FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14884

FusionGeneSummary for GNAS_PLXNC1

check button Fusion gene summary
Fusion gene informationFusion gene name: GNAS_PLXNC1
Fusion gene ID: 14884
HgeneTgene
Gene symbol

GNAS

PLXNC1

Gene ID

2778

10154

Gene nameGNAS complex locusplexin C1
SynonymsAHO|C20orf45|GNAS1|GPSA|GSA|GSP|NESP|PITA3|POH|SCG6|SgVICD232|PLXN-C1|VESPR
Cytomap

20q13.32

12q22

Type of geneprotein-codingprotein-coding
Descriptionprotein ALEXprotein GNASprotein SCG6 (secretogranin VI)G protein subunit alpha Sadenylate cyclase-stimulating G alpha proteinalternative gene product encoded by XL-exonextra large alphas proteinguanine nucleotide binding protein (G protein), alpha plexin-C1plexin (semaphorin receptor)receptor for viral semaphorin proteinreceptor for virally-encoded semaphorinvirus-encoded semaphorin protein receptor
Modification date2018052320180523
UniProtAcc

Q5JWF2

O60486

Ensembl transtripts involved in fusion geneENST00000313949, ENST00000371098, 
ENST00000371075, ENST00000371100, 
ENST00000371099, ENST00000371102, 
ENST00000464624, ENST00000306120, 
ENST00000371095, ENST00000371085, 
ENST00000354359, ENST00000265620, 
ENST00000306090, ENST00000371081, 
ENST00000258526, ENST00000547057, 
ENST00000551495, ENST00000545312, 
Fusion gene scores* DoF score34 X 18 X 17=104043 X 3 X 2=18
# samples 463
** MAII scorelog2(46/10404*10)=-4.49936063299862
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: GNAS [Title/Abstract] AND PLXNC1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPCPGTCGA-RW-A686-06AGNASchr20

57486241

+PLXNC1chr12

94642003

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000313949ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000313949ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000313949ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000313949ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-3CDSENST00000371098ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-intronENST00000371098ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-intronENST00000371098ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-intronENST00000371098ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+
Frame-shitENST00000371075ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371075ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371075ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371075ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+
In-frameENST00000371100ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371100ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371100ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371100ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-3CDSENST00000371099ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-intronENST00000371099ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-intronENST00000371099ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-intronENST00000371099ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+
In-frameENST00000371102ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371102ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371102ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371102ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+
Frame-shitENST00000464624ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000464624ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000464624ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000464624ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-3CDSENST00000306120ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-intronENST00000306120ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-intronENST00000306120ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-intronENST00000306120ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+
In-frameENST00000371095ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371095ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371095ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371095ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+
In-frameENST00000371085ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371085ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371085ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000371085ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+
In-frameENST00000354359ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000354359ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000354359ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000354359ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+
In-frameENST00000265620ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000265620ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000265620ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000265620ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+
In-frameENST00000306090ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000306090ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000306090ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
5CDS-intronENST00000306090ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-3CDSENST00000371081ENST00000258526GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-intronENST00000371081ENST00000547057GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-intronENST00000371081ENST00000551495GNASchr20

57486241

+PLXNC1chr12

94642003

+
intron-intronENST00000371081ENST00000545312GNASchr20

57486241

+PLXNC1chr12

94642003

+

Top

FusionProtFeatures for GNAS_PLXNC1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GNAS

Q5JWF2

PLXNC1

O60486

Guanine nucleotide-binding proteins (G proteins)function as transducers in numerous signaling pathways controlledby G protein-coupled receptors (GPCRs). Signaling involves theactivation of adenylyl cyclases, resulting in increased levels ofthe signaling molecule cAMP. GNAS functions downstream of severalGPCRs, including beta-adrenergic receptors. XLas isoforms interactwith the same set of receptors as GNAS isoforms (By similarity).{ECO:0000250|UniProtKB:Q6R0H7}. Receptor for SEMA7A, for smallpox semaphorin A39R,vaccinia virus semaphorin A39R and for herpesvirus Sema protein.Binding of semaphorins triggers cellular responses leading to therearrangement of the cytoskeleton and to secretion of IL6 and IL8(By similarity). {ECO:0000250, ECO:0000269|PubMed:20727575}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for GNAS_PLXNC1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GNAS_ENST00000371100_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_1864aa
MGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGA
HGSYSPPPEEAMPFEAEQPSLGGFWPTLEQPGFPSGVHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRGCSQLLLQ
VPDLAPGGPGAAGVPGAPPEEPQALRPAKAGSRGGYSPPPEETMPFELDGEGFGDDSPPPGLSRVIAQVDGSSQFAAVAASSAVRLTPAA
NAPPLWVPGAIGSPSQEAVRPPSNFTGSSPWMEISGPPFEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAE
MEGAADAAEGGKVPSPGYGSPAAGAASADTAARAAPAAPADPDSGATPEDPDSGTAPADPDSGAFAADPDSGAAPAAPADPDSGAAPDAP
ADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQAADP
PTPRPTRASAWRGKSESSRGRRVYYDEGVASSDDDSSGDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQPKA
SRSLKVKKVPLAEKRRQMRKEALEKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDP
QAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSN
EYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVI
REDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLR
ISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPE
XFCETPFSLQLAXMFQIXKAXGGLQKKEKRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKEKENDNFNISKK
DIEITLFHGENGQLNCSFENITRNQDLTTILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIFAAVGV
TRHKSKELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTA
LDALICNKSFLVTVIHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNWMSVCL
SGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKE
KIFQAFLSKNGSPYGLQLNEIGLELQMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILP
DSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLP
LRFWVNILKNPQFVFDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPPLSSSEMEEFLT

>In-frame_GNAS_ENST00000371102_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_1850aa
MGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGA
HGSYSPPPEEAMPFEAEQPSLGGFWPTLEQPGFPSGVHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRGCSQLLLQ
VPDLAPGGPGAAGVPGAPPEEPQALRPAKAGSRGGYSPPPEETMPFELDGEGFGDDSPPPGLSRVIAQVDGSSQFAAVAASSAVRLTPAA
NAPPLWVPGAIGSPSQEAVRPPSNFTGSSPWMEISGPPFEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAE
MEGAADAAEGGKVPSPGYGSPAAGAASADTAARAAPAAPADPDSGATPEDPDSGTAPADPDSGAFAADPDSGAAPAAPADPDSGAAPDAP
ADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQAADP
PTPRPTRASAWRGKSESSRGRRVYYDEGVASSDDDSSGDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQPKA
SRSLKVKKVPLAEKRRQMRKEALEKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGDSEKATK
VQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDK
IDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALN
LFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYP
HFTCAVDTENIRRVFNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPEXFCETPFSLQLAXM
FQIXKAXGGLQKKEKRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKEKENDNFNISKKDIEITLFHGENGQL
NCSFENITRNQDLTTILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIFAAVGVTRHKSKELSRKQSQ
QLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTV
IHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYL
LVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPY
GLQLNEIGLELQMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILPDSEAFQDVQGKRHR
GKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFV
FDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNEEV

>In-frame_GNAS_ENST00000371095_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_1207aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIE
TIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSD
QDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRT
ISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRR
VFNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPEXFCETPFSLQLAXMFQIXKAXGGLQKK
EKRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKEKENDNFNISKKDIEITLFHGENGQLNCSFENITRNQDL
TTILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIFAAVGVTRHKSKELSRKQSQQLELLESELRKEI
RDGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVIHTLEKQKNFSVK
DRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGP
VDVITCKALYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLELQM
GTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILPDSEAFQDVQGKRHRGKHKFKVKEMYLT
KLLSTKVAIHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDGCL
SVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYF

>In-frame_GNAS_ENST00000371085_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_1221aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKAT
KVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLD
KIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEAL
NLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY
PHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPEXFCETPFSLQLAX
MFQIXKAXGGLQKKEKRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKEKENDNFNISKKDIEITLFHGENGQ
LNCSFENITRNQDLTTILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIFAAVGVTRHKSKELSRKQS
QQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVT
VIHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFY
LLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSP
YGLQLNEIGLELQMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILPDSEAFQDVQGKRH
RGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQF
VFDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNEE

>In-frame_GNAS_ENST00000354359_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_1222aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGSEKA
TKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFL
DKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEA
LNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYC
YPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPEXFCETPFSLQLA
XMFQIXKAXGGLQKKEKRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKEKENDNFNISKKDIEITLFHGENG
QLNCSFENITRNQDLTTILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIFAAVGVTRHKSKELSRKQ
SQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLV
TVIHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPF
YLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGS
PYGLQLNEIGLELQMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILPDSEAFQDVQGKR
HRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQ
FVFDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNE

>In-frame_GNAS_ENST00000265620_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_1206aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGDEKATKVQDIKNNLKEAIET
IVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQ
DLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTI
SVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRV
FNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPEXFCETPFSLQLAXMFQIXKAXGGLQKKE
KRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKEKENDNFNISKKDIEITLFHGENGQLNCSFENITRNQDLT
TILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIFAAVGVTRHKSKELSRKQSQQLELLESELRKEIR
DGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVIHTLEKQKNFSVKD
RCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPV
DVITCKALYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLELQMG
TRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTK
LLSTKVAIHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDGCLS
VIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFD

>In-frame_GNAS_ENST00000306090_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_1205aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIE
TIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSD
QDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRT
ISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRR
VFNDCRDIIQRMHLRQYELLXEGNPQIXLKPXAQLIKSETXLYKQLITHHRAXLTKQPFPSPEXFCETPFSLQLAXMFQIXKAXGGLQKK
EKRPQKFPLTFSKNKXNSSSKQIKXNKRNKXNKYCVVQHXKKSKXKLNVSKENDNFNISKKDIEITLFHGENGQLNCSFENITRNQDLTT
ILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIFAAVGVTRHKSKELSRKQSQQLELLESELRKEIRD
GFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVIHTLEKQKNFSVKDR
CLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVD
VITCKALYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLELQMGT
RQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTKL
LSTKVAIHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDGCLSV
IAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GNAS_ENST00000371100_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_5592nt
ATGGGCGTGCGCAACTGCCTCTACGGCAATAATATGTCAGGACAACGCGATATCCCCCCTGAAATCGGGGAACAGCCCGAGCAACCACCT
TTGGAGGCCCCAGGGGCAGCTGCCCCCGGTGCTGGGCCTAGCCCAGCCGAAGAGATGGAGACCGAACCGCCTCACAACGAGCCCATCCCC
GTCGAGAATGATGGCGAGGCCTGTGGACCCCCAGAGGTCTCCAGACCCAACTTTCAGGTCCTCAACCCGGCATTCAGGGAAGCTGGAGCC
CATGGAAGCTACAGCCCACCTCCTGAGGAAGCAATGCCCTTCGAGGCTGAACAGCCCAGCTTGGGAGGCTTCTGGCCTACACTGGAGCAG
CCTGGATTCCCCAGTGGGGTCCATGCAGGCCTTGAGGCCTTCGGCCCAGCACTCATGGAGCCCGGAGCCTTCAGTGGTGCCAGACCAGGC
CTGGGAGGATACAGCCCTCCACCAGAAGAAGCTATGCCCTTTGAGTTTGACCAGCCTGCCCAGAGAGGCTGCAGTCAACTTCTCTTACAG
GTCCCAGACCTTGCTCCAGGAGGCCCAGGTGCTGCAGGGGTCCCCGGAGCTCCTCCCGAGGAGCCCCAAGCCCTCAGGCCTGCAAAGGCT
GGCTCCAGAGGAGGCTACAGCCCTCCCCCTGAGGAGACTATGCCATTTGAGCTTGATGGAGAAGGATTTGGGGACGACAGCCCACCCCCG
GGGCTTTCCCGAGTTATCGCACAAGTCGACGGCAGCAGCCAGTTCGCGGCAGTCGCGGCCTCGAGTGCGGTCCGCCTCACTCCCGCCGCG
AACGCGCCTCCCCTCTGGGTCCCAGGCGCCATCGGCAGCCCATCCCAAGAGGCTGTCAGACCTCCTTCTAACTTCACGGGCAGCAGCCCC
TGGATGGAGATCTCCGGACCCCCGTTCGAGATTGGCAGCGCCCCCGCTGGGGTCGACGACACTCCCGTCAACATGGACAGCCCCCCAATC
GCGCTTGACGGCCCGCCCATCAAGGTCTCCGGAGCCCCAGATAAGAGAGAGCGAGCAGAGAGACCCCCAGTTGAGGAGGAAGCAGCAGAG
ATGGAAGGAGCCGCTGATGCCGCGGAGGGAGGAAAAGTACCCTCTCCGGGGTACGGATCCCCTGCCGCCGGGGCAGCCTCAGCGGATACC
GCTGCCAGGGCAGCCCCTGCAGCCCCAGCCGATCCTGACTCCGGGGCAACCCCAGAAGATCCCGACTCCGGGACAGCACCAGCCGATCCT
GACTCCGGGGCATTCGCAGCCGATCCCGACTCCGGGGCAGCCCCTGCCGCCCCAGCCGATCCCGACTCCGGGGCGGCCCCTGACGCCCCA
GCCGATCCCGACTCCGGGGCGGCCCCTGACGCCCCAGCCGATCCAGATGCCGGGGCGGCCCCTGAGGCTCCCGCCGCCCCTGCGGCTGCT
GAGACCCGGGCAGCCCATGTCGCCCCAGCTGCGCCAGACGCAGGGGCTCCCACTGCCCCAGCCGCTTCTGCCACCCGGGCAGCCCAAGTC
CGCCGGGCGGCCTCTGCAGCCCCTGCCTCCGGGGCCAGACGCAAGATCCATCTCAGACCCCCCAGCCCCGAGATCCAGGCTGCCGATCCG
CCTACTCCGCGGCCTACTCGCGCGTCTGCCTGGCGGGGCAAGTCCGAGAGCAGCCGCGGCCGCCGCGTGTACTACGATGAAGGGGTGGCC
AGCAGCGACGATGACTCCAGCGGAGACGAGTCCGACGATGGGACCTCCGGATGCCTCCGCTGGTTTCAGCATCGGCGAAATCGCCGCCGC
CGAAAGCCCCAGCGCAACTTACTCCGCAACTTTCTCGTGCAAGCCTTCGGGGGCTGCTTCGGTCGATCTGAGAGTCCCCAGCCCAAAGCC
TCGCGCTCTCTCAAGGTCAAGAAGGTACCCCTGGCGGAGAAGCGCAGACAGATGCGCAAAGAAGCCCTGGAGAAGCGGGCCCAGAAGCGC
GCAGAGAAGAAACGCAGTAAGCTCATCGACAAACAACTCCAGGACGAAAAGATGGGCTACATGTGTACGCACCGCCTGCTGCTTCTAGGT
GCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAATGGAGAGGGCGGCGAAGAGGACCCG
CAGGCTGCAAGGAGCAACAGCGATGGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTG
GCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTG
CCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAAC
GAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTG
CTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAG
CGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATC
CGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTG
ATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGC
TACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGG
ATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAAC
GACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCA
CAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAG
TGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGG
CCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAA
TATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAATGACAACTTCAACATTTCCAAAAAA
GACATTGAAATTACTCTCTTCCATGGGGAAAATGGGCAATTAAATTGCAGTTTTGAAAATATTACTAGAAATCAAGATCTTACCACCATC
CTTTGCAAAATTAAAGGCATCAAGACTGCAAGCACCATTGCCAACTCTTCTAAGAAAGTTCGGGTCAAGCTGGGAAACCTGGAGCTCTAC
GTCGAGCAGGAGTCAGTTCCTTCCACATGGTATTTTCTGATTGTGCTCCCTGTCTTGCTAGTGATTGTCATTTTTGCGGCCGTGGGGGTG
ACCAGGCACAAATCGAAGGAGCTGAGTCGCAAACAGAGTCAACAACTAGAATTGCTGGAAAGCGAGCTCCGGAAAGAGATACGTGACGGC
TTTGCTGAGCTGCAGATGGATAAATTGGATGTGGTTGATAGTTTTGGAACTGTTCCCTTCCTTGACTACAAACATTTTGCTCTGAGAACT
TTCTTCCCTGAGTCAGGTGGCTTCACCCACATCTTCACTGAAGATATGCATAACAGAGACGCCAACGACAAGAATGAAAGTCTCACAGCT
TTGGATGCCCTAATCTGTAATAAAAGCTTTCTTGTTACTGTCATCCACACCCTTGAAAAGCAGAAGAACTTTTCTGTGAAGGACAGGTGT
CTGTTTGCCTCCTTCCTAACCATTGCACTGCAAACCAAGCTGGTCTACCTGACCAGCATCCTAGAGGTGCTGACCAGGGACTTGATGGAA
CAGTGTAGTAACATGCAGCCGAAACTCATGCTGAGACGCACGGAGTCCGTCGTCGAAAAACTCCTCACAAACTGGATGTCCGTCTGCCTT
TCTGGATTTCTCCGGGAGACTGTCGGAGAGCCCTTCTATTTGCTGGTGACGACTCTGAACCAGAAAATTAACAAGGGTCCCGTGGATGTA
ATCACTTGCAAAGCCCTGTACACACTTAATGAAGACTGGCTGTTGTGGCAGGTTCCGGAATTCAGTACTGTGGCATTAAACGTCGTCTTT
GAAAAAATCCCGGAAAACGAGAGTGCAGATGTCTGTCGGAATATTTCAGTCAATGTTCTCGACTGTGACACCATTGGCCAAGCCAAAGAA
AAGATTTTCCAAGCATTCTTAAGCAAAAATGGCTCTCCTTATGGACTTCAGCTTAATGAAATTGGTCTTGAGCTTCAAATGGGCACACGA
CAGAAAGAACTTCTGGACATCGACAGTTCCTCCGTGATTCTTGAAGATGGAATCACCAAGCTAAACACCATTGGCCACTATGAGATATCA
AATGGATCCACTATAAAAGTCTTTAAGAAGATAGCAAATTTTACTTCAGATGTGGAGTACTCGGATGACCACTGCCATTTGATTTTACCA
GATTCGGAAGCATTCCAAGATGTGCAAGGAAAGAGACATCGAGGGAAGCACAAGTTCAAAGTAAAAGAAATGTATCTGACAAAGCTGCTG
TCGACCAAGGTGGCAATTCATTCTGTGCTTGAAAAACTTTTTAGAAGCATTTGGAGTTTACCCAACAGCAGAGCTCCATTTGCTATAAAA
TACTTTTTTGACTTTTTGGACGCCCAGGCTGAAAACAAAAAAATCACAGATCCTGACGTCGTACATATTTGGAAAACAAACAGCCTTCCT
CTTCGCTTCTGGGTAAACATCCTGAAGAACCCTCAGTTTGTCTTTGACATTAAGAAGACACCACATATAGACGGCTGTTTGTCAGTGATT
GCCCAGGCATTCATGGATGCATTTTCTCTCACAGAGCAGCAACTAGGGAAGGAAGCACCAACTAATAAGCTTCTCTATGCCAAGGATATC
CCAACCTACAAAGAAGAAGTAAAATCTTATTACAAAGCAATCAGGGATTTGCCTCCATTGTCATCCTCAGAAATGGAAGAATTTTTAACT
CAGGAATCTAAGAAACATGAAAATGAATTTAATGAAGAAGTGGCCTTGACAGAAATTTACAAATACATCGTAAAATATTTTGATGAGATT
CTAAATAAACTAGAAAGAGAACGAGGGCTGGAAGAAGCTCAGAAACAACTCTTGCATGTAAAAGTCTTATTTGATGAAAAGAAGAAATGC

