCCCCAGCCCAAAGCC
TCGCGCTCTCTCAAGGTCAAGAAGGTACCCCTGGCGGAGAAGCGCAGACAGATGCGCAAAGAAGCCCTGGAGAAGCGGGCCCAGAAGCGC
GCAGAGAAGAAACGCAGTAAGCTCATCGACAAACAACTCCAGGACGAAAAGATGGGCTACATGTGTACGCACCGCCTGCTGCTTCTAGGT
GCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAATGGAGACAGTGAGAAGGCAACCAAA
GTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAAC
CCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAG
GCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAG
ATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAG
TTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTG
ACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAAC
CTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTC
CTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGAC
CCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCT
CATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTAC
GAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATC
ACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATG
TTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAAC
AGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTA
AATGTGAGCAAAGAAAAAGAAAAAGATGACAAGTGGAAAAGAGGGAGCGAACCAGTTCCAGAAAAAAAATTGGAACCTGTTGTTTTTGAG
AAGGTGAAAATGCCACAGAAAAAAGAAGACCCACAGCTACCTCGGAAAAGCTCCCCGAAATCCACAGCGCCTGTCATGGATTTGTTGGGC
CTTGATGCTCCTGTGGCCTGCTCCATTGCAAATAGTAAGACCAGCAATACCCTAGAGAAGGATTTAGATCTGTTGGCCTCTGTTCCATCC
CCTTCTTCTTCCGGTTCCAGAAAGGTTGTAGGTTCCATGCCAACTGCAGGGAGTGCCGGCTCTGTTCCTGAAAATCTGAACCTGTTTCCG
GAGCCAGGGAGCAAATCAGAAGAAATAGGCAAGAAACAGCTCTCTAAAGACTCCATTCTTTCACTGTATGGATCCCAGACGCCTCAAATG
CCTACTCAAGCAATGTTCATGGCTCCCGCTCAGATGGCATATCCCACAGCCTACCCCAGCTTCCCCGGGGTTACACCTCCTAACAGCATA
ATGGGGAGCATGATGCCTCCACCAGTAGGCATGGTTGCTCAGCCAGGAGCTTCTGGGATGGTTGCCCCCATGGCCATGCCTGCAGGCTAT
ATGGGTGGCATGCAGGCATCAATGATGGGTGTGCCGAATGGAATGATGACCACCCAGCAGGCTGGCTACATGGCAGGCATGGCAGCTATG
CCCCAGACTGTGTATGGGGTCCAGCCAGCTCAGCAGCTGCAATGGAACCTTACTCAGATGACCCAGCAGATGGCTGGGATGAACTTCTAT
GGAGCCAATGGCATGATGAACTATGGACAGTCAATGAGTGGCGGAAATGGACAGGCAGCAAATCAGACTCTCAGTCCTCAGATGTGGAAA

>In-frame_GNAS_ENST00000371095_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_2394nt
ATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTG
CAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATG
AGGATCCTGCATGTTAATGGGTTTAATGGAGACAGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAA
ACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTG
ATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAA
CGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGAT
CAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTG
GGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAAC
ATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACC
ATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAA
TTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAG
TTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGT
GTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAG
CCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCT
TCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAG
GAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAA
TGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAAAGATGACAAGTGGAAA
AGAGGGAGCGAACCAGTTCCAGAAAAAAAATTGGAACCTGTTGTTTTTGAGAAGGTGAAAATGCCACAGAAAAAAGAAGACCCACAGCTA
CCTCGGAAAAGCTCCCCGAAATCCACAGCGCCTGTCATGGATTTGTTGGGCCTTGATGCTCCTGTGGCCTGCTCCATTGCAAATAGTAAG
ACCAGCAATACCCTAGAGAAGGATTTAGATCTGTTGGCCTCTGTTCCATCCCCTTCTTCTTCCGGTTCCAGAAAGGTTGTAGGTTCCATG
CCAACTGCAGGGAGTGCCGGCTCTGTTCCTGAAAATCTGAACCTGTTTCCGGAGCCAGGGAGCAAATCAGAAGAAATAGGCAAGAAACAG
CTCTCTAAAGACTCCATTCTTTCACTGTATGGATCCCAGACGCCTCAAATGCCTACTCAAGCAATGTTCATGGCTCCCGCTCAGATGGCA
TATCCCACAGCCTACCCCAGCTTCCCCGGGGTTACACCTCCTAACAGCATAATGGGGAGCATGATGCCTCCACCAGTAGGCATGGTTGCT
CAGCCAGGAGCTTCTGGGATGGTTGCCCCCATGGCCATGCCTGCAGGCTATATGGGTGGCATGCAGGCATCAATGATGGGTGTGCCGAAT
GGAATGATGACCACCCAGCAGGCTGGCTACATGGCAGGCATGGCAGCTATGCCCCAGACTGTGTATGGGGTCCAGCCAGCTCAGCAGCTG
CAATGGAACCTTACTCAGATGACCCAGCAGATGGCTGGGATGAACTTCTATGGAGCCAATGGCATGATGAACTATGGACAGTCAATGAGT

>In-frame_GNAS_ENST00000371085_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_2436nt
ATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTG
CAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATG
AGGATCCTGCATGTTAATGGGTTTAATGGAGAGGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGGTGAGAAGGCAACC
AAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCC
AACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCC
AAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGAC
AAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACC
AAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGAT
GTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTG
AACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAA
GTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAG
GACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTAC
CCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAG
TACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTA
ATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAG
ATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAA
AACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAA
TTAAATGTGAGCAAAGAAAAAGAAAAAGATGACAAGTGGAAAAGAGGGAGCGAACCAGTTCCAGAAAAAAAATTGGAACCTGTTGTTTTT
GAGAAGGTGAAAATGCCACAGAAAAAAGAAGACCCACAGCTACCTCGGAAAAGCTCCCCGAAATCCACAGCGCCTGTCATGGATTTGTTG
GGCCTTGATGCTCCTGTGGCCTGCTCCATTGCAAATAGTAAGACCAGCAATACCCTAGAGAAGGATTTAGATCTGTTGGCCTCTGTTCCA
TCCCCTTCTTCTTCCGGTTCCAGAAAGGTTGTAGGTTCCATGCCAACTGCAGGGAGTGCCGGCTCTGTTCCTGAAAATCTGAACCTGTTT
CCGGAGCCAGGGAGCAAATCAGAAGAAATAGGCAAGAAACAGCTCTCTAAAGACTCCATTCTTTCACTGTATGGATCCCAGACGCCTCAA
ATGCCTACTCAAGCAATGTTCATGGCTCCCGCTCAGATGGCATATCCCACAGCCTACCCCAGCTTCCCCGGGGTTACACCTCCTAACAGC
ATAATGGGGAGCATGATGCCTCCACCAGTAGGCATGGTTGCTCAGCCAGGAGCTTCTGGGATGGTTGCCCCCATGGCCATGCCTGCAGGC
TATATGGGTGGCATGCAGGCATCAATGATGGGTGTGCCGAATGGAATGATGACCACCCAGCAGGCTGGCTACATGGCAGGCATGGCAGCT
ATGCCCCAGACTGTGTATGGGGTCCAGCCAGCTCAGCAGCTGCAATGGAACCTTACTCAGATGACCCAGCAGATGGCTGGGATGAACTTC
TATGGAGCCAATGGCATGATGAACTATGGACAGTCAATGAGTGGCGGAAATGGACAGGCAGCAAATCAGACTCTCAGTCCTCAGATGTGG

>In-frame_GNAS_ENST00000354359_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_2439nt
ATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTG
CAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATG
AGGATCCTGCATGTTAATGGGTTTAATGGAGAGGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGGCAGTGAGAAGGCA
ACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTG
GCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCAT
GCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTG
GACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAG
ACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAAC
GATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCT
CTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAG
AAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGA
GAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGC
TACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGT
CAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAG
TTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCT
TAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAA
TAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAA
AAATTAAATGTGAGCAAAGAAAAAGAAAAAGATGACAAGTGGAAAAGAGGGAGCGAACCAGTTCCAGAAAAAAAATTGGAACCTGTTGTT
TTTGAGAAGGTGAAAATGCCACAGAAAAAAGAAGACCCACAGCTACCTCGGAAAAGCTCCCCGAAATCCACAGCGCCTGTCATGGATTTG
TTGGGCCTTGATGCTCCTGTGGCCTGCTCCATTGCAAATAGTAAGACCAGCAATACCCTAGAGAAGGATTTAGATCTGTTGGCCTCTGTT
CCATCCCCTTCTTCTTCCGGTTCCAGAAAGGTTGTAGGTTCCATGCCAACTGCAGGGAGTGCCGGCTCTGTTCCTGAAAATCTGAACCTG
TTTCCGGAGCCAGGGAGCAAATCAGAAGAAATAGGCAAGAAACAGCTCTCTAAAGACTCCATTCTTTCACTGTATGGATCCCAGACGCCT
CAAATGCCTACTCAAGCAATGTTCATGGCTCCCGCTCAGATGGCATATCCCACAGCCTACCCCAGCTTCCCCGGGGTTACACCTCCTAAC
AGCATAATGGGGAGCATGATGCCTCCACCAGTAGGCATGGTTGCTCAGCCAGGAGCTTCTGGGATGGTTGCCCCCATGGCCATGCCTGCA
GGCTATATGGGTGGCATGCAGGCATCAATGATGGGTGTGCCGAATGGAATGATGACCACCCAGCAGGCTGGCTACATGGCAGGCATGGCA
GCTATGCCCCAGACTGTGTATGGGGTCCAGCCAGCTCAGCAGCTGCAATGGAACCTTACTCAGATGACCCAGCAGATGGCTGGGATGAAC
TTCTATGGAGCCAATGGCATGATGAACTATGGACAGTCAATGAGTGGCGGAAATGGACAGGCAGCAAATCAGACTCTCAGTCCTCAGATG

>In-frame_GNAS_ENST00000265620_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_2391nt
ATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTG
CAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATG
AGGATCCTGCATGTTAATGGGTTTAATGGAGATGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACC
ATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATG
AACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGC
TCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAG
GACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGT
GGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATG
GTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATC
TCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTT
GCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTT
CTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTG
TTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCT
TAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCC
CCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAA
AAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGA
AATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAAAGATGACAAGTGGAAAAGA
GGGAGCGAACCAGTTCCAGAAAAAAAATTGGAACCTGTTGTTTTTGAGAAGGTGAAAATGCCACAGAAAAAAGAAGACCCACAGCTACCT
CGGAAAAGCTCCCCGAAATCCACAGCGCCTGTCATGGATTTGTTGGGCCTTGATGCTCCTGTGGCCTGCTCCATTGCAAATAGTAAGACC
AGCAATACCCTAGAGAAGGATTTAGATCTGTTGGCCTCTGTTCCATCCCCTTCTTCTTCCGGTTCCAGAAAGGTTGTAGGTTCCATGCCA
ACTGCAGGGAGTGCCGGCTCTGTTCCTGAAAATCTGAACCTGTTTCCGGAGCCAGGGAGCAAATCAGAAGAAATAGGCAAGAAACAGCTC
TCTAAAGACTCCATTCTTTCACTGTATGGATCCCAGACGCCTCAAATGCCTACTCAAGCAATGTTCATGGCTCCCGCTCAGATGGCATAT
CCCACAGCCTACCCCAGCTTCCCCGGGGTTACACCTCCTAACAGCATAATGGGGAGCATGATGCCTCCACCAGTAGGCATGGTTGCTCAG
CCAGGAGCTTCTGGGATGGTTGCCCCCATGGCCATGCCTGCAGGCTATATGGGTGGCATGCAGGCATCAATGATGGGTGTGCCGAATGGA
ATGATGACCACCCAGCAGGCTGGCTACATGGCAGGCATGGCAGCTATGCCCCAGACTGTGTATGGGGTCCAGCCAGCTCAGCAGCTGCAA
TGGAACCTTACTCAGATGACCCAGCAGATGGCTGGGATGAACTTCTATGGAGCCAATGGCATGATGAACTATGGACAGTCAATGAGTGGC

>In-frame_GNAS_ENST00000306090_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_2388nt
ATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTG
CAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATG
AGGATCCTGCATGTTAATGGGTTTAATGGAGACAGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAA
ACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTG
ATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAA
CGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGAT
CAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTG
GGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAAC
ATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACC
ATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAA
TTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAG
TTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGT
GTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAG
CCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCT
TCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAG
GAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAA
TGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGATGACAAGTGGAAAAGAGGG
AGCGAACCAGTTCCAGAAAAAAAATTGGAACCTGTTGTTTTTGAGAAGGTGAAAATGCCACAGAAAAAAGAAGACCCACAGCTACCTCGG
AAAAGCTCCCCGAAATCCACAGCGCCTGTCATGGATTTGTTGGGCCTTGATGCTCCTGTGGCCTGCTCCATTGCAAATAGTAAGACCAGC
AATACCCTAGAGAAGGATTTAGATCTGTTGGCCTCTGTTCCATCCCCTTCTTCTTCCGGTTCCAGAAAGGTTGTAGGTTCCATGCCAACT
GCAGGGAGTGCCGGCTCTGTTCCTGAAAATCTGAACCTGTTTCCGGAGCCAGGGAGCAAATCAGAAGAAATAGGCAAGAAACAGCTCTCT
AAAGACTCCATTCTTTCACTGTATGGATCCCAGACGCCTCAAATGCCTACTCAAGCAATGTTCATGGCTCCCGCTCAGATGGCATATCCC
ACAGCCTACCCCAGCTTCCCCGGGGTTACACCTCCTAACAGCATAATGGGGAGCATGATGCCTCCACCAGTAGGCATGGTTGCTCAGCCA
GGAGCTTCTGGGATGGTTGCCCCCATGGCCATGCCTGCAGGCTATATGGGTGGCATGCAGGCATCAATGATGGGTGTGCCGAATGGAATG
ATGACCACCCAGCAGGCTGGCTACATGGCAGGCATGGCAGCTATGCCCCAGACTGTGTATGGGGTCCAGCCAGCTCAGCAGCTGCAATGG
AACCTTACTCAGATGACCCAGCAGATGGCTGGGATGAACTTCTATGGAGCCAATGGCATGATGAACTATGGACAGTCAATGAGTGGCGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_GNAS_ENST00000371100_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_5076nt
AAAGACTCCAAATCAGTCAGGGAGAGGAGTGGAAGGAGCCAAAACGTCCCTGCGAGGCCTGCGCTCACCAGCCCCCTTACCCAAAGTCCC
GGGCCCCTGGCGCCAGGAGCAGGCTCCTGGAGCCGGAGCCAGCTCGGCACTGGAACCGGCGTCCTCTGGTGGCAGAGAGAGAGCGCTACT
GGCGATTTTCGGACCGAATCGGCACGCTCGTCAGATCCAAGCAGGCGGGACTGGCCTGGAGCAAAAAGAAAGAGAGAGGAGGGCGTAAGG
ATAGACCAAGGAAGAGGGGCTGGGGGGCAGCCTGGGGGCATGAAAAGTGGCCAGGAAGGAGCCAAGACTCCACCAGCAACAATTGAGTTG
CTTCAGCCTCAGTCTAGGGTTCCTTCCAGGCCTTGAACCCCCCAACCTCACAAGGGTTGGAAAGTGAGGCCGGTGAACTTTCCAGCTGGT
ACTTTGATTTTAAAATAATAATAATAATTTTTTCACCCTAGTTCGGTTGGGTGCTCCATCTTACGGAGCCCCAAACTTATTTTGAGAGGC
CGCCACCGTGTTATGGGCGTGCGCAACTGCCTCTACGGCAATAATATGTCAGGACAACGCGATATCCCCCCTGAAATCGGGGAACAGCCC
GAGCAACCACCTTTGGAGGCCCCAGGGGCAGCTGCCCCCGGTGCTGGGCCTAGCCCAGCCGAAGAGATGGAGACCGAACCGCCTCACAAC
GAGCCCATCCCCGTCGAGAATGATGGCGAGGCCTGTGGACCCCCAGAGGTCTCCAGACCCAACTTTCAGGTCCTCAACCCGGCATTCAGG
GAAGCTGGAGCCCATGGAAGCTACAGCCCACCTCCTGAGGAAGCAATGCCCTTCGAGGCTGAACAGCCCAGCTTGGGAGGCTTCTGGCCT
ACACTGGAGCAGCCTGGATTCCCCAGTGGGGTCCATGCAGGCCTTGAGGCCTTCGGCCCAGCACTCATGGAGCCCGGAGCCTTCAGTGGT
GCCAGACCAGGCCTGGGAGGATACAGCCCTCCACCAGAAGAAGCTATGCCCTTTGAGTTTGACCAGCCTGCCCAGAGAGGCTGCAGTCAA
CTTCTCTTACAGGTCCCAGACCTTGCTCCAGGAGGCCCAGGTGCTGCAGGGGTCCCCGGAGCTCCTCCCGAGGAGCCCCAAGCCCTCAGG
CCTGCAAAGGCTGGCTCCAGAGGAGGCTACAGCCCTCCCCCTGAGGAGACTATGCCATTTGAGCTTGATGGAGAAGGATTTGGGGACGAC
AGCCCACCCCCGGGGCTTTCCCGAGTTATCGCACAAGTCGACGGCAGCAGCCAGTTCGCGGCAGTCGCGGCCTCGAGTGCGGTCCGCCTC
ACTCCCGCCGCGAACGCGCCTCCCCTCTGGGTCCCAGGCGCCATCGGCAGCCCATCCCAAGAGGCTGTCAGACCTCCTTCTAACTTCACG