>In-frame_GNAS_ENST00000371102_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_5550nt
ATGGGCGTGCGCAACTGCCTCTACGGCAATAATATGTCAGGACAACGCGATATCCCCCCTGAAATCGGGGAACAGCCCGAGCAACCACCT
TTGGAGGCCCCAGGGGCAGCTGCCCCCGGTGCTGGGCCTAGCCCAGCCGAAGAGATGGAGACCGAACCGCCTCACAACGAGCCCATCCCC
GTCGAGAATGATGGCGAGGCCTGTGGACCCCCAGAGGTCTCCAGACCCAACTTTCAGGTCCTCAACCCGGCATTCAGGGAAGCTGGAGCC
CATGGAAGCTACAGCCCACCTCCTGAGGAAGCAATGCCCTTCGAGGCTGAACAGCCCAGCTTGGGAGGCTTCTGGCCTACACTGGAGCAG
CCTGGATTCCCCAGTGGGGTCCATGCAGGCCTTGAGGCCTTCGGCCCAGCACTCATGGAGCCCGGAGCCTTCAGTGGTGCCAGACCAGGC
CTGGGAGGATACAGCCCTCCACCAGAAGAAGCTATGCCCTTTGAGTTTGACCAGCCTGCCCAGAGAGGCTGCAGTCAACTTCTCTTACAG
GTCCCAGACCTTGCTCCAGGAGGCCCAGGTGCTGCAGGGGTCCCCGGAGCTCCTCCCGAGGAGCCCCAAGCCCTCAGGCCTGCAAAGGCT
GGCTCCAGAGGAGGCTACAGCCCTCCCCCTGAGGAGACTATGCCATTTGAGCTTGATGGAGAAGGATTTGGGGACGACAGCCCACCCCCG
GGGCTTTCCCGAGTTATCGCACAAGTCGACGGCAGCAGCCAGTTCGCGGCAGTCGCGGCCTCGAGTGCGGTCCGCCTCACTCCCGCCGCG
AACGCGCCTCCCCTCTGGGTCCCAGGCGCCATCGGCAGCCCATCCCAAGAGGCTGTCAGACCTCCTTCTAACTTCACGGGCAGCAGCCCC
TGGATGGAGATCTCCGGACCCCCGTTCGAGATTGGCAGCGCCCCCGCTGGGGTCGACGACACTCCCGTCAACATGGACAGCCCCCCAATC
GCGCTTGACGGCCCGCCCATCAAGGTCTCCGGAGCCCCAGATAAGAGAGAGCGAGCAGAGAGACCCCCAGTTGAGGAGGAAGCAGCAGAG
ATGGAAGGAGCCGCTGATGCCGCGGAGGGAGGAAAAGTACCCTCTCCGGGGTACGGATCCCCTGCCGCCGGGGCAGCCTCAGCGGATACC
GCTGCCAGGGCAGCCCCTGCAGCCCCAGCCGATCCTGACTCCGGGGCAACCCCAGAAGATCCCGACTCCGGGACAGCACCAGCCGATCCT
GACTCCGGGGCATTCGCAGCCGATCCCGACTCCGGGGCAGCCCCTGCCGCCCCAGCCGATCCCGACTCCGGGGCGGCCCCTGACGCCCCA
GCCGATCCCGACTCCGGGGCGGCCCCTGACGCCCCAGCCGATCCAGATGCCGGGGCGGCCCCTGAGGCTCCCGCCGCCCCTGCGGCTGCT
GAGACCCGGGCAGCCCATGTCGCCCCAGCTGCGCCAGACGCAGGGGCTCCCACTGCCCCAGCCGCTTCTGCCACCCGGGCAGCCCAAGTC
CGCCGGGCGGCCTCTGCAGCCCCTGCCTCCGGGGCCAGACGCAAGATCCATCTCAGACCCCCCAGCCCCGAGATCCAGGCTGCCGATCCG
CCTACTCCGCGGCCTACTCGCGCGTCTGCCTGGCGGGGCAAGTCCGAGAGCAGCCGCGGCCGCCGCGTGTACTACGATGAAGGGGTGGCC
AGCAGCGACGATGACTCCAGCGGAGACGAGTCCGACGATGGGACCTCCGGATGCCTCCGCTGGTTTCAGCATCGGCGAAATCGCCGCCGC
CGAAAGCCCCAGCGCAACTTACTCCGCAACTTTCTCGTGCAAGCCTTCGGGGGCTGCTTCGGTCGATCTGAGAGTCCCCAGCCCAAAGCC
TCGCGCTCTCTCAAGGTCAAGAAGGTACCCCTGGCGGAGAAGCGCAGACAGATGCGCAAAGAAGCCCTGGAGAAGCGGGCCCAGAAGCGC
GCAGAGAAGAAACGCAGTAAGCTCATCGACAAACAACTCCAGGACGAAAAGATGGGCTACATGTGTACGCACCGCCTGCTGCTTCTAGGT
GCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAATGGAGACAGTGAGAAGGCAACCAAA
GTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAAC
CCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAG
GCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAG
ATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAG
TTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTG
ACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAAC
CTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTC
CTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGAC
CCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCT
CATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTAC
GAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATC
ACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATG
TTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAAC
AGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTA
AATGTGAGCAAAGAAAAAGAAAATGACAACTTCAACATTTCCAAAAAAGACATTGAAATTACTCTCTTCCATGGGGAAAATGGGCAATTA
AATTGCAGTTTTGAAAATATTACTAGAAATCAAGATCTTACCACCATCCTTTGCAAAATTAAAGGCATCAAGACTGCAAGCACCATTGCC
AACTCTTCTAAGAAAGTTCGGGTCAAGCTGGGAAACCTGGAGCTCTACGTCGAGCAGGAGTCAGTTCCTTCCACATGGTATTTTCTGATT
GTGCTCCCTGTCTTGCTAGTGATTGTCATTTTTGCGGCCGTGGGGGTGACCAGGCACAAATCGAAGGAGCTGAGTCGCAAACAGAGTCAA
CAACTAGAATTGCTGGAAAGCGAGCTCCGGAAAGAGATACGTGACGGCTTTGCTGAGCTGCAGATGGATAAATTGGATGTGGTTGATAGT
TTTGGAACTGTTCCCTTCCTTGACTACAAACATTTTGCTCTGAGAACTTTCTTCCCTGAGTCAGGTGGCTTCACCCACATCTTCACTGAA
GATATGCATAACAGAGACGCCAACGACAAGAATGAAAGTCTCACAGCTTTGGATGCCCTAATCTGTAATAAAAGCTTTCTTGTTACTGTC
ATCCACACCCTTGAAAAGCAGAAGAACTTTTCTGTGAAGGACAGGTGTCTGTTTGCCTCCTTCCTAACCATTGCACTGCAAACCAAGCTG
GTCTACCTGACCAGCATCCTAGAGGTGCTGACCAGGGACTTGATGGAACAGTGTAGTAACATGCAGCCGAAACTCATGCTGAGACGCACG
GAGTCCGTCGTCGAAAAACTCCTCACAAACTGGATGTCCGTCTGCCTTTCTGGATTTCTCCGGGAGACTGTCGGAGAGCCCTTCTATTTG
CTGGTGACGACTCTGAACCAGAAAATTAACAAGGGTCCCGTGGATGTAATCACTTGCAAAGCCCTGTACACACTTAATGAAGACTGGCTG
TTGTGGCAGGTTCCGGAATTCAGTACTGTGGCATTAAACGTCGTCTTTGAAAAAATCCCGGAAAACGAGAGTGCAGATGTCTGTCGGAAT
ATTTCAGTCAATGTTCTCGACTGTGACACCATTGGCCAAGCCAAAGAAAAGATTTTCCAAGCATTCTTAAGCAAAAATGGCTCTCCTTAT
GGACTTCAGCTTAATGAAATTGGTCTTGAGCTTCAAATGGGCACACGACAGAAAGAACTTCTGGACATCGACAGTTCCTCCGTGATTCTT
GAAGATGGAATCACCAAGCTAAACACCATTGGCCACTATGAGATATCAAATGGATCCACTATAAAAGTCTTTAAGAAGATAGCAAATTTT
ACTTCAGATGTGGAGTACTCGGATGACCACTGCCATTTGATTTTACCAGATTCGGAAGCATTCCAAGATGTGCAAGGAAAGAGACATCGA
GGGAAGCACAAGTTCAAAGTAAAAGAAATGTATCTGACAAAGCTGCTGTCGACCAAGGTGGCAATTCATTCTGTGCTTGAAAAACTTTTT
AGAAGCATTTGGAGTTTACCCAACAGCAGAGCTCCATTTGCTATAAAATACTTTTTTGACTTTTTGGACGCCCAGGCTGAAAACAAAAAA
ATCACAGATCCTGACGTCGTACATATTTGGAAAACAAACAGCCTTCCTCTTCGCTTCTGGGTAAACATCCTGAAGAACCCTCAGTTTGTC
TTTGACATTAAGAAGACACCACATATAGACGGCTGTTTGTCAGTGATTGCCCAGGCATTCATGGATGCATTTTCTCTCACAGAGCAGCAA
CTAGGGAAGGAAGCACCAACTAATAAGCTTCTCTATGCCAAGGATATCCCAACCTACAAAGAAGAAGTAAAATCTTATTACAAAGCAATC
AGGGATTTGCCTCCATTGTCATCCTCAGAAATGGAAGAATTTTTAACTCAGGAATCTAAGAAACATGAAAATGAATTTAATGAAGAAGTG
GCCTTGACAGAAATTTACAAATACATCGTAAAATATTTTGATGAGATTCTAAATAAACTAGAAAGAGAACGAGGGCTGGAAGAAGCTCAG

>In-frame_GNAS_ENST00000371095_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_3621nt
ATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTG
CAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATG
AGGATCCTGCATGTTAATGGGTTTAATGGAGACAGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAA
ACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTG
ATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAA
CGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGAT
CAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTG
GGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAAC
ATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACC
ATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAA
TTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAG
TTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGT
GTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAG
CCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCT
TCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAG
GAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAA
TGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAATGACAACTTCAACATT
TCCAAAAAAGACATTGAAATTACTCTCTTCCATGGGGAAAATGGGCAATTAAATTGCAGTTTTGAAAATATTACTAGAAATCAAGATCTT
ACCACCATCCTTTGCAAAATTAAAGGCATCAAGACTGCAAGCACCATTGCCAACTCTTCTAAGAAAGTTCGGGTCAAGCTGGGAAACCTG
GAGCTCTACGTCGAGCAGGAGTCAGTTCCTTCCACATGGTATTTTCTGATTGTGCTCCCTGTCTTGCTAGTGATTGTCATTTTTGCGGCC
GTGGGGGTGACCAGGCACAAATCGAAGGAGCTGAGTCGCAAACAGAGTCAACAACTAGAATTGCTGGAAAGCGAGCTCCGGAAAGAGATA
CGTGACGGCTTTGCTGAGCTGCAGATGGATAAATTGGATGTGGTTGATAGTTTTGGAACTGTTCCCTTCCTTGACTACAAACATTTTGCT
CTGAGAACTTTCTTCCCTGAGTCAGGTGGCTTCACCCACATCTTCACTGAAGATATGCATAACAGAGACGCCAACGACAAGAATGAAAGT
CTCACAGCTTTGGATGCCCTAATCTGTAATAAAAGCTTTCTTGTTACTGTCATCCACACCCTTGAAAAGCAGAAGAACTTTTCTGTGAAG
GACAGGTGTCTGTTTGCCTCCTTCCTAACCATTGCACTGCAAACCAAGCTGGTCTACCTGACCAGCATCCTAGAGGTGCTGACCAGGGAC
TTGATGGAACAGTGTAGTAACATGCAGCCGAAACTCATGCTGAGACGCACGGAGTCCGTCGTCGAAAAACTCCTCACAAACTGGATGTCC
GTCTGCCTTTCTGGATTTCTCCGGGAGACTGTCGGAGAGCCCTTCTATTTGCTGGTGACGACTCTGAACCAGAAAATTAACAAGGGTCCC
GTGGATGTAATCACTTGCAAAGCCCTGTACACACTTAATGAAGACTGGCTGTTGTGGCAGGTTCCGGAATTCAGTACTGTGGCATTAAAC
GTCGTCTTTGAAAAAATCCCGGAAAACGAGAGTGCAGATGTCTGTCGGAATATTTCAGTCAATGTTCTCGACTGTGACACCATTGGCCAA
GCCAAAGAAAAGATTTTCCAAGCATTCTTAAGCAAAAATGGCTCTCCTTATGGACTTCAGCTTAATGAAATTGGTCTTGAGCTTCAAATG
GGCACACGACAGAAAGAACTTCTGGACATCGACAGTTCCTCCGTGATTCTTGAAGATGGAATCACCAAGCTAAACACCATTGGCCACTAT
GAGATATCAAATGGATCCACTATAAAAGTCTTTAAGAAGATAGCAAATTTTACTTCAGATGTGGAGTACTCGGATGACCACTGCCATTTG
ATTTTACCAGATTCGGAAGCATTCCAAGATGTGCAAGGAAAGAGACATCGAGGGAAGCACAAGTTCAAAGTAAAAGAAATGTATCTGACA
AAGCTGCTGTCGACCAAGGTGGCAATTCATTCTGTGCTTGAAAAACTTTTTAGAAGCATTTGGAGTTTACCCAACAGCAGAGCTCCATTT
GCTATAAAATACTTTTTTGACTTTTTGGACGCCCAGGCTGAAAACAAAAAAATCACAGATCCTGACGTCGTACATATTTGGAAAACAAAC
AGCCTTCCTCTTCGCTTCTGGGTAAACATCCTGAAGAACCCTCAGTTTGTCTTTGACATTAAGAAGACACCACATATAGACGGCTGTTTG
TCAGTGATTGCCCAGGCATTCATGGATGCATTTTCTCTCACAGAGCAGCAACTAGGGAAGGAAGCACCAACTAATAAGCTTCTCTATGCC
AAGGATATCCCAACCTACAAAGAAGAAGTAAAATCTTATTACAAAGCAATCAGGGATTTGCCTCCATTGTCATCCTCAGAAATGGAAGAA
TTTTTAACTCAGGAATCTAAGAAACATGAAAATGAATTTAATGAAGAAGTGGCCTTGACAGAAATTTACAAATACATCGTAAAATATTTT
GATGAGATTCTAAATAAACTAGAAAGAGAACGAGGGCTGGAAGAAGCTCAGAAACAACTCTTGCATGTAAAAGTCTTATTTGATGAAAAG

>In-frame_GNAS_ENST00000371085_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_3663nt
ATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTG
CAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATG
AGGATCCTGCATGTTAATGGGTTTAATGGAGAGGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGGTGAGAAGGCAACC
AAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCC
AACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCC
AAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGAC
AAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACC
AAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGAT
GTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTG
AACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAA
GTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAG
GACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTAC
CCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAG
TACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTA
ATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAG
ATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAA
AACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAA
TTAAATGTGAGCAAAGAAAAAGAAAATGACAACTTCAACATTTCCAAAAAAGACATTGAAATTACTCTCTTCCATGGGGAAAATGGGCAA
TTAAATTGCAGTTTTGAAAATATTACTAGAAATCAAGATCTTACCACCATCCTTTGCAAAATTAAAGGCATCAAGACTGCAAGCACCATT
GCCAACTCTTCTAAGAAAGTTCGGGTCAAGCTGGGAAACCTGGAGCTCTACGTCGAGCAGGAGTCAGTTCCTTCCACATGGTATTTTCTG
ATTGTGCTCCCTGTCTTGCTAGTGATTGTCATTTTTGCGGCCGTGGGGGTGACCAGGCACAAATCGAAGGAGCTGAGTCGCAAACAGAGT
CAACAACTAGAATTGCTGGAAAGCGAGCTCCGGAAAGAGATACGTGACGGCTTTGCTGAGCTGCAGATGGATAAATTGGATGTGGTTGAT
AGTTTTGGAACTGTTCCCTTCCTTGACTACAAACATTTTGCTCTGAGAACTTTCTTCCCTGAGTCAGGTGGCTTCACCCACATCTTCACT
GAAGATATGCATAACAGAGACGCCAACGACAAGAATGAAAGTCTCACAGCTTTGGATGCCCTAATCTGTAATAAAAGCTTTCTTGTTACT
GTCATCCACACCCTTGAAAAGCAGAAGAACTTTTCTGTGAAGGACAGGTGTCTGTTTGCCTCCTTCCTAACCATTGCACTGCAAACCAAG
CTGGTCTACCTGACCAGCATCCTAGAGGTGCTGACCAGGGACTTGATGGAACAGTGTAGTAACATGCAGCCGAAACTCATGCTGAGACGC
ACGGAGTCCGTCGTCGAAAAACTCCTCACAAACTGGATGTCCGTCTGCCTTTCTGGATTTCTCCGGGAGACTGTCGGAGAGCCCTTCTAT
TTGCTGGTGACGACTCTGAACCAGAAAATTAACAAGGGTCCCGTGGATGTAATCACTTGCAAAGCCCTGTACACACTTAATGAAGACTGG
CTGTTGTGGCAGGTTCCGGAATTCAGTACTGTGGCATTAAACGTCGTCTTTGAAAAAATCCCGGAAAACGAGAGTGCAGATGTCTGTCGG
AATATTTCAGTCAATGTTCTCGACTGTGACACCATTGGCCAAGCCAAAGAAAAGATTTTCCAAGCATTCTTAAGCAAAAATGGCTCTCCT
TATGGACTTCAGCTTAATGAAATTGGTCTTGAGCTTCAAATGGGCACACGACAGAAAGAACTTCTGGACATCGACAGTTCCTCCGTGATT
CTTGAAGATGGAATCACCAAGCTAAACACCATTGGCCACTATGAGATATCAAATGGATCCACTATAAAAGTCTTTAAGAAGATAGCAAAT
TTTACTTCAGATGTGGAGTACTCGGATGACCACTGCCATTTGATTTTACCAGATTCGGAAGCATTCCAAGATGTGCAAGGAAAGAGACAT
CGAGGGAAGCACAAGTTCAAAGTAAAAGAAATGTATCTGACAAAGCTGCTGTCGACCAAGGTGGCAATTCATTCTGTGCTTGAAAAACTT
TTTAGAAGCATTTGGAGTTTACCCAACAGCAGAGCTCCATTTGCTATAAAATACTTTTTTGACTTTTTGGACGCCCAGGCTGAAAACAAA
AAAATCACAGATCCTGACGTCGTACATATTTGGAAAACAAACAGCCTTCCTCTTCGCTTCTGGGTAAACATCCTGAAGAACCCTCAGTTT
GTCTTTGACATTAAGAAGACACCACATATAGACGGCTGTTTGTCAGTGATTGCCCAGGCATTCATGGATGCATTTTCTCTCACAGAGCAG
CAACTAGGGAAGGAAGCACCAACTAATAAGCTTCTCTATGCCAAGGATATCCCAACCTACAAAGAAGAAGTAAAATCTTATTACAAAGCA
ATCAGGGATTTGCCTCCATTGTCATCCTCAGAAATGGAAGAATTTTTAACTCAGGAATCTAAGAAACATGAAAATGAATTTAATGAAGAA
GTGGCCTTGACAGAAATTTACAAATACATCGTAAAATATTTTGATGAGATTCTAAATAAACTAGAAAGAGAACGAGGGCTGGAAGAAGCT

>In-frame_GNAS_ENST00000354359_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_3666nt
ATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTG
CAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATG
AGGATCCTGCATGTTAATGGGTTTAATGGAGAGGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGGCAGTGAGAAGGCA
ACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTG
GCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCAT
GCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTG
GACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAG
ACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAAC
GATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCT
CTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAG
AAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGA
GAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGC
TACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGT
CAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAG
TTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCT
TAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAA
TAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAA
AAATTAAATGTGAGCAAAGAAAAAGAAAATGACAACTTCAACATTTCCAAAAAAGACATTGAAATTACTCTCTTCCATGGGGAAAATGGG
CAATTAAATTGCAGTTTTGAAAATATTACTAGAAATCAAGATCTTACCACCATCCTTTGCAAAATTAAAGGCATCAAGACTGCAAGCACC
ATTGCCAACTCTTCTAAGAAAGTTCGGGTCAAGCTGGGAAACCTGGAGCTCTACGTCGAGCAGGAGTCAGTTCCTTCCACATGGTATTTT
CTGATTGTGCTCCCTGTCTTGCTAGTGATTGTCATTTTTGCGGCCGTGGGGGTGACCAGGCACAAATCGAAGGAGCTGAGTCGCAAACAG
AGTCAACAACTAGAATTGCTGGAAAGCGAGCTCCGGAAAGAGATACGTGACGGCTTTGCTGAGCTGCAGATGGATAAATTGGATGTGGTT
GATAGTTTTGGAACTGTTCCCTTCCTTGACTACAAACATTTTGCTCTGAGAACTTTCTTCCCTGAGTCAGGTGGCTTCACCCACATCTTC
ACTGAAGATATGCATAACAGAGACGCCAACGACAAGAATGAAAGTCTCACAGCTTTGGATGCCCTAATCTGTAATAAAAGCTTTCTTGTT
ACTGTCATCCACACCCTTGAAAAGCAGAAGAACTTTTCTGTGAAGGACAGGTGTCTGTTTGCCTCCTTCCTAACCATTGCACTGCAAACC
AAGCTGGTCTACCTGACCAGCATCCTAGAGGTGCTGACCAGGGACTTGATGGAACAGTGTAGTAACATGCAGCCGAAACTCATGCTGAGA
CGCACGGAGTCCGTCGTCGAAAAACTCCTCACAAACTGGATGTCCGTCTGCCTTTCTGGATTTCTCCGGGAGACTGTCGGAGAGCCCTTC
TATTTGCTGGTGACGACTCTGAACCAGAAAATTAACAAGGGTCCCGTGGATGTAATCACTTGCAAAGCCCTGTACACACTTAATGAAGAC
TGGCTGTTGTGGCAGGTTCCGGAATTCAGTACTGTGGCATTAAACGTCGTCTTTGAAAAAATCCCGGAAAACGAGAGTGCAGATGTCTGT
CGGAATATTTCAGTCAATGTTCTCGACTGTGACACCATTGGCCAAGCCAAAGAAAAGATTTTCCAAGCATTCTTAAGCAAAAATGGCTCT
CCTTATGGACTTCAGCTTAATGAAATTGGTCTTGAGCTTCAAATGGGCACACGACAGAAAGAACTTCTGGACATCGACAGTTCCTCCGTG
ATTCTTGAAGATGGAATCACCAAGCTAAACACCATTGGCCACTATGAGATATCAAATGGATCCACTATAAAAGTCTTTAAGAAGATAGCA
AATTTTACTTCAGATGTGGAGTACTCGGATGACCACTGCCATTTGATTTTACCAGATTCGGAAGCATTCCAAGATGTGCAAGGAAAGAGA
CATCGAGGGAAGCACAAGTTCAAAGTAAAAGAAATGTATCTGACAAAGCTGCTGTCGACCAAGGTGGCAATTCATTCTGTGCTTGAAAAA
CTTTTTAGAAGCATTTGGAGTTTACCCAACAGCAGAGCTCCATTTGCTATAAAATACTTTTTTGACTTTTTGGACGCCCAGGCTGAAAAC
AAAAAAATCACAGATCCTGACGTCGTACATATTTGGAAAACAAACAGCCTTCCTCTTCGCTTCTGGGTAAACATCCTGAAGAACCCTCAG
TTTGTCTTTGACATTAAGAAGACACCACATATAGACGGCTGTTTGTCAGTGATTGCCCAGGCATTCATGGATGCATTTTCTCTCACAGAG
CAGCAACTAGGGAAGGAAGCACCAACTAATAAGCTTCTCTATGCCAAGGATATCCCAACCTACAAAGAAGAAGTAAAATCTTATTACAAA
GCAATCAGGGATTTGCCTCCATTGTCATCCTCAGAAATGGAAGAATTTTTAACTCAGGAATCTAAGAAACATGAAAATGAATTTAATGAA
GAAGTGGCCTTGACAGAAATTTACAAATACATCGTAAAATATTTTGATGAGATTCTAAATAAACTAGAAAGAGAACGAGGGCTGGAAGAA

>In-frame_GNAS_ENST00000265620_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_3618nt
ATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTG
CAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATG
AGGATCCTGCATGTTAATGGGTTTAATGGAGATGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACC
ATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATG
AACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGC
TCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAG
GACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGT
GGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATG
GTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATC
TCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTT
GCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTT
CTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTG
TTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCT
TAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCC
CCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAA
AAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGA
AATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAATGACAACTTCAACATTTCC
AAAAAAGACATTGAAATTACTCTCTTCCATGGGGAAAATGGGCAATTAAATTGCAGTTTTGAAAATATTACTAGAAATCAAGATCTTACC
ACCATCCTTTGCAAAATTAAAGGCATCAAGACTGCAAGCACCATTGCCAACTCTTCTAAGAAAGTTCGGGTCAAGCTGGGAAACCTGGAG
CTCTACGTCGAGCAGGAGTCAGTTCCTTCCACATGGTATTTTCTGATTGTGCTCCCTGTCTTGCTAGTGATTGTCATTTTTGCGGCCGTG
GGGGTGACCAGGCACAAATCGAAGGAGCTGAGTCGCAAACAGAGTCAACAACTAGAATTGCTGGAAAGCGAGCTCCGGAAAGAGATACGT
GACGGCTTTGCTGAGCTGCAGATGGATAAATTGGATGTGGTTGATAGTTTTGGAACTGTTCCCTTCCTTGACTACAAACATTTTGCTCTG
AGAACTTTCTTCCCTGAGTCAGGTGGCTTCACCCACATCTTCACTGAAGATATGCATAACAGAGACGCCAACGACAAGAATGAAAGTCTC
ACAGCTTTGGATGCCCTAATCTGTAATAAAAGCTTTCTTGTTACTGTCATCCACACCCTTGAAAAGCAGAAGAACTTTTCTGTGAAGGAC
AGGTGTCTGTTTGCCTCCTTCCTAACCATTGCACTGCAAACCAAGCTGGTCTACCTGACCAGCATCCTAGAGGTGCTGACCAGGGACTTG
ATGGAACAGTGTAGTAACATGCAGCCGAAACTCATGCTGAGACGCACGGAGTCCGTCGTCGAAAAACTCCTCACAAACTGGATGTCCGTC
TGCCTTTCTGGATTTCTCCGGGAGACTGTCGGAGAGCCCTTCTATTTGCTGGTGACGACTCTGAACCAGAAAATTAACAAGGGTCCCGTG
GATGTAATCACTTGCAAAGCCCTGTACACACTTAATGAAGACTGGCTGTTGTGGCAGGTTCCGGAATTCAGTACTGTGGCATTAAACGTC
GTCTTTGAAAAAATCCCGGAAAACGAGAGTGCAGATGTCTGTCGGAATATTTCAGTCAATGTTCTCGACTGTGACACCATTGGCCAAGCC
AAAGAAAAGATTTTCCAAGCATTCTTAAGCAAAAATGGCTCTCCTTATGGACTTCAGCTTAATGAAATTGGTCTTGAGCTTCAAATGGGC
ACACGACAGAAAGAACTTCTGGACATCGACAGTTCCTCCGTGATTCTTGAAGATGGAATCACCAAGCTAAACACCATTGGCCACTATGAG
ATATCAAATGGATCCACTATAAAAGTCTTTAAGAAGATAGCAAATTTTACTTCAGATGTGGAGTACTCGGATGACCACTGCCATTTGATT
TTACCAGATTCGGAAGCATTCCAAGATGTGCAAGGAAAGAGACATCGAGGGAAGCACAAGTTCAAAGTAAAAGAAATGTATCTGACAAAG
CTGCTGTCGACCAAGGTGGCAATTCATTCTGTGCTTGAAAAACTTTTTAGAAGCATTTGGAGTTTACCCAACAGCAGAGCTCCATTTGCT
ATAAAATACTTTTTTGACTTTTTGGACGCCCAGGCTGAAAACAAAAAAATCACAGATCCTGACGTCGTACATATTTGGAAAACAAACAGC
CTTCCTCTTCGCTTCTGGGTAAACATCCTGAAGAACCCTCAGTTTGTCTTTGACATTAAGAAGACACCACATATAGACGGCTGTTTGTCA
GTGATTGCCCAGGCATTCATGGATGCATTTTCTCTCACAGAGCAGCAACTAGGGAAGGAAGCACCAACTAATAAGCTTCTCTATGCCAAG
GATATCCCAACCTACAAAGAAGAAGTAAAATCTTATTACAAAGCAATCAGGGATTTGCCTCCATTGTCATCCTCAGAAATGGAAGAATTT
TTAACTCAGGAATCTAAGAAACATGAAAATGAATTTAATGAAGAAGTGGCCTTGACAGAAATTTACAAATACATCGTAAAATATTTTGAT
GAGATTCTAAATAAACTAGAAAGAGAACGAGGGCTGGAAGAAGCTCAGAAACAACTCTTGCATGTAAAAGTCTTATTTGATGAAAAGAAG