GGCAGCAGCCCCTGGATGGAGATCTCCGGACCCCCGTTCGAGATTGGCAGCGCCCCCGCTGGGGTCGACGACACTCCCGTCAACATGGAC
AGCCCCCCAATCGCGCTTGACGGCCCGCCCATCAAGGTCTCCGGAGCCCCAGATAAGAGAGAGCGAGCAGAGAGACCCCCAGTTGAGGAG
GAAGCAGCAGAGATGGAAGGAGCCGCTGATGCCGCGGAGGGAGGAAAAGTACCCTCTCCGGGGTACGGATCCCCTGCCGCCGGGGCAGCC
TCAGCGGATACCGCTGCCAGGGCAGCCCCTGCAGCCCCAGCCGATCCTGACTCCGGGGCAACCCCAGAAGATCCCGACTCCGGGACAGCA
CCAGCCGATCCTGACTCCGGGGCATTCGCAGCCGATCCCGACTCCGGGGCAGCCCCTGCCGCCCCAGCCGATCCCGACTCCGGGGCGGCC
CCTGACGCCCCAGCCGATCCCGACTCCGGGGCGGCCCCTGACGCCCCAGCCGATCCAGATGCCGGGGCGGCCCCTGAGGCTCCCGCCGCC
CCTGCGGCTGCTGAGACCCGGGCAGCCCATGTCGCCCCAGCTGCGCCAGACGCAGGGGCTCCCACTGCCCCAGCCGCTTCTGCCACCCGG
GCAGCCCAAGTCCGCCGGGCGGCCTCTGCAGCCCCTGCCTCCGGGGCCAGACGCAAGATCCATCTCAGACCCCCCAGCCCCGAGATCCAG
GCTGCCGATCCGCCTACTCCGCGGCCTACTCGCGCGTCTGCCTGGCGGGGCAAGTCCGAGAGCAGCCGCGGCCGCCGCGTGTACTACGAT
GAAGGGGTGGCCAGCAGCGACGATGACTCCAGCGGAGACGAGTCCGACGATGGGACCTCCGGATGCCTCCGCTGGTTTCAGCATCGGCGA
AATCGCCGCCGCCGAAAGCCCCAGCGCAACTTACTCCGCAACTTTCTCGTGCAAGCCTTCGGGGGCTGCTTCGGTCGATCTGAGAGTCCC
CAGCCCAAAGCCTCGCGCTCTCTCAAGGTCAAGAAGGTACCCCTGGCGGAGAAGCGCAGACAGATGCGCAAAGAAGCCCTGGAGAAGCGG
GCCCAGAAGCGCGCAGAGAAGAAACGCAGTAAGCTCATCGACAAACAACTCCAGGACGAAAAGATGGGCTACATGTGTACGCACCGCCTG
CTGCTTCTAGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAATGGAGAGGGCGGC
GAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATT
GAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGT
GTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTAC
GAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGC
GATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGAC
GTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTAC
AACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGC
ACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCA
GAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGAT
GAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGC
CGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTA
AAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTC
CCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAA
AAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAAC
AAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAAAGATGACAAGTGG
AAAAGAGGGAGCGAACCAGTTCCAGAAAAAAAATTGGAACCTGTTGTTTTTGAGAAGGTGAAAATGCCACAGAAAAAAGAAGACCCACAG
CTACCTCGGAAAAGCTCCCCGAAATCCACAGCGCCTGTCATGGATTTGTTGGGCCTTGATGCTCCTGTGGCCTGCTCCATTGCAAATAGT
AAGACCAGCAATACCCTAGAGAAGGATTTAGATCTGTTGGCCTCTGTTCCATCCCCTTCTTCTTCCGGTTCCAGAAAGGTTGTAGGTTCC
ATGCCAACTGCAGGGAGTGCCGGCTCTGTTCCTGAAAATCTGAACCTGTTTCCGGAGCCAGGGAGCAAATCAGAAGAAATAGGCAAGAAA
CAGCTCTCTAAAGACTCCATTCTTTCACTGTATGGATCCCAGACGCCTCAAATGCCTACTCAAGCAATGTTCATGGCTCCCGCTCAGATG
GCATATCCCACAGCCTACCCCAGCTTCCCCGGGGTTACACCTCCTAACAGCATAATGGGGAGCATGATGCCTCCACCAGTAGGCATGGTT
GCTCAGCCAGGAGCTTCTGGGATGGTTGCCCCCATGGCCATGCCTGCAGGCTATATGGGTGGCATGCAGGCATCAATGATGGGTGTGCCG
AATGGAATGATGACCACCCAGCAGGCTGGCTACATGGCAGGCATGGCAGCTATGCCCCAGACTGTGTATGGGGTCCAGCCAGCTCAGCAG
CTGCAATGGAACCTTACTCAGATGACCCAGCAGATGGCTGGGATGAACTTCTATGGAGCCAATGGCATGATGAACTATGGACAGTCAATG
AGTGGCGGAAATGGACAGGCAGCAAATCAGACTCTCAGTCCTCAGATGTGGAAATAAAAACAAAACACCTGTATGGCTGCCATTCTCTTC
AGCCCTCGCTCTCCCCTTTCCACAGCCTCCACCCCTGACCCCCATCCTCTTTTCCTACCTCTCTGTTTGGTTTAGAAATTGCTCAATAAG

>In-frame_GNAS_ENST00000371102_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_4485nt
GTTATGGGCGTGCGCAACTGCCTCTACGGCAATAATATGTCAGGACAACGCGATATCCCCCCTGAAATCGGGGAACAGCCCGAGCAACCA
CCTTTGGAGGCCCCAGGGGCAGCTGCCCCCGGTGCTGGGCCTAGCCCAGCCGAAGAGATGGAGACCGAACCGCCTCACAACGAGCCCATC
CCCGTCGAGAATGATGGCGAGGCCTGTGGACCCCCAGAGGTCTCCAGACCCAACTTTCAGGTCCTCAACCCGGCATTCAGGGAAGCTGGA
GCCCATGGAAGCTACAGCCCACCTCCTGAGGAAGCAATGCCCTTCGAGGCTGAACAGCCCAGCTTGGGAGGCTTCTGGCCTACACTGGAG
CAGCCTGGATTCCCCAGTGGGGTCCATGCAGGCCTTGAGGCCTTCGGCCCAGCACTCATGGAGCCCGGAGCCTTCAGTGGTGCCAGACCA
GGCCTGGGAGGATACAGCCCTCCACCAGAAGAAGCTATGCCCTTTGAGTTTGACCAGCCTGCCCAGAGAGGCTGCAGTCAACTTCTCTTA
CAGGTCCCAGACCTTGCTCCAGGAGGCCCAGGTGCTGCAGGGGTCCCCGGAGCTCCTCCCGAGGAGCCCCAAGCCCTCAGGCCTGCAAAG
GCTGGCTCCAGAGGAGGCTACAGCCCTCCCCCTGAGGAGACTATGCCATTTGAGCTTGATGGAGAAGGATTTGGGGACGACAGCCCACCC
CCGGGGCTTTCCCGAGTTATCGCACAAGTCGACGGCAGCAGCCAGTTCGCGGCAGTCGCGGCCTCGAGTGCGGTCCGCCTCACTCCCGCC
GCGAACGCGCCTCCCCTCTGGGTCCCAGGCGCCATCGGCAGCCCATCCCAAGAGGCTGTCAGACCTCCTTCTAACTTCACGGGCAGCAGC
CCCTGGATGGAGATCTCCGGACCCCCGTTCGAGATTGGCAGCGCCCCCGCTGGGGTCGACGACACTCCCGTCAACATGGACAGCCCCCCA
ATCGCGCTTGACGGCCCGCCCATCAAGGTCTCCGGAGCCCCAGATAAGAGAGAGCGAGCAGAGAGACCCCCAGTTGAGGAGGAAGCAGCA
GAGATGGAAGGAGCCGCTGATGCCGCGGAGGGAGGAAAAGTACCCTCTCCGGGGTACGGATCCCCTGCCGCCGGGGCAGCCTCAGCGGAT
ACCGCTGCCAGGGCAGCCCCTGCAGCCCCAGCCGATCCTGACTCCGGGGCAACCCCAGAAGATCCCGACTCCGGGACAGCACCAGCCGAT