>In-frame_GNAS_ENST00000306090_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_3615nt
ATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTG
CAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATG
AGGATCCTGCATGTTAATGGGTTTAATGGAGACAGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAA
ACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTG
ATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAA
CGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGAT
CAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTG
GGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAAC
ATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACC
ATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAA
TTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAG
TTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGT
GTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAG
CCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCT
TCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAG
GAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAA
TGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAATGACAACTTCAACATTTCCAAA
AAAGACATTGAAATTACTCTCTTCCATGGGGAAAATGGGCAATTAAATTGCAGTTTTGAAAATATTACTAGAAATCAAGATCTTACCACC
ATCCTTTGCAAAATTAAAGGCATCAAGACTGCAAGCACCATTGCCAACTCTTCTAAGAAAGTTCGGGTCAAGCTGGGAAACCTGGAGCTC
TACGTCGAGCAGGAGTCAGTTCCTTCCACATGGTATTTTCTGATTGTGCTCCCTGTCTTGCTAGTGATTGTCATTTTTGCGGCCGTGGGG
GTGACCAGGCACAAATCGAAGGAGCTGAGTCGCAAACAGAGTCAACAACTAGAATTGCTGGAAAGCGAGCTCCGGAAAGAGATACGTGAC
GGCTTTGCTGAGCTGCAGATGGATAAATTGGATGTGGTTGATAGTTTTGGAACTGTTCCCTTCCTTGACTACAAACATTTTGCTCTGAGA
ACTTTCTTCCCTGAGTCAGGTGGCTTCACCCACATCTTCACTGAAGATATGCATAACAGAGACGCCAACGACAAGAATGAAAGTCTCACA
GCTTTGGATGCCCTAATCTGTAATAAAAGCTTTCTTGTTACTGTCATCCACACCCTTGAAAAGCAGAAGAACTTTTCTGTGAAGGACAGG
TGTCTGTTTGCCTCCTTCCTAACCATTGCACTGCAAACCAAGCTGGTCTACCTGACCAGCATCCTAGAGGTGCTGACCAGGGACTTGATG
GAACAGTGTAGTAACATGCAGCCGAAACTCATGCTGAGACGCACGGAGTCCGTCGTCGAAAAACTCCTCACAAACTGGATGTCCGTCTGC
CTTTCTGGATTTCTCCGGGAGACTGTCGGAGAGCCCTTCTATTTGCTGGTGACGACTCTGAACCAGAAAATTAACAAGGGTCCCGTGGAT
GTAATCACTTGCAAAGCCCTGTACACACTTAATGAAGACTGGCTGTTGTGGCAGGTTCCGGAATTCAGTACTGTGGCATTAAACGTCGTC
TTTGAAAAAATCCCGGAAAACGAGAGTGCAGATGTCTGTCGGAATATTTCAGTCAATGTTCTCGACTGTGACACCATTGGCCAAGCCAAA
GAAAAGATTTTCCAAGCATTCTTAAGCAAAAATGGCTCTCCTTATGGACTTCAGCTTAATGAAATTGGTCTTGAGCTTCAAATGGGCACA
CGACAGAAAGAACTTCTGGACATCGACAGTTCCTCCGTGATTCTTGAAGATGGAATCACCAAGCTAAACACCATTGGCCACTATGAGATA
TCAAATGGATCCACTATAAAAGTCTTTAAGAAGATAGCAAATTTTACTTCAGATGTGGAGTACTCGGATGACCACTGCCATTTGATTTTA
CCAGATTCGGAAGCATTCCAAGATGTGCAAGGAAAGAGACATCGAGGGAAGCACAAGTTCAAAGTAAAAGAAATGTATCTGACAAAGCTG
CTGTCGACCAAGGTGGCAATTCATTCTGTGCTTGAAAAACTTTTTAGAAGCATTTGGAGTTTACCCAACAGCAGAGCTCCATTTGCTATA
AAATACTTTTTTGACTTTTTGGACGCCCAGGCTGAAAACAAAAAAATCACAGATCCTGACGTCGTACATATTTGGAAAACAAACAGCCTT
CCTCTTCGCTTCTGGGTAAACATCCTGAAGAACCCTCAGTTTGTCTTTGACATTAAGAAGACACCACATATAGACGGCTGTTTGTCAGTG
ATTGCCCAGGCATTCATGGATGCATTTTCTCTCACAGAGCAGCAACTAGGGAAGGAAGCACCAACTAATAAGCTTCTCTATGCCAAGGAT
ATCCCAACCTACAAAGAAGAAGTAAAATCTTATTACAAAGCAATCAGGGATTTGCCTCCATTGTCATCCTCAGAAATGGAAGAATTTTTA
ACTCAGGAATCTAAGAAACATGAAAATGAATTTAATGAAGAAGTGGCCTTGACAGAAATTTACAAATACATCGTAAAATATTTTGATGAG
ATTCTAAATAAACTAGAAAGAGAACGAGGGCTGGAAGAAGCTCAGAAACAACTCTTGCATGTAAAAGTCTTATTTGATGAAAAGAAGAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_GNAS_ENST00000371100_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_8534nt
AAAGACTCCAAATCAGTCAGGGAGAGGAGTGGAAGGAGCCAAAACGTCCCTGCGAGGCCTGCGCTCACCAGCCCCCTTACCCAAAGTCCC
GGGCCCCTGGCGCCAGGAGCAGGCTCCTGGAGCCGGAGCCAGCTCGGCACTGGAACCGGCGTCCTCTGGTGGCAGAGAGAGAGCGCTACT
GGCGATTTTCGGACCGAATCGGCACGCTCGTCAGATCCAAGCAGGCGGGACTGGCCTGGAGCAAAAAGAAAGAGAGAGGAGGGCGTAAGG
ATAGACCAAGGAAGAGGGGCTGGGGGGCAGCCTGGGGGCATGAAAAGTGGCCAGGAAGGAGCCAAGACTCCACCAGCAACAATTGAGTTG
CTTCAGCCTCAGTCTAGGGTTCCTTCCAGGCCTTGAACCCCCCAACCTCACAAGGGTTGGAAAGTGAGGCCGGTGAACTTTCCAGCTGGT
ACTTTGATTTTAAAATAATAATAATAATTTTTTCACCCTAGTTCGGTTGGGTGCTCCATCTTACGGAGCCCCAAACTTATTTTGAGAGGC
CGCCACCGTGTTATGGGCGTGCGCAACTGCCTCTACGGCAATAATATGTCAGGACAACGCGATATCCCCCCTGAAATCGGGGAACAGCCC
GAGCAACCACCTTTGGAGGCCCCAGGGGCAGCTGCCCCCGGTGCTGGGCCTAGCCCAGCCGAAGAGATGGAGACCGAACCGCCTCACAAC
GAGCCCATCCCCGTCGAGAATGATGGCGAGGCCTGTGGACCCCCAGAGGTCTCCAGACCCAACTTTCAGGTCCTCAACCCGGCATTCAGG
GAAGCTGGAGCCCATGGAAGCTACAGCCCACCTCCTGAGGAAGCAATGCCCTTCGAGGCTGAACAGCCCAGCTTGGGAGGCTTCTGGCCT
ACACTGGAGCAGCCTGGATTCCCCAGTGGGGTCCATGCAGGCCTTGAGGCCTTCGGCCCAGCACTCATGGAGCCCGGAGCCTTCAGTGGT
GCCAGACCAGGCCTGGGAGGATACAGCCCTCCACCAGAAGAAGCTATGCCCTTTGAGTTTGACCAGCCTGCCCAGAGAGGCTGCAGTCAA
CTTCTCTTACAGGTCCCAGACCTTGCTCCAGGAGGCCCAGGTGCTGCAGGGGTCCCCGGAGCTCCTCCCGAGGAGCCCCAAGCCCTCAGG
CCTGCAAAGGCTGGCTCCAGAGGAGGCTACAGCCCTCCCCCTGAGGAGACTATGCCATTTGAGCTTGATGGAGAAGGATTTGGGGACGAC
AGCCCACCCCCGGGGCTTTCCCGAGTTATCGCACAAGTCGACGGCAGCAGCCAGTTCGCGGCAGTCGCGGCCTCGAGTGCGGTCCGCCTC
ACTCCCGCCGCGAACGCGCCTCCCCTCTGGGTCCCAGGCGCCATCGGCAGCCCATCCCAAGAGGCTGTCAGACCTCCTTCTAACTTCACG
GGCAGCAGCCCCTGGATGGAGATCTCCGGACCCCCGTTCGAGATTGGCAGCGCCCCCGCTGGGGTCGACGACACTCCCGTCAACATGGAC
AGCCCCCCAATCGCGCTTGACGGCCCGCCCATCAAGGTCTCCGGAGCCCCAGATAAGAGAGAGCGAGCAGAGAGACCCCCAGTTGAGGAG
GAAGCAGCAGAGATGGAAGGAGCCGCTGATGCCGCGGAGGGAGGAAAAGTACCCTCTCCGGGGTACGGATCCCCTGCCGCCGGGGCAGCC
TCAGCGGATACCGCTGCCAGGGCAGCCCCTGCAGCCCCAGCCGATCCTGACTCCGGGGCAACCCCAGAAGATCCCGACTCCGGGACAGCA
CCAGCCGATCCTGACTCCGGGGCATTCGCAGCCGATCCCGACTCCGGGGCAGCCCCTGCCGCCCCAGCCGATCCCGACTCCGGGGCGGCC
CCTGACGCCCCAGCCGATCCCGACTCCGGGGCGGCCCCTGACGCCCCAGCCGATCCAGATGCCGGGGCGGCCCCTGAGGCTCCCGCCGCC
CCTGCGGCTGCTGAGACCCGGGCAGCCCATGTCGCCCCAGCTGCGCCAGACGCAGGGGCTCCCACTGCCCCAGCCGCTTCTGCCACCCGG
GCAGCCCAAGTCCGCCGGGCGGCCTCTGCAGCCCCTGCCTCCGGGGCCAGACGCAAGATCCATCTCAGACCCCCCAGCCCCGAGATCCAG
GCTGCCGATCCGCCTACTCCGCGGCCTACTCGCGCGTCTGCCTGGCGGGGCAAGTCCGAGAGCAGCCGCGGCCGCCGCGTGTACTACGAT
GAAGGGGTGGCCAGCAGCGACGATGACTCCAGCGGAGACGAGTCCGACGATGGGACCTCCGGATGCCTCCGCTGGTTTCAGCATCGGCGA
AATCGCCGCCGCCGAAAGCCCCAGCGCAACTTACTCCGCAACTTTCTCGTGCAAGCCTTCGGGGGCTGCTTCGGTCGATCTGAGAGTCCC
CAGCCCAAAGCCTCGCGCTCTCTCAAGGTCAAGAAGGTACCCCTGGCGGAGAAGCGCAGACAGATGCGCAAAGAAGCCCTGGAGAAGCGG
GCCCAGAAGCGCGCAGAGAAGAAACGCAGTAAGCTCATCGACAAACAACTCCAGGACGAAAAGATGGGCTACATGTGTACGCACCGCCTG
CTGCTTCTAGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAATGGAGAGGGCGGC
GAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATT
GAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGT
GTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTAC
GAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGC
GATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGAC
GTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTAC
AACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGC
ACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCA
GAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGAT
GAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGC
CGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTA
AAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTC
CCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAA
AAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAAC
AAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAATGACAACTTCAAC
ATTTCCAAAAAAGACATTGAAATTACTCTCTTCCATGGGGAAAATGGGCAATTAAATTGCAGTTTTGAAAATATTACTAGAAATCAAGAT
CTTACCACCATCCTTTGCAAAATTAAAGGCATCAAGACTGCAAGCACCATTGCCAACTCTTCTAAGAAAGTTCGGGTCAAGCTGGGAAAC
CTGGAGCTCTACGTCGAGCAGGAGTCAGTTCCTTCCACATGGTATTTTCTGATTGTGCTCCCTGTCTTGCTAGTGATTGTCATTTTTGCG
GCCGTGGGGGTGACCAGGCACAAATCGAAGGAGCTGAGTCGCAAACAGAGTCAACAACTAGAATTGCTGGAAAGCGAGCTCCGGAAAGAG
ATACGTGACGGCTTTGCTGAGCTGCAGATGGATAAATTGGATGTGGTTGATAGTTTTGGAACTGTTCCCTTCCTTGACTACAAACATTTT
GCTCTGAGAACTTTCTTCCCTGAGTCAGGTGGCTTCACCCACATCTTCACTGAAGATATGCATAACAGAGACGCCAACGACAAGAATGAA
AGTCTCACAGCTTTGGATGCCCTAATCTGTAATAAAAGCTTTCTTGTTACTGTCATCCACACCCTTGAAAAGCAGAAGAACTTTTCTGTG
AAGGACAGGTGTCTGTTTGCCTCCTTCCTAACCATTGCACTGCAAACCAAGCTGGTCTACCTGACCAGCATCCTAGAGGTGCTGACCAGG
GACTTGATGGAACAGTGTAGTAACATGCAGCCGAAACTCATGCTGAGACGCACGGAGTCCGTCGTCGAAAAACTCCTCACAAACTGGATG
TCCGTCTGCCTTTCTGGATTTCTCCGGGAGACTGTCGGAGAGCCCTTCTATTTGCTGGTGACGACTCTGAACCAGAAAATTAACAAGGGT
CCCGTGGATGTAATCACTTGCAAAGCCCTGTACACACTTAATGAAGACTGGCTGTTGTGGCAGGTTCCGGAATTCAGTACTGTGGCATTA
AACGTCGTCTTTGAAAAAATCCCGGAAAACGAGAGTGCAGATGTCTGTCGGAATATTTCAGTCAATGTTCTCGACTGTGACACCATTGGC
CAAGCCAAAGAAAAGATTTTCCAAGCATTCTTAAGCAAAAATGGCTCTCCTTATGGACTTCAGCTTAATGAAATTGGTCTTGAGCTTCAA
ATGGGCACACGACAGAAAGAACTTCTGGACATCGACAGTTCCTCCGTGATTCTTGAAGATGGAATCACCAAGCTAAACACCATTGGCCAC
TATGAGATATCAAATGGATCCACTATAAAAGTCTTTAAGAAGATAGCAAATTTTACTTCAGATGTGGAGTACTCGGATGACCACTGCCAT
TTGATTTTACCAGATTCGGAAGCATTCCAAGATGTGCAAGGAAAGAGACATCGAGGGAAGCACAAGTTCAAAGTAAAAGAAATGTATCTG
ACAAAGCTGCTGTCGACCAAGGTGGCAATTCATTCTGTGCTTGAAAAACTTTTTAGAAGCATTTGGAGTTTACCCAACAGCAGAGCTCCA
TTTGCTATAAAATACTTTTTTGACTTTTTGGACGCCCAGGCTGAAAACAAAAAAATCACAGATCCTGACGTCGTACATATTTGGAAAACA
AACAGCCTTCCTCTTCGCTTCTGGGTAAACATCCTGAAGAACCCTCAGTTTGTCTTTGACATTAAGAAGACACCACATATAGACGGCTGT
TTGTCAGTGATTGCCCAGGCATTCATGGATGCATTTTCTCTCACAGAGCAGCAACTAGGGAAGGAAGCACCAACTAATAAGCTTCTCTAT
GCCAAGGATATCCCAACCTACAAAGAAGAAGTAAAATCTTATTACAAAGCAATCAGGGATTTGCCTCCATTGTCATCCTCAGAAATGGAA
GAATTTTTAACTCAGGAATCTAAGAAACATGAAAATGAATTTAATGAAGAAGTGGCCTTGACAGAAATTTACAAATACATCGTAAAATAT
TTTGATGAGATTCTAAATAAACTAGAAAGAGAACGAGGGCTGGAAGAAGCTCAGAAACAACTCTTGCATGTAAAAGTCTTATTTGATGAA
AAGAAGAAATGCAAGTGGATGTAAGCACTCTGGGGCCTGGCTTAATCTGGCAAAGTTCTTCAGACGACTTGGGAGCAAAATGGCTGCTTG
AGCTACTCTGTGTCGTTAATTTGTTGTTTGCACATAGGTTCCACTTTGGGCACTGTCTTTTTAAGAGACCAAGGCACATGCACAGCTTTT
AGAAAGCATACCAACCCTTGTGCCTGTGTGTATACCGTGGGAACCCTTCTGTAAATAGAGTTGAAGTGGTTGTTGCAAACAGCCTCCTTG
TTTACAGAGAATACAAGGCCAGTAAGCGAATGTCAGTATTGTAACTACAGTCTCCACTTAAGCACAATGATATAAGTGGTTTTGTTTGAA
AACTACAGCTATGTAGCACTTGTGCTACACTGCACCTCTGCATTGTAAAGGGATACTGCCAGTGCTCAAAACAAAATGTGAAATGAGTCA
TTTGGAAACAAGGTGGGGGTGTTAGGGCAACCTCGAGGATTTGCAGCATTGAAACTTTCCCCAGTAGTTCTTGGAAAAGCTGACCGCAGA
ATTTGGTAGTGTACACTTAGCATTTGTGAGTGTGTGTGTGTGTTTAAACCAAAAACTAACAGTGTTGCAACATTGTTGAAAGGGCTCGTG
TTTTTCAGTGGTCATCAACTGCACTCCATCAAACTCACCTCCATTTCACCAAGGAGCTCTAAAGTAAGGAGAGTGGGCTTTATTTAAATG
AACAGCATTTTAACCAGATACTTTGTCCTAATGTATGTTCCTTTTCTTCATCTGTTTTTTCATACTAAATGTATTTGATAGTGGACATGT
TGGATATTATACAAAAAAATCATTAATTCATTTCTGTTCCAAAACCTTTGATCAGAACGATCTGTGGAAGAGTAACTCCATTTCTATATG
AGTGAGTGTCTCCTTGCTTTAGATTTCTGGTGAACCCTGTGGTTATGAATACTTGTGTGTGATTTAAAAAAAAAAAGATACATTTTACAT
TTTATCGAATTGCTGTTCACACTGGAGTATTATATATAAATATATATATTTGAGGCCCAAGGCCTGAAAAATATTAGTATACAACTTGGT
ATCTTAGTCTTACTATGTACTTTTTGAAAGTATTCCTCGCAGGAGAAAGAATTTAAAATACCCATTTTATTCATGCCTTTCTTTTTAAAG
AATTCTCTATCCAGTTATACTGTAGTCTTTTTAGTGCTGATTTTTTAATTCCTGAATTTTTGCTGCTCATGACCAGTTTTAATACCACTG
TGTTTTCCTTCTATTAAACCAGAAGAAGTAAACAGCATAATTGGCAACTCTTGAGCTTTTCTTGTGGCAGGCACCTTTTACCCTTGGTGC
TCCAAATCCCCCATCTAGGAAAGAAAATTTTTTCAAGTCAAATAACATTGATCACATATTCCTTGAAATCATTTACCAACACTGTATGGA
GCATTAGGATTTAAATATGAATTTGTCTTAAAGGCAATTCCTTTTTGCTTCTGTATTATCTGGAAAAGCATGAGAGAGGTGACACCTCAA
CAAACTGATCAGAGAAAATAAGCAGTTACTACCCTGATAGGCACCTTCCCAATCCTGTTGCTTTTGACCATTGTCTGTCCAACGGACACA
CCTCAAACAAACAAAACTACCAAATAGATGACAGATCAGAATAAAGGTGAGAGGTCTGGTCCCCATTGAAGGCTGCTACAGTCTTCAAAG
AGGTGAAGGAGTTCATAAGAGAACAACAGTAGGAAAGTTGAGAGCCAAGGGTAGGAGAGTTGCCCAAAAGACTTCCCCTACTACTTTAGG
GTACTGAAAACTCAAAGGATCAGCTACAGCTTTATCTAAGTATTTACTAAATGCTACATGAGGGTGTCCCTGTCCAGCTTTCTGGCACAT
GAGTCCTGTGTGGAGAGTTACCTCCTCTTCCAGGGACTGTGCTGTTGGGAACTTTGGGCAAGTCACTTACCTCTTTGTGCCTCAATTTCT
GTATAATATTTCTAAGCTACCTCACTGAGGTGGTATGAAGATTCACTAATGTATGTAGCGTGTTTGTCAATCCTCCAGTGAAAAGCACTA
TCTAGATCACATTTTGGATCACATTAGCCAAATGCAGTAAATGGCCAAATTAGATGTGTGCTGAAGACAATCAGTCACTGGGTCTATATT
AAACAGCAACCAGAGCAACAAATGGCAAACAATTTCTATTTTCAAGTTTCTTTGCATATTTTTTTGGTGCAAAACCATTTATAAACTTTT
TTTTCTAACACTAGTGTCTACAGCAGCATTCAAAAAAATTCTGTTACCTTTTCTGTATTAGGATTTAAAGTCTATTTCTTATTGTATACC

>In-frame_GNAS_ENST00000371102_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_7943nt
GTTATGGGCGTGCGCAACTGCCTCTACGGCAATAATATGTCAGGACAACGCGATATCCCCCCTGAAATCGGGGAACAGCCCGAGCAACCA
CCTTTGGAGGCCCCAGGGGCAGCTGCCCCCGGTGCTGGGCCTAGCCCAGCCGAAGAGATGGAGACCGAACCGCCTCACAACGAGCCCATC
CCCGTCGAGAATGATGGCGAGGCCTGTGGACCCCCAGAGGTCTCCAGACCCAACTTTCAGGTCCTCAACCCGGCATTCAGGGAAGCTGGA
GCCCATGGAAGCTACAGCCCACCTCCTGAGGAAGCAATGCCCTTCGAGGCTGAACAGCCCAGCTTGGGAGGCTTCTGGCCTACACTGGAG
CAGCCTGGATTCCCCAGTGGGGTCCATGCAGGCCTTGAGGCCTTCGGCCCAGCACTCATGGAGCCCGGAGCCTTCAGTGGTGCCAGACCA
GGCCTGGGAGGATACAGCCCTCCACCAGAAGAAGCTATGCCCTTTGAGTTTGACCAGCCTGCCCAGAGAGGCTGCAGTCAACTTCTCTTA
CAGGTCCCAGACCTTGCTCCAGGAGGCCCAGGTGCTGCAGGGGTCCCCGGAGCTCCTCCCGAGGAGCCCCAAGCCCTCAGGCCTGCAAAG
GCTGGCTCCAGAGGAGGCTACAGCCCTCCCCCTGAGGAGACTATGCCATTTGAGCTTGATGGAGAAGGATTTGGGGACGACAGCCCACCC
CCGGGGCTTTCCCGAGTTATCGCACAAGTCGACGGCAGCAGCCAGTTCGCGGCAGTCGCGGCCTCGAGTGCGGTCCGCCTCACTCCCGCC
GCGAACGCGCCTCCCCTCTGGGTCCCAGGCGCCATCGGCAGCCCATCCCAAGAGGCTGTCAGACCTCCTTCTAACTTCACGGGCAGCAGC
CCCTGGATGGAGATCTCCGGACCCCCGTTCGAGATTGGCAGCGCCCCCGCTGGGGTCGACGACACTCCCGTCAACATGGACAGCCCCCCA
ATCGCGCTTGACGGCCCGCCCATCAAGGTCTCCGGAGCCCCAGATAAGAGAGAGCGAGCAGAGAGACCCCCAGTTGAGGAGGAAGCAGCA
GAGATGGAAGGAGCCGCTGATGCCGCGGAGGGAGGAAAAGTACCCTCTCCGGGGTACGGATCCCCTGCCGCCGGGGCAGCCTCAGCGGAT
ACCGCTGCCAGGGCAGCCCCTGCAGCCCCAGCCGATCCTGACTCCGGGGCAACCCCAGAAGATCCCGACTCCGGGACAGCACCAGCCGAT
CCTGACTCCGGGGCATTCGCAGCCGATCCCGACTCCGGGGCAGCCCCTGCCGCCCCAGCCGATCCCGACTCCGGGGCGGCCCCTGACGCC
CCAGCCGATCCCGACTCCGGGGCGGCCCCTGACGCCCCAGCCGATCCAGATGCCGGGGCGGCCCCTGAGGCTCCCGCCGCCCCTGCGGCT
GCTGAGACCCGGGCAGCCCATGTCGCCCCAGCTGCGCCAGACGCAGGGGCTCCCACTGCCCCAGCCGCTTCTGCCACCCGGGCAGCCCAA
GTCCGCCGGGCGGCCTCTGCAGCCCCTGCCTCCGGGGCCAGACGCAAGATCCATCTCAGACCCCCCAGCCCCGAGATCCAGGCTGCCGAT
CCGCCTACTCCGCGGCCTACTCGCGCGTCTGCCTGGCGGGGCAAGTCCGAGAGCAGCCGCGGCCGCCGCGTGTACTACGATGAAGGGGTG
GCCAGCAGCGACGATGACTCCAGCGGAGACGAGTCCGACGATGGGACCTCCGGATGCCTCCGCTGGTTTCAGCATCGGCGAAATCGCCGC
CGCCGAAAGCCCCAGCGCAACTTACTCCGCAACTTTCTCGTGCAAGCCTTCGGGGGCTGCTTCGGTCGATCTGAGAGTCCCCAGCCCAAA
GCCTCGCGCTCTCTCAAGGTCAAGAAGGTACCCCTGGCGGAGAAGCGCAGACAGATGCGCAAAGAAGCCCTGGAGAAGCGGGCCCAGAAG
CGCGCAGAGAAGAAACGCAGTAAGCTCATCGACAAACAACTCCAGGACGAAAAGATGGGCTACATGTGTACGCACCGCCTGCTGCTTCTA
GGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAATGGAGACAGTGAGAAGGCAACC
AAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCC
AACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCC
AAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGAC
AAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACC
AAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGAT
GTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTG
AACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAA
GTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAG
GACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTAC
CCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAG
TACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTA
ATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAG
ATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAA
AACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAA
TTAAATGTGAGCAAAGAAAAAGAAAATGACAACTTCAACATTTCCAAAAAAGACATTGAAATTACTCTCTTCCATGGGGAAAATGGGCAA
TTAAATTGCAGTTTTGAAAATATTACTAGAAATCAAGATCTTACCACCATCCTTTGCAAAATTAAAGGCATCAAGACTGCAAGCACCATT
GCCAACTCTTCTAAGAAAGTTCGGGTCAAGCTGGGAAACCTGGAGCTCTACGTCGAGCAGGAGTCAGTTCCTTCCACATGGTATTTTCTG
ATTGTGCTCCCTGTCTTGCTAGTGATTGTCATTTTTGCGGCCGTGGGGGTGACCAGGCACAAATCGAAGGAGCTGAGTCGCAAACAGAGT
CAACAACTAGAATTGCTGGAAAGCGAGCTCCGGAAAGAGATACGTGACGGCTTTGCTGAGCTGCAGATGGATAAATTGGATGTGGTTGAT
AGTTTTGGAACTGTTCCCTTCCTTGACTACAAACATTTTGCTCTGAGAACTTTCTTCCCTGAGTCAGGTGGCTTCACCCACATCTTCACT
GAAGATATGCATAACAGAGACGCCAACGACAAGAATGAAAGTCTCACAGCTTTGGATGCCCTAATCTGTAATAAAAGCTTTCTTGTTACT
GTCATCCACACCCTTGAAAAGCAGAAGAACTTTTCTGTGAAGGACAGGTGTCTGTTTGCCTCCTTCCTAACCATTGCACTGCAAACCAAG
CTGGTCTACCTGACCAGCATCCTAGAGGTGCTGACCAGGGACTTGATGGAACAGTGTAGTAACATGCAGCCGAAACTCATGCTGAGACGC
ACGGAGTCCGTCGTCGAAAAACTCCTCACAAACTGGATGTCCGTCTGCCTTTCTGGATTTCTCCGGGAGACTGTCGGAGAGCCCTTCTAT
TTGCTGGTGACGACTCTGAACCAGAAAATTAACAAGGGTCCCGTGGATGTAATCACTTGCAAAGCCCTGTACACACTTAATGAAGACTGG
CTGTTGTGGCAGGTTCCGGAATTCAGTACTGTGGCATTAAACGTCGTCTTTGAAAAAATCCCGGAAAACGAGAGTGCAGATGTCTGTCGG
AATATTTCAGTCAATGTTCTCGACTGTGACACCATTGGCCAAGCCAAAGAAAAGATTTTCCAAGCATTCTTAAGCAAAAATGGCTCTCCT
TATGGACTTCAGCTTAATGAAATTGGTCTTGAGCTTCAAATGGGCACACGACAGAAAGAACTTCTGGACATCGACAGTTCCTCCGTGATT
CTTGAAGATGGAATCACCAAGCTAAACACCATTGGCCACTATGAGATATCAAATGGATCCACTATAAAAGTCTTTAAGAAGATAGCAAAT
TTTACTTCAGATGTGGAGTACTCGGATGACCACTGCCATTTGATTTTACCAGATTCGGAAGCATTCCAAGATGTGCAAGGAAAGAGACAT
CGAGGGAAGCACAAGTTCAAAGTAAAAGAAATGTATCTGACAAAGCTGCTGTCGACCAAGGTGGCAATTCATTCTGTGCTTGAAAAACTT
TTTAGAAGCATTTGGAGTTTACCCAACAGCAGAGCTCCATTTGCTATAAAATACTTTTTTGACTTTTTGGACGCCCAGGCTGAAAACAAA
AAAATCACAGATCCTGACGTCGTACATATTTGGAAAACAAACAGCCTTCCTCTTCGCTTCTGGGTAAACATCCTGAAGAACCCTCAGTTT
GTCTTTGACATTAAGAAGACACCACATATAGACGGCTGTTTGTCAGTGATTGCCCAGGCATTCATGGATGCATTTTCTCTCACAGAGCAG
CAACTAGGGAAGGAAGCACCAACTAATAAGCTTCTCTATGCCAAGGATATCCCAACCTACAAAGAAGAAGTAAAATCTTATTACAAAGCA
ATCAGGGATTTGCCTCCATTGTCATCCTCAGAAATGGAAGAATTTTTAACTCAGGAATCTAAGAAACATGAAAATGAATTTAATGAAGAA
GTGGCCTTGACAGAAATTTACAAATACATCGTAAAATATTTTGATGAGATTCTAAATAAACTAGAAAGAGAACGAGGGCTGGAAGAAGCT
CAGAAACAACTCTTGCATGTAAAAGTCTTATTTGATGAAAAGAAGAAATGCAAGTGGATGTAAGCACTCTGGGGCCTGGCTTAATCTGGC
AAAGTTCTTCAGACGACTTGGGAGCAAAATGGCTGCTTGAGCTACTCTGTGTCGTTAATTTGTTGTTTGCACATAGGTTCCACTTTGGGC
ACTGTCTTTTTAAGAGACCAAGGCACATGCACAGCTTTTAGAAAGCATACCAACCCTTGTGCCTGTGTGTATACCGTGGGAACCCTTCTG
TAAATAGAGTTGAAGTGGTTGTTGCAAACAGCCTCCTTGTTTACAGAGAATACAAGGCCAGTAAGCGAATGTCAGTATTGTAACTACAGT
CTCCACTTAAGCACAATGATATAAGTGGTTTTGTTTGAAAACTACAGCTATGTAGCACTTGTGCTACACTGCACCTCTGCATTGTAAAGG
GATACTGCCAGTGCTCAAAACAAAATGTGAAATGAGTCATTTGGAAACAAGGTGGGGGTGTTAGGGCAACCTCGAGGATTTGCAGCATTG
AAACTTTCCCCAGTAGTTCTTGGAAAAGCTGACCGCAGAATTTGGTAGTGTACACTTAGCATTTGTGAGTGTGTGTGTGTGTTTAAACCA
AAAACTAACAGTGTTGCAACATTGTTGAAAGGGCTCGTGTTTTTCAGTGGTCATCAACTGCACTCCATCAAACTCACCTCCATTTCACCA
AGGAGCTCTAAAGTAAGGAGAGTGGGCTTTATTTAAATGAACAGCATTTTAACCAGATACTTTGTCCTAATGTATGTTCCTTTTCTTCAT
CTGTTTTTTCATACTAAATGTATTTGATAGTGGACATGTTGGATATTATACAAAAAAATCATTAATTCATTTCTGTTCCAAAACCTTTGA
TCAGAACGATCTGTGGAAGAGTAACTCCATTTCTATATGAGTGAGTGTCTCCTTGCTTTAGATTTCTGGTGAACCCTGTGGTTATGAATA
CTTGTGTGTGATTTAAAAAAAAAAAGATACATTTTACATTTTATCGAATTGCTGTTCACACTGGAGTATTATATATAAATATATATATTT
GAGGCCCAAGGCCTGAAAAATATTAGTATACAACTTGGTATCTTAGTCTTACTATGTACTTTTTGAAAGTATTCCTCGCAGGAGAAAGAA
TTTAAAATACCCATTTTATTCATGCCTTTCTTTTTAAAGAATTCTCTATCCAGTTATACTGTAGTCTTTTTAGTGCTGATTTTTTAATTC
CTGAATTTTTGCTGCTCATGACCAGTTTTAATACCACTGTGTTTTCCTTCTATTAAACCAGAAGAAGTAAACAGCATAATTGGCAACTCT
TGAGCTTTTCTTGTGGCAGGCACCTTTTACCCTTGGTGCTCCAAATCCCCCATCTAGGAAAGAAAATTTTTTCAAGTCAAATAACATTGA
TCACATATTCCTTGAAATCATTTACCAACACTGTATGGAGCATTAGGATTTAAATATGAATTTGTCTTAAAGGCAATTCCTTTTTGCTTC
TGTATTATCTGGAAAAGCATGAGAGAGGTGACACCTCAACAAACTGATCAGAGAAAATAAGCAGTTACTACCCTGATAGGCACCTTCCCA
ATCCTGTTGCTTTTGACCATTGTCTGTCCAACGGACACACCTCAAACAAACAAAACTACCAAATAGATGACAGATCAGAATAAAGGTGAG
AGGTCTGGTCCCCATTGAAGGCTGCTACAGTCTTCAAAGAGGTGAAGGAGTTCATAAGAGAACAACAGTAGGAAAGTTGAGAGCCAAGGG
TAGGAGAGTTGCCCAAAAGACTTCCCCTACTACTTTAGGGTACTGAAAACTCAAAGGATCAGCTACAGCTTTATCTAAGTATTTACTAAA
TGCTACATGAGGGTGTCCCTGTCCAGCTTTCTGGCACATGAGTCCTGTGTGGAGAGTTACCTCCTCTTCCAGGGACTGTGCTGTTGGGAA
CTTTGGGCAAGTCACTTACCTCTTTGTGCCTCAATTTCTGTATAATATTTCTAAGCTACCTCACTGAGGTGGTATGAAGATTCACTAATG
TATGTAGCGTGTTTGTCAATCCTCCAGTGAAAAGCACTATCTAGATCACATTTTGGATCACATTAGCCAAATGCAGTAAATGGCCAAATT
AGATGTGTGCTGAAGACAATCAGTCACTGGGTCTATATTAAACAGCAACCAGAGCAACAAATGGCAAACAATTTCTATTTTCAAGTTTCT
TTGCATATTTTTTTGGTGCAAAACCATTTATAAACTTTTTTTTCTAACACTAGTGTCTACAGCAGCATTCAAAAAAATTCTGTTACCTTT
TCTGTATTAGGATTTAAAGTCTATTTCTTATTGTATACCTGATTGAAGCTGTTCTTGGAGATGAATGTTTTAAATGTCTATATCCAAAAA