CCTGACTCCGGGGCATTCGCAGCCGATCCCGACTCCGGGGCAGCCCCTGCCGCCCCAGCCGATCCCGACTCCGGGGCGGCCCCTGACGCC
CCAGCCGATCCCGACTCCGGGGCGGCCCCTGACGCCCCAGCCGATCCAGATGCCGGGGCGGCCCCTGAGGCTCCCGCCGCCCCTGCGGCT
GCTGAGACCCGGGCAGCCCATGTCGCCCCAGCTGCGCCAGACGCAGGGGCTCCCACTGCCCCAGCCGCTTCTGCCACCCGGGCAGCCCAA
GTCCGCCGGGCGGCCTCTGCAGCCCCTGCCTCCGGGGCCAGACGCAAGATCCATCTCAGACCCCCCAGCCCCGAGATCCAGGCTGCCGAT
CCGCCTACTCCGCGGCCTACTCGCGCGTCTGCCTGGCGGGGCAAGTCCGAGAGCAGCCGCGGCCGCCGCGTGTACTACGATGAAGGGGTG
GCCAGCAGCGACGATGACTCCAGCGGAGACGAGTCCGACGATGGGACCTCCGGATGCCTCCGCTGGTTTCAGCATCGGCGAAATCGCCGC
CGCCGAAAGCCCCAGCGCAACTTACTCCGCAACTTTCTCGTGCAAGCCTTCGGGGGCTGCTTCGGTCGATCTGAGAGTCCCCAGCCCAAA
GCCTCGCGCTCTCTCAAGGTCAAGAAGGTACCCCTGGCGGAGAAGCGCAGACAGATGCGCAAAGAAGCCCTGGAGAAGCGGGCCCAGAAG
CGCGCAGAGAAGAAACGCAGTAAGCTCATCGACAAACAACTCCAGGACGAAAAGATGGGCTACATGTGTACGCACCGCCTGCTGCTTCTA
GGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAATGGAGACAGTGAGAAGGCAACC
AAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCC
AACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCC
AAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGAC
AAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACC
AAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGAT
GTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTG
AACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAA
GTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAG
GACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTAC
CCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAG
TACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTA
ATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAG
ATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAA
AACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAA
TTAAATGTGAGCAAAGAAAAAGAAAAAGATGACAAGTGGAAAAGAGGGAGCGAACCAGTTCCAGAAAAAAAATTGGAACCTGTTGTTTTT
GAGAAGGTGAAAATGCCACAGAAAAAAGAAGACCCACAGCTACCTCGGAAAAGCTCCCCGAAATCCACAGCGCCTGTCATGGATTTGTTG
GGCCTTGATGCTCCTGTGGCCTGCTCCATTGCAAATAGTAAGACCAGCAATACCCTAGAGAAGGATTTAGATCTGTTGGCCTCTGTTCCA
TCCCCTTCTTCTTCCGGTTCCAGAAAGGTTGTAGGTTCCATGCCAACTGCAGGGAGTGCCGGCTCTGTTCCTGAAAATCTGAACCTGTTT
CCGGAGCCAGGGAGCAAATCAGAAGAAATAGGCAAGAAACAGCTCTCTAAAGACTCCATTCTTTCACTGTATGGATCCCAGACGCCTCAA
ATGCCTACTCAAGCAATGTTCATGGCTCCCGCTCAGATGGCATATCCCACAGCCTACCCCAGCTTCCCCGGGGTTACACCTCCTAACAGC
ATAATGGGGAGCATGATGCCTCCACCAGTAGGCATGGTTGCTCAGCCAGGAGCTTCTGGGATGGTTGCCCCCATGGCCATGCCTGCAGGC
TATATGGGTGGCATGCAGGCATCAATGATGGGTGTGCCGAATGGAATGATGACCACCCAGCAGGCTGGCTACATGGCAGGCATGGCAGCT
ATGCCCCAGACTGTGTATGGGGTCCAGCCAGCTCAGCAGCTGCAATGGAACCTTACTCAGATGACCCAGCAGATGGCTGGGATGAACTTC
TATGGAGCCAATGGCATGATGAACTATGGACAGTCAATGAGTGGCGGAAATGGACAGGCAGCAAATCAGACTCTCAGTCCTCAGATGTGG
AAATAAAAACAAAACACCTGTATGGCTGCCATTCTCTTCAGCCCTCGCTCTCCCCTTTCCACAGCCTCCACCCCTGACCCCCATCCTCTT

>In-frame_GNAS_ENST00000371095_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_2978nt
CTCGCCGCCGCCGCCTCCTCCTCCCCCCGCCTCCCCCCGCCCGCCGCGGCGCTTTTGGCTCGGGGCGGCGGCGGGGGCCCGGCCGAGGCA
ATAAGAGCGGCGGCGGCGGCAGCGGCGGCAGCAGCTCCCGCAGCTCCTGCTCTGGTCCGCCTCGGCCCGGCGGCGGCCATCAGCCCCCTC
GGCCTCGGCTCGAGGGGCGGGGAGCTGCGCGCGCCCCTCGGTCCGACCGACACCCTCCCCTTCCCGCCCGTCCGCGCGCCCCGCGGCCCG
CGGCCCGCAGTCCGCCCCGCGCGCTCCTTGCCGAGGAGCCGAGCCCGCGCCCGGCCCGCCCGCCCGGCGCTGCCCCGGCCCTCCCGGCCC
GCGTGAGGCCGCCCGCGCCCGCCGCCGCCGCAGCCCGGCCGCGCCCCGCCGCCGCCGCCGCCGCCATGGGCTGCCTCGGGAACAGTAAGA
CCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTGCAGAAGGACAAGCAGGTCTACCGGG
CCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTA
ATGGAGACAGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACC
TGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCC
CTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTG
ACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCC
TGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCA
AGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGA
CCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACA
AGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGG
ATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTG
GAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCA
TTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTG
AAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCC
CCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTC
TCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGC
ATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAAAGATGACAAGTGGAAAAGAGGGAGCGAACCAGTTCCAGAAA
AAAAATTGGAACCTGTTGTTTTTGAGAAGGTGAAAATGCCACAGAAAAAAGAAGACCCACAGCTACCTCGGAAAAGCTCCCCGAAATCCA
CAGCGCCTGTCATGGATTTGTTGGGCCTTGATGCTCCTGTGGCCTGCTCCATTGCAAATAGTAAGACCAGCAATACCCTAGAGAAGGATT
TAGATCTGTTGGCCTCTGTTCCATCCCCTTCTTCTTCCGGTTCCAGAAAGGTTGTAGGTTCCATGCCAACTGCAGGGAGTGCCGGCTCTG