>In-frame_GNAS_ENST00000371095_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_6436nt
CTCGCCGCCGCCGCCTCCTCCTCCCCCCGCCTCCCCCCGCCCGCCGCGGCGCTTTTGGCTCGGGGCGGCGGCGGGGGCCCGGCCGAGGCA
ATAAGAGCGGCGGCGGCGGCAGCGGCGGCAGCAGCTCCCGCAGCTCCTGCTCTGGTCCGCCTCGGCCCGGCGGCGGCCATCAGCCCCCTC
GGCCTCGGCTCGAGGGGCGGGGAGCTGCGCGCGCCCCTCGGTCCGACCGACACCCTCCCCTTCCCGCCCGTCCGCGCGCCCCGCGGCCCG
CGGCCCGCAGTCCGCCCCGCGCGCTCCTTGCCGAGGAGCCGAGCCCGCGCCCGGCCCGCCCGCCCGGCGCTGCCCCGGCCCTCCCGGCCC
GCGTGAGGCCGCCCGCGCCCGCCGCCGCCGCAGCCCGGCCGCGCCCCGCCGCCGCCGCCGCCGCCATGGGCTGCCTCGGGAACAGTAAGA
CCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTGCAGAAGGACAAGCAGGTCTACCGGG
CCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTA
ATGGAGACAGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACC
TGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCC
CTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTG
ACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCC
TGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCA
AGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGA
CCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACA
AGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGG
ATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTG
GAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCA
TTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTG
AAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCC
CCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTC
TCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGC
ATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAATGACAACTTCAACATTTCCAAAAAAGACATTGAAATTACTC
TCTTCCATGGGGAAAATGGGCAATTAAATTGCAGTTTTGAAAATATTACTAGAAATCAAGATCTTACCACCATCCTTTGCAAAATTAAAG
GCATCAAGACTGCAAGCACCATTGCCAACTCTTCTAAGAAAGTTCGGGTCAAGCTGGGAAACCTGGAGCTCTACGTCGAGCAGGAGTCAG
TTCCTTCCACATGGTATTTTCTGATTGTGCTCCCTGTCTTGCTAGTGATTGTCATTTTTGCGGCCGTGGGGGTGACCAGGCACAAATCGA
AGGAGCTGAGTCGCAAACAGAGTCAACAACTAGAATTGCTGGAAAGCGAGCTCCGGAAAGAGATACGTGACGGCTTTGCTGAGCTGCAGA
TGGATAAATTGGATGTGGTTGATAGTTTTGGAACTGTTCCCTTCCTTGACTACAAACATTTTGCTCTGAGAACTTTCTTCCCTGAGTCAG
GTGGCTTCACCCACATCTTCACTGAAGATATGCATAACAGAGACGCCAACGACAAGAATGAAAGTCTCACAGCTTTGGATGCCCTAATCT
GTAATAAAAGCTTTCTTGTTACTGTCATCCACACCCTTGAAAAGCAGAAGAACTTTTCTGTGAAGGACAGGTGTCTGTTTGCCTCCTTCC
TAACCATTGCACTGCAAACCAAGCTGGTCTACCTGACCAGCATCCTAGAGGTGCTGACCAGGGACTTGATGGAACAGTGTAGTAACATGC
AGCCGAAACTCATGCTGAGACGCACGGAGTCCGTCGTCGAAAAACTCCTCACAAACTGGATGTCCGTCTGCCTTTCTGGATTTCTCCGGG
AGACTGTCGGAGAGCCCTTCTATTTGCTGGTGACGACTCTGAACCAGAAAATTAACAAGGGTCCCGTGGATGTAATCACTTGCAAAGCCC
TGTACACACTTAATGAAGACTGGCTGTTGTGGCAGGTTCCGGAATTCAGTACTGTGGCATTAAACGTCGTCTTTGAAAAAATCCCGGAAA
ACGAGAGTGCAGATGTCTGTCGGAATATTTCAGTCAATGTTCTCGACTGTGACACCATTGGCCAAGCCAAAGAAAAGATTTTCCAAGCAT
TCTTAAGCAAAAATGGCTCTCCTTATGGACTTCAGCTTAATGAAATTGGTCTTGAGCTTCAAATGGGCACACGACAGAAAGAACTTCTGG
ACATCGACAGTTCCTCCGTGATTCTTGAAGATGGAATCACCAAGCTAAACACCATTGGCCACTATGAGATATCAAATGGATCCACTATAA
AAGTCTTTAAGAAGATAGCAAATTTTACTTCAGATGTGGAGTACTCGGATGACCACTGCCATTTGATTTTACCAGATTCGGAAGCATTCC
AAGATGTGCAAGGAAAGAGACATCGAGGGAAGCACAAGTTCAAAGTAAAAGAAATGTATCTGACAAAGCTGCTGTCGACCAAGGTGGCAA
TTCATTCTGTGCTTGAAAAACTTTTTAGAAGCATTTGGAGTTTACCCAACAGCAGAGCTCCATTTGCTATAAAATACTTTTTTGACTTTT
TGGACGCCCAGGCTGAAAACAAAAAAATCACAGATCCTGACGTCGTACATATTTGGAAAACAAACAGCCTTCCTCTTCGCTTCTGGGTAA
ACATCCTGAAGAACCCTCAGTTTGTCTTTGACATTAAGAAGACACCACATATAGACGGCTGTTTGTCAGTGATTGCCCAGGCATTCATGG
ATGCATTTTCTCTCACAGAGCAGCAACTAGGGAAGGAAGCACCAACTAATAAGCTTCTCTATGCCAAGGATATCCCAACCTACAAAGAAG
AAGTAAAATCTTATTACAAAGCAATCAGGGATTTGCCTCCATTGTCATCCTCAGAAATGGAAGAATTTTTAACTCAGGAATCTAAGAAAC
ATGAAAATGAATTTAATGAAGAAGTGGCCTTGACAGAAATTTACAAATACATCGTAAAATATTTTGATGAGATTCTAAATAAACTAGAAA
GAGAACGAGGGCTGGAAGAAGCTCAGAAACAACTCTTGCATGTAAAAGTCTTATTTGATGAAAAGAAGAAATGCAAGTGGATGTAAGCAC
TCTGGGGCCTGGCTTAATCTGGCAAAGTTCTTCAGACGACTTGGGAGCAAAATGGCTGCTTGAGCTACTCTGTGTCGTTAATTTGTTGTT
TGCACATAGGTTCCACTTTGGGCACTGTCTTTTTAAGAGACCAAGGCACATGCACAGCTTTTAGAAAGCATACCAACCCTTGTGCCTGTG
TGTATACCGTGGGAACCCTTCTGTAAATAGAGTTGAAGTGGTTGTTGCAAACAGCCTCCTTGTTTACAGAGAATACAAGGCCAGTAAGCG
AATGTCAGTATTGTAACTACAGTCTCCACTTAAGCACAATGATATAAGTGGTTTTGTTTGAAAACTACAGCTATGTAGCACTTGTGCTAC
ACTGCACCTCTGCATTGTAAAGGGATACTGCCAGTGCTCAAAACAAAATGTGAAATGAGTCATTTGGAAACAAGGTGGGGGTGTTAGGGC
AACCTCGAGGATTTGCAGCATTGAAACTTTCCCCAGTAGTTCTTGGAAAAGCTGACCGCAGAATTTGGTAGTGTACACTTAGCATTTGTG
AGTGTGTGTGTGTGTTTAAACCAAAAACTAACAGTGTTGCAACATTGTTGAAAGGGCTCGTGTTTTTCAGTGGTCATCAACTGCACTCCA
TCAAACTCACCTCCATTTCACCAAGGAGCTCTAAAGTAAGGAGAGTGGGCTTTATTTAAATGAACAGCATTTTAACCAGATACTTTGTCC
TAATGTATGTTCCTTTTCTTCATCTGTTTTTTCATACTAAATGTATTTGATAGTGGACATGTTGGATATTATACAAAAAAATCATTAATT
CATTTCTGTTCCAAAACCTTTGATCAGAACGATCTGTGGAAGAGTAACTCCATTTCTATATGAGTGAGTGTCTCCTTGCTTTAGATTTCT
GGTGAACCCTGTGGTTATGAATACTTGTGTGTGATTTAAAAAAAAAAAGATACATTTTACATTTTATCGAATTGCTGTTCACACTGGAGT
ATTATATATAAATATATATATTTGAGGCCCAAGGCCTGAAAAATATTAGTATACAACTTGGTATCTTAGTCTTACTATGTACTTTTTGAA
AGTATTCCTCGCAGGAGAAAGAATTTAAAATACCCATTTTATTCATGCCTTTCTTTTTAAAGAATTCTCTATCCAGTTATACTGTAGTCT
TTTTAGTGCTGATTTTTTAATTCCTGAATTTTTGCTGCTCATGACCAGTTTTAATACCACTGTGTTTTCCTTCTATTAAACCAGAAGAAG
TAAACAGCATAATTGGCAACTCTTGAGCTTTTCTTGTGGCAGGCACCTTTTACCCTTGGTGCTCCAAATCCCCCATCTAGGAAAGAAAAT
TTTTTCAAGTCAAATAACATTGATCACATATTCCTTGAAATCATTTACCAACACTGTATGGAGCATTAGGATTTAAATATGAATTTGTCT
TAAAGGCAATTCCTTTTTGCTTCTGTATTATCTGGAAAAGCATGAGAGAGGTGACACCTCAACAAACTGATCAGAGAAAATAAGCAGTTA
CTACCCTGATAGGCACCTTCCCAATCCTGTTGCTTTTGACCATTGTCTGTCCAACGGACACACCTCAAACAAACAAAACTACCAAATAGA
TGACAGATCAGAATAAAGGTGAGAGGTCTGGTCCCCATTGAAGGCTGCTACAGTCTTCAAAGAGGTGAAGGAGTTCATAAGAGAACAACA
GTAGGAAAGTTGAGAGCCAAGGGTAGGAGAGTTGCCCAAAAGACTTCCCCTACTACTTTAGGGTACTGAAAACTCAAAGGATCAGCTACA
GCTTTATCTAAGTATTTACTAAATGCTACATGAGGGTGTCCCTGTCCAGCTTTCTGGCACATGAGTCCTGTGTGGAGAGTTACCTCCTCT
TCCAGGGACTGTGCTGTTGGGAACTTTGGGCAAGTCACTTACCTCTTTGTGCCTCAATTTCTGTATAATATTTCTAAGCTACCTCACTGA
GGTGGTATGAAGATTCACTAATGTATGTAGCGTGTTTGTCAATCCTCCAGTGAAAAGCACTATCTAGATCACATTTTGGATCACATTAGC
CAAATGCAGTAAATGGCCAAATTAGATGTGTGCTGAAGACAATCAGTCACTGGGTCTATATTAAACAGCAACCAGAGCAACAAATGGCAA
ACAATTTCTATTTTCAAGTTTCTTTGCATATTTTTTTGGTGCAAAACCATTTATAAACTTTTTTTTCTAACACTAGTGTCTACAGCAGCA
TTCAAAAAAATTCTGTTACCTTTTCTGTATTAGGATTTAAAGTCTATTTCTTATTGTATACCTGATTGAAGCTGTTCTTGGAGATGAATG

>In-frame_GNAS_ENST00000371085_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_6477nt
TCGCCGCCGCCGCCTCCTCCTCCCCCCGCCTCCCCCCGCCCGCCGCGGCGCTTTTGGCTCGGGGCGGCGGCGGGGGCCCGGCCGAGGCAA
TAAGAGCGGCGGCGGCGGCAGCGGCGGCAGCAGCTCCCGCAGCTCCTGCTCTGGTCCGCCTCGGCCCGGCGGCGGCCATCAGCCCCCTCG
GCCTCGGCTCGAGGGGCGGGGAGCTGCGCGCGCCCCTCGGTCCGACCGACACCCTCCCCTTCCCGCCCGTCCGCGCGCCCCGCGGCCCGC
GGCCCGCAGTCCGCCCCGCGCGCTCCTTGCCGAGGAGCCGAGCCCGCGCCCGGCCCGCCCGCCCGGCGCTGCCCCGGCCCTCCCGGCCCG
CGTGAGGCCGCCCGCGCCCGCCGCCGCCGCAGCCCGGCCGCGCCCCGCCGCCGCCGCCGCCGCCATGGGCTGCCTCGGGAACAGTAAGAC
CGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTGCAGAAGGACAAGCAGGTCTACCGGGC
CACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAA
TGGAGAGGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCT
GAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGA
CTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGT
GCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGA
CTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTT
CCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGC
CAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAA
CAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGA
GGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTA
CTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACAC
TGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCC
CCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAAC
AAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGG
CGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATG
AAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAA
TGACAACTTCAACATTTCCAAAAAAGACATTGAAATTACTCTCTTCCATGGGGAAAATGGGCAATTAAATTGCAGTTTTGAAAATATTAC
TAGAAATCAAGATCTTACCACCATCCTTTGCAAAATTAAAGGCATCAAGACTGCAAGCACCATTGCCAACTCTTCTAAGAAAGTTCGGGT
CAAGCTGGGAAACCTGGAGCTCTACGTCGAGCAGGAGTCAGTTCCTTCCACATGGTATTTTCTGATTGTGCTCCCTGTCTTGCTAGTGAT
TGTCATTTTTGCGGCCGTGGGGGTGACCAGGCACAAATCGAAGGAGCTGAGTCGCAAACAGAGTCAACAACTAGAATTGCTGGAAAGCGA
GCTCCGGAAAGAGATACGTGACGGCTTTGCTGAGCTGCAGATGGATAAATTGGATGTGGTTGATAGTTTTGGAACTGTTCCCTTCCTTGA
CTACAAACATTTTGCTCTGAGAACTTTCTTCCCTGAGTCAGGTGGCTTCACCCACATCTTCACTGAAGATATGCATAACAGAGACGCCAA
CGACAAGAATGAAAGTCTCACAGCTTTGGATGCCCTAATCTGTAATAAAAGCTTTCTTGTTACTGTCATCCACACCCTTGAAAAGCAGAA
GAACTTTTCTGTGAAGGACAGGTGTCTGTTTGCCTCCTTCCTAACCATTGCACTGCAAACCAAGCTGGTCTACCTGACCAGCATCCTAGA
GGTGCTGACCAGGGACTTGATGGAACAGTGTAGTAACATGCAGCCGAAACTCATGCTGAGACGCACGGAGTCCGTCGTCGAAAAACTCCT
CACAAACTGGATGTCCGTCTGCCTTTCTGGATTTCTCCGGGAGACTGTCGGAGAGCCCTTCTATTTGCTGGTGACGACTCTGAACCAGAA
AATTAACAAGGGTCCCGTGGATGTAATCACTTGCAAAGCCCTGTACACACTTAATGAAGACTGGCTGTTGTGGCAGGTTCCGGAATTCAG
TACTGTGGCATTAAACGTCGTCTTTGAAAAAATCCCGGAAAACGAGAGTGCAGATGTCTGTCGGAATATTTCAGTCAATGTTCTCGACTG
TGACACCATTGGCCAAGCCAAAGAAAAGATTTTCCAAGCATTCTTAAGCAAAAATGGCTCTCCTTATGGACTTCAGCTTAATGAAATTGG
TCTTGAGCTTCAAATGGGCACACGACAGAAAGAACTTCTGGACATCGACAGTTCCTCCGTGATTCTTGAAGATGGAATCACCAAGCTAAA
CACCATTGGCCACTATGAGATATCAAATGGATCCACTATAAAAGTCTTTAAGAAGATAGCAAATTTTACTTCAGATGTGGAGTACTCGGA
TGACCACTGCCATTTGATTTTACCAGATTCGGAAGCATTCCAAGATGTGCAAGGAAAGAGACATCGAGGGAAGCACAAGTTCAAAGTAAA
AGAAATGTATCTGACAAAGCTGCTGTCGACCAAGGTGGCAATTCATTCTGTGCTTGAAAAACTTTTTAGAAGCATTTGGAGTTTACCCAA
CAGCAGAGCTCCATTTGCTATAAAATACTTTTTTGACTTTTTGGACGCCCAGGCTGAAAACAAAAAAATCACAGATCCTGACGTCGTACA
TATTTGGAAAACAAACAGCCTTCCTCTTCGCTTCTGGGTAAACATCCTGAAGAACCCTCAGTTTGTCTTTGACATTAAGAAGACACCACA
TATAGACGGCTGTTTGTCAGTGATTGCCCAGGCATTCATGGATGCATTTTCTCTCACAGAGCAGCAACTAGGGAAGGAAGCACCAACTAA
TAAGCTTCTCTATGCCAAGGATATCCCAACCTACAAAGAAGAAGTAAAATCTTATTACAAAGCAATCAGGGATTTGCCTCCATTGTCATC
CTCAGAAATGGAAGAATTTTTAACTCAGGAATCTAAGAAACATGAAAATGAATTTAATGAAGAAGTGGCCTTGACAGAAATTTACAAATA
CATCGTAAAATATTTTGATGAGATTCTAAATAAACTAGAAAGAGAACGAGGGCTGGAAGAAGCTCAGAAACAACTCTTGCATGTAAAAGT
CTTATTTGATGAAAAGAAGAAATGCAAGTGGATGTAAGCACTCTGGGGCCTGGCTTAATCTGGCAAAGTTCTTCAGACGACTTGGGAGCA
AAATGGCTGCTTGAGCTACTCTGTGTCGTTAATTTGTTGTTTGCACATAGGTTCCACTTTGGGCACTGTCTTTTTAAGAGACCAAGGCAC
ATGCACAGCTTTTAGAAAGCATACCAACCCTTGTGCCTGTGTGTATACCGTGGGAACCCTTCTGTAAATAGAGTTGAAGTGGTTGTTGCA
AACAGCCTCCTTGTTTACAGAGAATACAAGGCCAGTAAGCGAATGTCAGTATTGTAACTACAGTCTCCACTTAAGCACAATGATATAAGT
GGTTTTGTTTGAAAACTACAGCTATGTAGCACTTGTGCTACACTGCACCTCTGCATTGTAAAGGGATACTGCCAGTGCTCAAAACAAAAT
GTGAAATGAGTCATTTGGAAACAAGGTGGGGGTGTTAGGGCAACCTCGAGGATTTGCAGCATTGAAACTTTCCCCAGTAGTTCTTGGAAA
AGCTGACCGCAGAATTTGGTAGTGTACACTTAGCATTTGTGAGTGTGTGTGTGTGTTTAAACCAAAAACTAACAGTGTTGCAACATTGTT
GAAAGGGCTCGTGTTTTTCAGTGGTCATCAACTGCACTCCATCAAACTCACCTCCATTTCACCAAGGAGCTCTAAAGTAAGGAGAGTGGG
CTTTATTTAAATGAACAGCATTTTAACCAGATACTTTGTCCTAATGTATGTTCCTTTTCTTCATCTGTTTTTTCATACTAAATGTATTTG
ATAGTGGACATGTTGGATATTATACAAAAAAATCATTAATTCATTTCTGTTCCAAAACCTTTGATCAGAACGATCTGTGGAAGAGTAACT
CCATTTCTATATGAGTGAGTGTCTCCTTGCTTTAGATTTCTGGTGAACCCTGTGGTTATGAATACTTGTGTGTGATTTAAAAAAAAAAAG
ATACATTTTACATTTTATCGAATTGCTGTTCACACTGGAGTATTATATATAAATATATATATTTGAGGCCCAAGGCCTGAAAAATATTAG
TATACAACTTGGTATCTTAGTCTTACTATGTACTTTTTGAAAGTATTCCTCGCAGGAGAAAGAATTTAAAATACCCATTTTATTCATGCC
TTTCTTTTTAAAGAATTCTCTATCCAGTTATACTGTAGTCTTTTTAGTGCTGATTTTTTAATTCCTGAATTTTTGCTGCTCATGACCAGT
TTTAATACCACTGTGTTTTCCTTCTATTAAACCAGAAGAAGTAAACAGCATAATTGGCAACTCTTGAGCTTTTCTTGTGGCAGGCACCTT
TTACCCTTGGTGCTCCAAATCCCCCATCTAGGAAAGAAAATTTTTTCAAGTCAAATAACATTGATCACATATTCCTTGAAATCATTTACC
AACACTGTATGGAGCATTAGGATTTAAATATGAATTTGTCTTAAAGGCAATTCCTTTTTGCTTCTGTATTATCTGGAAAAGCATGAGAGA
GGTGACACCTCAACAAACTGATCAGAGAAAATAAGCAGTTACTACCCTGATAGGCACCTTCCCAATCCTGTTGCTTTTGACCATTGTCTG
TCCAACGGACACACCTCAAACAAACAAAACTACCAAATAGATGACAGATCAGAATAAAGGTGAGAGGTCTGGTCCCCATTGAAGGCTGCT
ACAGTCTTCAAAGAGGTGAAGGAGTTCATAAGAGAACAACAGTAGGAAAGTTGAGAGCCAAGGGTAGGAGAGTTGCCCAAAAGACTTCCC
CTACTACTTTAGGGTACTGAAAACTCAAAGGATCAGCTACAGCTTTATCTAAGTATTTACTAAATGCTACATGAGGGTGTCCCTGTCCAG
CTTTCTGGCACATGAGTCCTGTGTGGAGAGTTACCTCCTCTTCCAGGGACTGTGCTGTTGGGAACTTTGGGCAAGTCACTTACCTCTTTG
TGCCTCAATTTCTGTATAATATTTCTAAGCTACCTCACTGAGGTGGTATGAAGATTCACTAATGTATGTAGCGTGTTTGTCAATCCTCCA
GTGAAAAGCACTATCTAGATCACATTTTGGATCACATTAGCCAAATGCAGTAAATGGCCAAATTAGATGTGTGCTGAAGACAATCAGTCA
CTGGGTCTATATTAAACAGCAACCAGAGCAACAAATGGCAAACAATTTCTATTTTCAAGTTTCTTTGCATATTTTTTTGGTGCAAAACCA
TTTATAAACTTTTTTTTCTAACACTAGTGTCTACAGCAGCATTCAAAAAAATTCTGTTACCTTTTCTGTATTAGGATTTAAAGTCTATTT

>In-frame_GNAS_ENST00000354359_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_6480nt
TCGCCGCCGCCGCCTCCTCCTCCCCCCGCCTCCCCCCGCCCGCCGCGGCGCTTTTGGCTCGGGGCGGCGGCGGGGGCCCGGCCGAGGCAA
TAAGAGCGGCGGCGGCGGCAGCGGCGGCAGCAGCTCCCGCAGCTCCTGCTCTGGTCCGCCTCGGCCCGGCGGCGGCCATCAGCCCCCTCG
GCCTCGGCTCGAGGGGCGGGGAGCTGCGCGCGCCCCTCGGTCCGACCGACACCCTCCCCTTCCCGCCCGTCCGCGCGCCCCGCGGCCCGC
GGCCCGCAGTCCGCCCCGCGCGCTCCTTGCCGAGGAGCCGAGCCCGCGCCCGGCCCGCCCGCCCGGCGCTGCCCCGGCCCTCCCGGCCCG
CGTGAGGCCGCCCGCGCCCGCCGCCGCCGCAGCCCGGCCGCGCCCCGCCGCCGCCGCCGCCGCCATGGGCTGCCTCGGGAACAGTAAGAC
CGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTGCAGAAGGACAAGCAGGTCTACCGGGC
CACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAA
TGGAGAGGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGCAACAGCGATGGCAGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAA
CCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGT
GGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGG
AGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGC
TGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAA
CTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGT
GGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAA
CAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGAT
TGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAA
GTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGA
CACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAA
CCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATT
AACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTA
AGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAA
ATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGA
AAATGACAACTTCAACATTTCCAAAAAAGACATTGAAATTACTCTCTTCCATGGGGAAAATGGGCAATTAAATTGCAGTTTTGAAAATAT
TACTAGAAATCAAGATCTTACCACCATCCTTTGCAAAATTAAAGGCATCAAGACTGCAAGCACCATTGCCAACTCTTCTAAGAAAGTTCG
GGTCAAGCTGGGAAACCTGGAGCTCTACGTCGAGCAGGAGTCAGTTCCTTCCACATGGTATTTTCTGATTGTGCTCCCTGTCTTGCTAGT
GATTGTCATTTTTGCGGCCGTGGGGGTGACCAGGCACAAATCGAAGGAGCTGAGTCGCAAACAGAGTCAACAACTAGAATTGCTGGAAAG
CGAGCTCCGGAAAGAGATACGTGACGGCTTTGCTGAGCTGCAGATGGATAAATTGGATGTGGTTGATAGTTTTGGAACTGTTCCCTTCCT
TGACTACAAACATTTTGCTCTGAGAACTTTCTTCCCTGAGTCAGGTGGCTTCACCCACATCTTCACTGAAGATATGCATAACAGAGACGC
CAACGACAAGAATGAAAGTCTCACAGCTTTGGATGCCCTAATCTGTAATAAAAGCTTTCTTGTTACTGTCATCCACACCCTTGAAAAGCA
GAAGAACTTTTCTGTGAAGGACAGGTGTCTGTTTGCCTCCTTCCTAACCATTGCACTGCAAACCAAGCTGGTCTACCTGACCAGCATCCT
AGAGGTGCTGACCAGGGACTTGATGGAACAGTGTAGTAACATGCAGCCGAAACTCATGCTGAGACGCACGGAGTCCGTCGTCGAAAAACT
CCTCACAAACTGGATGTCCGTCTGCCTTTCTGGATTTCTCCGGGAGACTGTCGGAGAGCCCTTCTATTTGCTGGTGACGACTCTGAACCA
GAAAATTAACAAGGGTCCCGTGGATGTAATCACTTGCAAAGCCCTGTACACACTTAATGAAGACTGGCTGTTGTGGCAGGTTCCGGAATT
CAGTACTGTGGCATTAAACGTCGTCTTTGAAAAAATCCCGGAAAACGAGAGTGCAGATGTCTGTCGGAATATTTCAGTCAATGTTCTCGA
CTGTGACACCATTGGCCAAGCCAAAGAAAAGATTTTCCAAGCATTCTTAAGCAAAAATGGCTCTCCTTATGGACTTCAGCTTAATGAAAT
TGGTCTTGAGCTTCAAATGGGCACACGACAGAAAGAACTTCTGGACATCGACAGTTCCTCCGTGATTCTTGAAGATGGAATCACCAAGCT
AAACACCATTGGCCACTATGAGATATCAAATGGATCCACTATAAAAGTCTTTAAGAAGATAGCAAATTTTACTTCAGATGTGGAGTACTC
GGATGACCACTGCCATTTGATTTTACCAGATTCGGAAGCATTCCAAGATGTGCAAGGAAAGAGACATCGAGGGAAGCACAAGTTCAAAGT
AAAAGAAATGTATCTGACAAAGCTGCTGTCGACCAAGGTGGCAATTCATTCTGTGCTTGAAAAACTTTTTAGAAGCATTTGGAGTTTACC
CAACAGCAGAGCTCCATTTGCTATAAAATACTTTTTTGACTTTTTGGACGCCCAGGCTGAAAACAAAAAAATCACAGATCCTGACGTCGT
ACATATTTGGAAAACAAACAGCCTTCCTCTTCGCTTCTGGGTAAACATCCTGAAGAACCCTCAGTTTGTCTTTGACATTAAGAAGACACC
ACATATAGACGGCTGTTTGTCAGTGATTGCCCAGGCATTCATGGATGCATTTTCTCTCACAGAGCAGCAACTAGGGAAGGAAGCACCAAC
TAATAAGCTTCTCTATGCCAAGGATATCCCAACCTACAAAGAAGAAGTAAAATCTTATTACAAAGCAATCAGGGATTTGCCTCCATTGTC
ATCCTCAGAAATGGAAGAATTTTTAACTCAGGAATCTAAGAAACATGAAAATGAATTTAATGAAGAAGTGGCCTTGACAGAAATTTACAA
ATACATCGTAAAATATTTTGATGAGATTCTAAATAAACTAGAAAGAGAACGAGGGCTGGAAGAAGCTCAGAAACAACTCTTGCATGTAAA
AGTCTTATTTGATGAAAAGAAGAAATGCAAGTGGATGTAAGCACTCTGGGGCCTGGCTTAATCTGGCAAAGTTCTTCAGACGACTTGGGA
GCAAAATGGCTGCTTGAGCTACTCTGTGTCGTTAATTTGTTGTTTGCACATAGGTTCCACTTTGGGCACTGTCTTTTTAAGAGACCAAGG
CACATGCACAGCTTTTAGAAAGCATACCAACCCTTGTGCCTGTGTGTATACCGTGGGAACCCTTCTGTAAATAGAGTTGAAGTGGTTGTT
GCAAACAGCCTCCTTGTTTACAGAGAATACAAGGCCAGTAAGCGAATGTCAGTATTGTAACTACAGTCTCCACTTAAGCACAATGATATA
AGTGGTTTTGTTTGAAAACTACAGCTATGTAGCACTTGTGCTACACTGCACCTCTGCATTGTAAAGGGATACTGCCAGTGCTCAAAACAA
AATGTGAAATGAGTCATTTGGAAACAAGGTGGGGGTGTTAGGGCAACCTCGAGGATTTGCAGCATTGAAACTTTCCCCAGTAGTTCTTGG
AAAAGCTGACCGCAGAATTTGGTAGTGTACACTTAGCATTTGTGAGTGTGTGTGTGTGTTTAAACCAAAAACTAACAGTGTTGCAACATT
GTTGAAAGGGCTCGTGTTTTTCAGTGGTCATCAACTGCACTCCATCAAACTCACCTCCATTTCACCAAGGAGCTCTAAAGTAAGGAGAGT
GGGCTTTATTTAAATGAACAGCATTTTAACCAGATACTTTGTCCTAATGTATGTTCCTTTTCTTCATCTGTTTTTTCATACTAAATGTAT
TTGATAGTGGACATGTTGGATATTATACAAAAAAATCATTAATTCATTTCTGTTCCAAAACCTTTGATCAGAACGATCTGTGGAAGAGTA
ACTCCATTTCTATATGAGTGAGTGTCTCCTTGCTTTAGATTTCTGGTGAACCCTGTGGTTATGAATACTTGTGTGTGATTTAAAAAAAAA
AAGATACATTTTACATTTTATCGAATTGCTGTTCACACTGGAGTATTATATATAAATATATATATTTGAGGCCCAAGGCCTGAAAAATAT
TAGTATACAACTTGGTATCTTAGTCTTACTATGTACTTTTTGAAAGTATTCCTCGCAGGAGAAAGAATTTAAAATACCCATTTTATTCAT
GCCTTTCTTTTTAAAGAATTCTCTATCCAGTTATACTGTAGTCTTTTTAGTGCTGATTTTTTAATTCCTGAATTTTTGCTGCTCATGACC
AGTTTTAATACCACTGTGTTTTCCTTCTATTAAACCAGAAGAAGTAAACAGCATAATTGGCAACTCTTGAGCTTTTCTTGTGGCAGGCAC
CTTTTACCCTTGGTGCTCCAAATCCCCCATCTAGGAAAGAAAATTTTTTCAAGTCAAATAACATTGATCACATATTCCTTGAAATCATTT
ACCAACACTGTATGGAGCATTAGGATTTAAATATGAATTTGTCTTAAAGGCAATTCCTTTTTGCTTCTGTATTATCTGGAAAAGCATGAG
AGAGGTGACACCTCAACAAACTGATCAGAGAAAATAAGCAGTTACTACCCTGATAGGCACCTTCCCAATCCTGTTGCTTTTGACCATTGT
CTGTCCAACGGACACACCTCAAACAAACAAAACTACCAAATAGATGACAGATCAGAATAAAGGTGAGAGGTCTGGTCCCCATTGAAGGCT
GCTACAGTCTTCAAAGAGGTGAAGGAGTTCATAAGAGAACAACAGTAGGAAAGTTGAGAGCCAAGGGTAGGAGAGTTGCCCAAAAGACTT
CCCCTACTACTTTAGGGTACTGAAAACTCAAAGGATCAGCTACAGCTTTATCTAAGTATTTACTAAATGCTACATGAGGGTGTCCCTGTC
CAGCTTTCTGGCACATGAGTCCTGTGTGGAGAGTTACCTCCTCTTCCAGGGACTGTGCTGTTGGGAACTTTGGGCAAGTCACTTACCTCT
TTGTGCCTCAATTTCTGTATAATATTTCTAAGCTACCTCACTGAGGTGGTATGAAGATTCACTAATGTATGTAGCGTGTTTGTCAATCCT
CCAGTGAAAAGCACTATCTAGATCACATTTTGGATCACATTAGCCAAATGCAGTAAATGGCCAAATTAGATGTGTGCTGAAGACAATCAG
TCACTGGGTCTATATTAAACAGCAACCAGAGCAACAAATGGCAAACAATTTCTATTTTCAAGTTTCTTTGCATATTTTTTTGGTGCAAAA
CCATTTATAAACTTTTTTTTCTAACACTAGTGTCTACAGCAGCATTCAAAAAAATTCTGTTACCTTTTCTGTATTAGGATTTAAAGTCTA
TTTCTTATTGTATACCTGATTGAAGCTGTTCTTGGAGATGAATGTTTTAAATGTCTATATCCAAAAAATAAACATTTTGATGTAACTGTG