TTCCTGAAAATCTGAACCTGTTTCCGGAGCCAGGGAGCAAATCAGAAGAAATAGGCAAGAAACAGCTCTCTAAAGACTCCATTCTTTCAC
TGTATGGATCCCAGACGCCTCAAATGCCTACTCAAGCAATGTTCATGGCTCCCGCTCAGATGGCATATCCCACAGCCTACCCCAGCTTCC
CCGGGGTTACACCTCCTAACAGCATAATGGGGAGCATGATGCCTCCACCAGTAGGCATGGTTGCTCAGCCAGGAGCTTCTGGGATGGTTG
CCCCCATGGCCATGCCTGCAGGCTATATGGGTGGCATGCAGGCATCAATGATGGGTGTGCCGAATGGAATGATGACCACCCAGCAGGCTG
GCTACATGGCAGGCATGGCAGCTATGCCCCAGACTGTGTATGGGGTCCAGCCAGCTCAGCAGCTGCAATGGAACCTTACTCAGATGACCC
AGCAGATGGCTGGGATGAACTTCTATGGAGCCAATGGCATGATGAACTATGGACAGTCAATGAGTGGCGGAAATGGACAGGCAGCAAATC
AGACTCTCAGTCCTCAGATGTGGAAATAAAAACAAAACACCTGTATGGCTGCCATTCTCTTCAGCCCTCGCTCTCCCCTTTCCACAGCCT
CCACCCCTGACCCCCATCCTCTTTTCCTACCTCTCTGTTTGGTTTAGAAATTGCTCAATAAGTCATTTGGGGTTTGGCATCCTGCCCAGC

>In-frame_GNAS_ENST00000371085_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_3019nt
TCGCCGCCGCCGCCTCCTCCTCCCCCCGCCTCCCCCCGCCCGCCGCGGCGCTTTTGGCTCGGGGCGGCGGCGGGGGCCCGGCCGAGGCAA
TAAGAGCGGCGGCGGCGGCAGCGGCGGCAGCAGCTCCCGCAGCTCCTGCTCTGGTCCGCCTCGGCCCGGCGGCGGCCATCAGCCCCCTCG
GCCTCGGCTCGAGGGGCGGGGAGCTGCGCGCGCCCCTCGGTCCGACCGACACCCTCCCCTTCCCGCCCGTCCGCGCGCCCCGCGGCCCGC
GGCCCGCAGTCCGCCCCGCGCGCTCCTTGCCGAGGAGCCGAGCCCGCGCCCGGCCCGCCCGCCCGGCGCTGCCCCGGCCCTCCCGGCCCG
CGTGAGGCCGCCCGCGCCCGCCGCCGCCGCAGCCCGGCCGCGCCCCGCCGCCGCCGCCGCCGCCATGGGCTGCCTCGGGAACAGTAAGAC
CGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTGCAGAAGGACAAGCAGGTCTACCGGGC
CACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAA
TGGAGAGGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCT
GAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGA
CTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGT
GCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGA
CTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTT
CCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGC
CAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAA
CAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGA
GGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTA
CTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACAC
TGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCC
CCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAAC
AAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGG
CGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATG
AAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAA
AGATGACAAGTGGAAAAGAGGGAGCGAACCAGTTCCAGAAAAAAAATTGGAACCTGTTGTTTTTGAGAAGGTGAAAATGCCACAGAAAAA
AGAAGACCCACAGCTACCTCGGAAAAGCTCCCCGAAATCCACAGCGCCTGTCATGGATTTGTTGGGCCTTGATGCTCCTGTGGCCTGCTC
CATTGCAAATAGTAAGACCAGCAATACCCTAGAGAAGGATTTAGATCTGTTGGCCTCTGTTCCATCCCCTTCTTCTTCCGGTTCCAGAAA
GGTTGTAGGTTCCATGCCAACTGCAGGGAGTGCCGGCTCTGTTCCTGAAAATCTGAACCTGTTTCCGGAGCCAGGGAGCAAATCAGAAGA
AATAGGCAAGAAACAGCTCTCTAAAGACTCCATTCTTTCACTGTATGGATCCCAGACGCCTCAAATGCCTACTCAAGCAATGTTCATGGC
TCCCGCTCAGATGGCATATCCCACAGCCTACCCCAGCTTCCCCGGGGTTACACCTCCTAACAGCATAATGGGGAGCATGATGCCTCCACC
AGTAGGCATGGTTGCTCAGCCAGGAGCTTCTGGGATGGTTGCCCCCATGGCCATGCCTGCAGGCTATATGGGTGGCATGCAGGCATCAAT
GATGGGTGTGCCGAATGGAATGATGACCACCCAGCAGGCTGGCTACATGGCAGGCATGGCAGCTATGCCCCAGACTGTGTATGGGGTCCA
GCCAGCTCAGCAGCTGCAATGGAACCTTACTCAGATGACCCAGCAGATGGCTGGGATGAACTTCTATGGAGCCAATGGCATGATGAACTA
TGGACAGTCAATGAGTGGCGGAAATGGACAGGCAGCAAATCAGACTCTCAGTCCTCAGATGTGGAAATAAAAACAAAACACCTGTATGGC
TGCCATTCTCTTCAGCCCTCGCTCTCCCCTTTCCACAGCCTCCACCCCTGACCCCCATCCTCTTTTCCTACCTCTCTGTTTGGTTTAGAA

>In-frame_GNAS_ENST00000354359_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_3022nt
TCGCCGCCGCCGCCTCCTCCTCCCCCCGCCTCCCCCCGCCCGCCGCGGCGCTTTTGGCTCGGGGCGGCGGCGGGGGCCCGGCCGAGGCAA
TAAGAGCGGCGGCGGCGGCAGCGGCGGCAGCAGCTCCCGCAGCTCCTGCTCTGGTCCGCCTCGGCCCGGCGGCGGCCATCAGCCCCCTCG
GCCTCGGCTCGAGGGGCGGGGAGCTGCGCGCGCCCCTCGGTCCGACCGACACCCTCCCCTTCCCGCCCGTCCGCGCGCCCCGCGGCCCGC
GGCCCGCAGTCCGCCCCGCGCGCTCCTTGCCGAGGAGCCGAGCCCGCGCCCGGCCCGCCCGCCCGGCGCTGCCCCGGCCCTCCCGGCCCG
CGTGAGGCCGCCCGCGCCCGCCGCCGCCGCAGCCCGGCCGCGCCCCGCCGCCGCCGCCGCCGCCATGGGCTGCCTCGGGAACAGTAAGAC
CGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTGCAGAAGGACAAGCAGGTCTACCGGGC
CACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAA
TGGAGAGGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGGCAGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAA
CCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGT
GGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGG
AGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGC
TGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAA
CTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGT
GGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAA
CAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGAT
TGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAA
GTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGA
CACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAA
CCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATT
AACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTA
AGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAA
ATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGA
AAAAGATGACAAGTGGAAAAGAGGGAGCGAACCAGTTCCAGAAAAAAAATTGGAACCTGTTGTTTTTGAGAAGGTGAAAATGCCACAGAA
AAAAGAAGACCCACAGCTACCTCGGAAAAGCTCCCCGAAATCCACAGCGCCTGTCATGGATTTGTTGGGCCTTGATGCTCCTGTGGCCTG
CTCCATTGCAAATAGTAAGACCAGCAATACCCTAGAGAAGGATTTAGATCTGTTGGCCTCTGTTCCATCCCCTTCTTCTTCCGGTTCCAG
AAAGGTTGTAGGTTCCATGCCAACTGCAGGGAGTGCCGGCTCTGTTCCTGAAAATCTGAACCTGTTTCCGGAGCCAGGGAGCAAATCAGA
AGAAATAGGCAAGAAACAGCTCTCTAAAGACTCCATTCTTTCACTGTATGGATCCCAGACGCCTCAAATGCCTACTCAAGCAATGTTCAT
GGCTCCCGCTCAGATGGCATATCCCACAGCCTACCCCAGCTTCCCCGGGGTTACACCTCCTAACAGCATAATGGGGAGCATGATGCCTCC
ACCAGTAGGCATGGTTGCTCAGCCAGGAGCTTCTGGGATGGTTGCCCCCATGGCCATGCCTGCAGGCTATATGGGTGGCATGCAGGCATC
AATGATGGGTGTGCCGAATGGAATGATGACCACCCAGCAGGCTGGCTACATGGCAGGCATGGCAGCTATGCCCCAGACTGTGTATGGGGT
CCAGCCAGCTCAGCAGCTGCAATGGAACCTTACTCAGATGACCCAGCAGATGGCTGGGATGAACTTCTATGGAGCCAATGGCATGATGAA
CTATGGACAGTCAATGAGTGGCGGAAATGGACAGGCAGCAAATCAGACTCTCAGTCCTCAGATGTGGAAATAAAAACAAAACACCTGTAT
GGCTGCCATTCTCTTCAGCCCTCGCTCTCCCCTTTCCACAGCCTCCACCCCTGACCCCCATCCTCTTTTCCTACCTCTCTGTTTGGTTTA

>In-frame_GNAS_ENST00000265620_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_2913nt
GGGCGGCGGCGGGGGCCCGGCCGAGGCAATAAGAGCGGCGGCGGCGGCAGCGGCGGCAGCAGCTCCCGCAGCTCCTGCTCTGGTCCGCCT
CGGCCCGGCGGCGGCCATCAGCCCCCTCGGCCTCGGCTCGAGGGGCGGGGAGCTGCGCGCGCCCCTCGGTCCGACCGACACCCTCCCCTT
CCCGCCCGTCCGCGCGCCCCGCGGCCCGCGGCCCGCAGTCCGCCCCGCGCGCTCCTTGCCGAGGAGCCGAGCCCGCGCCCGGCCCGCCCG
CCCGGCGCTGCCCCGGCCCTCCCGGCCCGCGTGAGGCCGCCCGCGCCCGCCGCCGCCGCAGCCCGGCCGCGCCCCGCCGCCGCCGCCGCC
GCCATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAG
CTGCAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAG
ATGAGGATCCTGCATGTTAATGGGTTTAATGGAGATGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAA
ACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTG
ATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAA
CGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGAT
CAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTG
GGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAAC
ATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACC
ATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAA
TTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAG
TTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGT
GTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAG
CCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCT
TCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAG
GAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAA
TGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAAAGATGACAAGTGGAAA
AGAGGGAGCGAACCAGTTCCAGAAAAAAAATTGGAACCTGTTGTTTTTGAGAAGGTGAAAATGCCACAGAAAAAAGAAGACCCACAGCTA
CCTCGGAAAAGCTCCCCGAAATCCACAGCGCCTGTCATGGATTTGTTGGGCCTTGATGCTCCTGTGGCCTGCTCCATTGCAAATAGTAAG
ACCAGCAATACCCTAGAGAAGGATTTAGATCTGTTGGCCTCTGTTCCATCCCCTTCTTCTTCCGGTTCCAGAAAGGTTGTAGGTTCCATG
CCAACTGCAGGGAGTGCCGGCTCTGTTCCTGAAAATCTGAACCTGTTTCCGGAGCCAGGGAGCAAATCAGAAGAAATAGGCAAGAAACAG
CTCTCTAAAGACTCCATTCTTTCACTGTATGGATCCCAGACGCCTCAAATGCCTACTCAAGCAATGTTCATGGCTCCCGCTCAGATGGCA
TATCCCACAGCCTACCCCAGCTTCCCCGGGGTTACACCTCCTAACAGCATAATGGGGAGCATGATGCCTCCACCAGTAGGCATGGTTGCT
CAGCCAGGAGCTTCTGGGATGGTTGCCCCCATGGCCATGCCTGCAGGCTATATGGGTGGCATGCAGGCATCAATGATGGGTGTGCCGAAT
GGAATGATGACCACCCAGCAGGCTGGCTACATGGCAGGCATGGCAGCTATGCCCCAGACTGTGTATGGGGTCCAGCCAGCTCAGCAGCTG
CAATGGAACCTTACTCAGATGACCCAGCAGATGGCTGGGATGAACTTCTATGGAGCCAATGGCATGATGAACTATGGACAGTCAATGAGT
GGCGGAAATGGACAGGCAGCAAATCAGACTCTCAGTCCTCAGATGTGGAAATAAAAACAAAACACCTGTATGGCTGCCATTCTCTTCAGC
CCTCGCTCTCCCCTTTCCACAGCCTCCACCCCTGACCCCCATCCTCTTTTCCTACCTCTCTGTTTGGTTTAGAAATTGCTCAATAAGTCA

>In-frame_GNAS_ENST00000306090_chr20_57486241_+_SMAP2_ENST00000539317_chr1_40878688_+_2689nt
CAGCGGCGGCAGCAGCTCCCGCAGCTCCTGCTCTGGTCCGCCTCGGCCCGGCGGCGGCCATCAGCCCCCTCGGCCTCGGCTCGAGGGGCG
GGGAGCTGCGCGCGCCCCTCGGTCCGACCGACACCCTCCCCTTCCCGCCCCCATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCG
CAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTGCAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCT
GCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAATGGAGACAGTGA
GAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGT
GGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTA
TGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTA
CTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAAT
CTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTG
CTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCA
GGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCT
CGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGA
GCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCA
CTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCA
CCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTA
CAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCA
GCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAA
AAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATC
AAAATAAAAATTAAATGTGAGCAAAGAAAAAGATGACAAGTGGAAAAGAGGGAGCGAACCAGTTCCAGAAAAAAAATTGGAACCTGTTGT
TTTTGAGAAGGTGAAAATGCCACAGAAAAAAGAAGACCCACAGCTACCTCGGAAAAGCTCCCCGAAATCCACAGCGCCTGTCATGGATTT
GTTGGGCCTTGATGCTCCTGTGGCCTGCTCCATTGCAAATAGTAAGACCAGCAATACCCTAGAGAAGGATTTAGATCTGTTGGCCTCTGT
TCCATCCCCTTCTTCTTCCGGTTCCAGAAAGGTTGTAGGTTCCATGCCAACTGCAGGGAGTGCCGGCTCTGTTCCTGAAAATCTGAACCT
GTTTCCGGAGCCAGGGAGCAAATCAGAAGAAATAGGCAAGAAACAGCTCTCTAAAGACTCCATTCTTTCACTGTATGGATCCCAGACGCC
TCAAATGCCTACTCAAGCAATGTTCATGGCTCCCGCTCAGATGGCATATCCCACAGCCTACCCCAGCTTCCCCGGGGTTACACCTCCTAA
CAGCATAATGGGGAGCATGATGCCTCCACCAGTAGGCATGGTTGCTCAGCCAGGAGCTTCTGGGATGGTTGCCCCCATGGCCATGCCTGC
AGGCTATATGGGTGGCATGCAGGCATCAATGATGGGTGTGCCGAATGGAATGATGACCACCCAGCAGGCTGGCTACATGGCAGGCATGGC
AGCTATGCCCCAGACTGTGTATGGGGTCCAGCCAGCTCAGCAGCTGCAATGGAACCTTACTCAGATGACCCAGCAGATGGCTGGGATGAA
CTTCTATGGAGCCAATGGCATGATGAACTATGGACAGTCAATGAGTGGCGGAAATGGACAGGCAGCAAATCAGACTCTCAGTCCTCAGAT
GTGGAAATAAAAACAAAACACCTGTATGGCTGCCATTCTCTTCAGCCCTCGCTCTCCCCTTTCCACAGCCTCCACCCCTGACCCCCATCC


Top

FusionGenePPI for GNAS_SMAP2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GNASFSCN1, PAICS, RUVBL1, SHMT2, TTC1, ADCY6, CRHR1, RGS2, SNX13, VIPR1, GNAS, MDM2, CALM1, GNG2, PCK1, ADRB2, AVPR2, TBXA2R, GNB1, GNAQ, GNA11, SLC25A12, LAMTOR1, NUCB1, NUCB2, HLA-A, OPTN, PTGIR, FUS, AXIN1, PANX1, CCDC8, EGFR, JAK3, GNAL, GNG4, TRO, MAGED2, GNB2, GNB4, C1QBP, METAP2, CPT2, YBEY, GNG10, OCIAD1, GNA12, ARMCX3, GNG5, EIF4H, EML2, GIPC1, DIS3, PFAS, NTRK1, RIC8B, CHEK2, HERC2, XPO1, CAT, DBN1, FLNA, MYH9, DNAJC7, SYNPO, THOC2, ELMSAN1, ADCY2, CDC5L, CD47, GLP1R, NAP1L1, MTNR1B, TRIM25SMAP2FN1, VCAM1, DAB1, MAGED1, DAZAP2, FAM168A, C1orf94, SLC25A11, SLC2A4, CRYZ, CEP170, CNTROB, TMEM17, XPO1, GTSE1, MFSD4, SLC22A12, CLINT1, CELF5, STAMBPL1, MFSD11, CDIPT, SLC5A8, SLC2A14, SLC2A12, RBMS1, SMAD9, ZNF143


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GNAS_SMAP2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GNAS_SMAP2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGNASC3494506Pseudohypoparathyroidism, Type Ia13CTD_human;ORPHANET;UNIPROT
HgeneGNASC0242292McCune-Albright Syndrome5ORPHANET;UNIPROT
HgeneGNASC2931404Albright's hereditary osteodystrophy4CTD_human
HgeneGNASC0016065Polyostotic fibrous dysplasia3CTD_human;HPO;ORPHANET
HgeneGNASC0033806Pseudohypoparathyroidism3CTD_human;HPO
HgeneGNASC1857451Acth-Independent Macronodular Adrenal Hyperplasia3ORPHANET;UNIPROT
HgeneGNASC0014130Endocrine System Diseases2CTD_human
HgeneGNASC0034013Precocious Puberty2CTD_human;HPO
HgeneGNASC0221263Cafe-au-Lait Spots2CTD_human
HgeneGNASC0001206Acromegaly1CTD_human;HPO
HgeneGNASC0001624Adrenal Gland Neoplasms1CTD_human
HgeneGNASC0011573Endogenous depression1PSYGENET
HgeneGNASC0019087Hemorrhagic Disorders1CTD_human
HgeneGNASC0020538Hypertensive disease1CTD_human;HPO
HgeneGNASC0021655Insulin Resistance1CTD_human
HgeneGNASC0023897Liver Diseases, Parasitic1CTD_human
HgeneGNASC0027819Neuroblastoma1CTD_human
HgeneGNASC0028754Obesity1CTD_human;HPO
HgeneGNASC0029396Heterotopic Ossification1CTD_human;HPO
HgeneGNASC0032460Polycystic Ovary Syndrome1CTD_human
HgeneGNASC0033835Pseudopseudohypoparathyroidism1CTD_human;ORPHANET
HgeneGNASC0035204Respiration Disorders1CTD_human
HgeneGNASC0036341Schizophrenia1PSYGENET
HgeneGNASC0038587Substance Withdrawal Syndrome1CTD_human
HgeneGNASC0039231Tachycardia1CTD_human
HgeneGNASC0206698Cholangiocarcinoma1CTD_human
HgeneGNASC0221357Brachydactyly1CTD_human;HPO
HgeneGNASC0242184Hypoxia1CTD_human
HgeneGNASC0242216Biliary calculi1CTD_human
HgeneGNASC0334041Osteoma cutis1CTD_human;ORPHANET;UNIPROT
HgeneGNASC0346302Growth Hormone-Secreting Pituitary Adenoma1CTD_human
HgeneGNASC2932715Pseudohypoparathyroidism Type 1B1CTD_human;ORPHANET
HgeneGNASC2932716Pseudohypoparathyroidism Type 1C1ORPHANET;UNIPROT
HgeneGNASC3714756Intellectual Disability1CTD_human;HPO