>In-frame_GNAS_ENST00000265620_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_6371nt
GGGCGGCGGCGGGGGCCCGGCCGAGGCAATAAGAGCGGCGGCGGCGGCAGCGGCGGCAGCAGCTCCCGCAGCTCCTGCTCTGGTCCGCCT
CGGCCCGGCGGCGGCCATCAGCCCCCTCGGCCTCGGCTCGAGGGGCGGGGAGCTGCGCGCGCCCCTCGGTCCGACCGACACCCTCCCCTT
CCCGCCCGTCCGCGCGCCCCGCGGCCCGCGGCCCGCAGTCCGCCCCGCGCGCTCCTTGCCGAGGAGCCGAGCCCGCGCCCGGCCCGCCCG
CCCGGCGCTGCCCCGGCCCTCCCGGCCCGCGTGAGGCCGCCCGCGCCCGCCGCCGCCGCAGCCCGGCCGCGCCCCGCCGCCGCCGCCGCC
GCCATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCGCAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAG
CTGCAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCTGCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAG
ATGAGGATCCTGCATGTTAATGGGTTTAATGGAGATGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAA
ACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTG
ATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAA
CGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGAT
CAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTG
GGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAAC
ATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACC
ATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAA
TTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAG
TTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGT
GTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAG
CCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCT
TCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAG
GAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAA
TGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAAAAAGAAAATGACAACTTCAACATT
TCCAAAAAAGACATTGAAATTACTCTCTTCCATGGGGAAAATGGGCAATTAAATTGCAGTTTTGAAAATATTACTAGAAATCAAGATCTT
ACCACCATCCTTTGCAAAATTAAAGGCATCAAGACTGCAAGCACCATTGCCAACTCTTCTAAGAAAGTTCGGGTCAAGCTGGGAAACCTG
GAGCTCTACGTCGAGCAGGAGTCAGTTCCTTCCACATGGTATTTTCTGATTGTGCTCCCTGTCTTGCTAGTGATTGTCATTTTTGCGGCC
GTGGGGGTGACCAGGCACAAATCGAAGGAGCTGAGTCGCAAACAGAGTCAACAACTAGAATTGCTGGAAAGCGAGCTCCGGAAAGAGATA
CGTGACGGCTTTGCTGAGCTGCAGATGGATAAATTGGATGTGGTTGATAGTTTTGGAACTGTTCCCTTCCTTGACTACAAACATTTTGCT
CTGAGAACTTTCTTCCCTGAGTCAGGTGGCTTCACCCACATCTTCACTGAAGATATGCATAACAGAGACGCCAACGACAAGAATGAAAGT
CTCACAGCTTTGGATGCCCTAATCTGTAATAAAAGCTTTCTTGTTACTGTCATCCACACCCTTGAAAAGCAGAAGAACTTTTCTGTGAAG
GACAGGTGTCTGTTTGCCTCCTTCCTAACCATTGCACTGCAAACCAAGCTGGTCTACCTGACCAGCATCCTAGAGGTGCTGACCAGGGAC
TTGATGGAACAGTGTAGTAACATGCAGCCGAAACTCATGCTGAGACGCACGGAGTCCGTCGTCGAAAAACTCCTCACAAACTGGATGTCC
GTCTGCCTTTCTGGATTTCTCCGGGAGACTGTCGGAGAGCCCTTCTATTTGCTGGTGACGACTCTGAACCAGAAAATTAACAAGGGTCCC
GTGGATGTAATCACTTGCAAAGCCCTGTACACACTTAATGAAGACTGGCTGTTGTGGCAGGTTCCGGAATTCAGTACTGTGGCATTAAAC
GTCGTCTTTGAAAAAATCCCGGAAAACGAGAGTGCAGATGTCTGTCGGAATATTTCAGTCAATGTTCTCGACTGTGACACCATTGGCCAA
GCCAAAGAAAAGATTTTCCAAGCATTCTTAAGCAAAAATGGCTCTCCTTATGGACTTCAGCTTAATGAAATTGGTCTTGAGCTTCAAATG
GGCACACGACAGAAAGAACTTCTGGACATCGACAGTTCCTCCGTGATTCTTGAAGATGGAATCACCAAGCTAAACACCATTGGCCACTAT
GAGATATCAAATGGATCCACTATAAAAGTCTTTAAGAAGATAGCAAATTTTACTTCAGATGTGGAGTACTCGGATGACCACTGCCATTTG
ATTTTACCAGATTCGGAAGCATTCCAAGATGTGCAAGGAAAGAGACATCGAGGGAAGCACAAGTTCAAAGTAAAAGAAATGTATCTGACA
AAGCTGCTGTCGACCAAGGTGGCAATTCATTCTGTGCTTGAAAAACTTTTTAGAAGCATTTGGAGTTTACCCAACAGCAGAGCTCCATTT
GCTATAAAATACTTTTTTGACTTTTTGGACGCCCAGGCTGAAAACAAAAAAATCACAGATCCTGACGTCGTACATATTTGGAAAACAAAC
AGCCTTCCTCTTCGCTTCTGGGTAAACATCCTGAAGAACCCTCAGTTTGTCTTTGACATTAAGAAGACACCACATATAGACGGCTGTTTG
TCAGTGATTGCCCAGGCATTCATGGATGCATTTTCTCTCACAGAGCAGCAACTAGGGAAGGAAGCACCAACTAATAAGCTTCTCTATGCC
AAGGATATCCCAACCTACAAAGAAGAAGTAAAATCTTATTACAAAGCAATCAGGGATTTGCCTCCATTGTCATCCTCAGAAATGGAAGAA
TTTTTAACTCAGGAATCTAAGAAACATGAAAATGAATTTAATGAAGAAGTGGCCTTGACAGAAATTTACAAATACATCGTAAAATATTTT
GATGAGATTCTAAATAAACTAGAAAGAGAACGAGGGCTGGAAGAAGCTCAGAAACAACTCTTGCATGTAAAAGTCTTATTTGATGAAAAG
AAGAAATGCAAGTGGATGTAAGCACTCTGGGGCCTGGCTTAATCTGGCAAAGTTCTTCAGACGACTTGGGAGCAAAATGGCTGCTTGAGC
TACTCTGTGTCGTTAATTTGTTGTTTGCACATAGGTTCCACTTTGGGCACTGTCTTTTTAAGAGACCAAGGCACATGCACAGCTTTTAGA
AAGCATACCAACCCTTGTGCCTGTGTGTATACCGTGGGAACCCTTCTGTAAATAGAGTTGAAGTGGTTGTTGCAAACAGCCTCCTTGTTT
ACAGAGAATACAAGGCCAGTAAGCGAATGTCAGTATTGTAACTACAGTCTCCACTTAAGCACAATGATATAAGTGGTTTTGTTTGAAAAC
TACAGCTATGTAGCACTTGTGCTACACTGCACCTCTGCATTGTAAAGGGATACTGCCAGTGCTCAAAACAAAATGTGAAATGAGTCATTT
GGAAACAAGGTGGGGGTGTTAGGGCAACCTCGAGGATTTGCAGCATTGAAACTTTCCCCAGTAGTTCTTGGAAAAGCTGACCGCAGAATT
TGGTAGTGTACACTTAGCATTTGTGAGTGTGTGTGTGTGTTTAAACCAAAAACTAACAGTGTTGCAACATTGTTGAAAGGGCTCGTGTTT
TTCAGTGGTCATCAACTGCACTCCATCAAACTCACCTCCATTTCACCAAGGAGCTCTAAAGTAAGGAGAGTGGGCTTTATTTAAATGAAC
AGCATTTTAACCAGATACTTTGTCCTAATGTATGTTCCTTTTCTTCATCTGTTTTTTCATACTAAATGTATTTGATAGTGGACATGTTGG
ATATTATACAAAAAAATCATTAATTCATTTCTGTTCCAAAACCTTTGATCAGAACGATCTGTGGAAGAGTAACTCCATTTCTATATGAGT
GAGTGTCTCCTTGCTTTAGATTTCTGGTGAACCCTGTGGTTATGAATACTTGTGTGTGATTTAAAAAAAAAAAGATACATTTTACATTTT
ATCGAATTGCTGTTCACACTGGAGTATTATATATAAATATATATATTTGAGGCCCAAGGCCTGAAAAATATTAGTATACAACTTGGTATC
TTAGTCTTACTATGTACTTTTTGAAAGTATTCCTCGCAGGAGAAAGAATTTAAAATACCCATTTTATTCATGCCTTTCTTTTTAAAGAAT
TCTCTATCCAGTTATACTGTAGTCTTTTTAGTGCTGATTTTTTAATTCCTGAATTTTTGCTGCTCATGACCAGTTTTAATACCACTGTGT
TTTCCTTCTATTAAACCAGAAGAAGTAAACAGCATAATTGGCAACTCTTGAGCTTTTCTTGTGGCAGGCACCTTTTACCCTTGGTGCTCC
AAATCCCCCATCTAGGAAAGAAAATTTTTTCAAGTCAAATAACATTGATCACATATTCCTTGAAATCATTTACCAACACTGTATGGAGCA
TTAGGATTTAAATATGAATTTGTCTTAAAGGCAATTCCTTTTTGCTTCTGTATTATCTGGAAAAGCATGAGAGAGGTGACACCTCAACAA
ACTGATCAGAGAAAATAAGCAGTTACTACCCTGATAGGCACCTTCCCAATCCTGTTGCTTTTGACCATTGTCTGTCCAACGGACACACCT
CAAACAAACAAAACTACCAAATAGATGACAGATCAGAATAAAGGTGAGAGGTCTGGTCCCCATTGAAGGCTGCTACAGTCTTCAAAGAGG
TGAAGGAGTTCATAAGAGAACAACAGTAGGAAAGTTGAGAGCCAAGGGTAGGAGAGTTGCCCAAAAGACTTCCCCTACTACTTTAGGGTA
CTGAAAACTCAAAGGATCAGCTACAGCTTTATCTAAGTATTTACTAAATGCTACATGAGGGTGTCCCTGTCCAGCTTTCTGGCACATGAG
TCCTGTGTGGAGAGTTACCTCCTCTTCCAGGGACTGTGCTGTTGGGAACTTTGGGCAAGTCACTTACCTCTTTGTGCCTCAATTTCTGTA
TAATATTTCTAAGCTACCTCACTGAGGTGGTATGAAGATTCACTAATGTATGTAGCGTGTTTGTCAATCCTCCAGTGAAAAGCACTATCT
AGATCACATTTTGGATCACATTAGCCAAATGCAGTAAATGGCCAAATTAGATGTGTGCTGAAGACAATCAGTCACTGGGTCTATATTAAA
CAGCAACCAGAGCAACAAATGGCAAACAATTTCTATTTTCAAGTTTCTTTGCATATTTTTTTGGTGCAAAACCATTTATAAACTTTTTTT
TCTAACACTAGTGTCTACAGCAGCATTCAAAAAAATTCTGTTACCTTTTCTGTATTAGGATTTAAAGTCTATTTCTTATTGTATACCTGA

>In-frame_GNAS_ENST00000306090_chr20_57486241_+_PLXNC1_ENST00000258526_chr12_94642003_+_6147nt
CAGCGGCGGCAGCAGCTCCCGCAGCTCCTGCTCTGGTCCGCCTCGGCCCGGCGGCGGCCATCAGCCCCCTCGGCCTCGGCTCGAGGGGCG
GGGAGCTGCGCGCGCCCCTCGGTCCGACCGACACCCTCCCCTTCCCGCCCCCATGGGCTGCCTCGGGAACAGTAAGACCGAGGACCAGCG
CAACGAGGAGAAGGCGCAGCGTGAGGCCAACAAAAAGATCGAGAAGCAGCTGCAGAAGGACAAGCAGGTCTACCGGGCCACGCACCGCCT
GCTGCTGCTGGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATCCTGCATGTTAATGGGTTTAATGGAGACAGTGA
GAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCGATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGT
GGAGCTGGCCAACCCCGAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTCCCTCCCGAATTCTA
TGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGCTACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTA
CTTCCTGGACAAGATCGACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTCCTGACTTCTGGAAT
CTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTTGACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTG
CTTCAACGATGTGACTGCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAGACCAACCGCCTGCA
GGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTGCGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCT
CGCTGAGAAAGTCCTTGCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAGGATGCTACTCCCGA
GCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGAGATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCA
CTACTGCTACCCTCATTTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATCATTCAGCGCATGCA
CCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAATTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTA
CAAGCAGTTAATCACCCACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACCCCCTTTTCCCTTCA
GCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAGAAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAA
AAATAAATAAAACAGCAGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAGCATTAAAAAAAATC
AAAATAAAAATTAAATGTGAGCAAAGAAAATGACAACTTCAACATTTCCAAAAAAGACATTGAAATTACTCTCTTCCATGGGGAAAATGG
GCAATTAAATTGCAGTTTTGAAAATATTACTAGAAATCAAGATCTTACCACCATCCTTTGCAAAATTAAAGGCATCAAGACTGCAAGCAC
CATTGCCAACTCTTCTAAGAAAGTTCGGGTCAAGCTGGGAAACCTGGAGCTCTACGTCGAGCAGGAGTCAGTTCCTTCCACATGGTATTT
TCTGATTGTGCTCCCTGTCTTGCTAGTGATTGTCATTTTTGCGGCCGTGGGGGTGACCAGGCACAAATCGAAGGAGCTGAGTCGCAAACA
GAGTCAACAACTAGAATTGCTGGAAAGCGAGCTCCGGAAAGAGATACGTGACGGCTTTGCTGAGCTGCAGATGGATAAATTGGATGTGGT
TGATAGTTTTGGAACTGTTCCCTTCCTTGACTACAAACATTTTGCTCTGAGAACTTTCTTCCCTGAGTCAGGTGGCTTCACCCACATCTT
CACTGAAGATATGCATAACAGAGACGCCAACGACAAGAATGAAAGTCTCACAGCTTTGGATGCCCTAATCTGTAATAAAAGCTTTCTTGT
TACTGTCATCCACACCCTTGAAAAGCAGAAGAACTTTTCTGTGAAGGACAGGTGTCTGTTTGCCTCCTTCCTAACCATTGCACTGCAAAC
CAAGCTGGTCTACCTGACCAGCATCCTAGAGGTGCTGACCAGGGACTTGATGGAACAGTGTAGTAACATGCAGCCGAAACTCATGCTGAG
ACGCACGGAGTCCGTCGTCGAAAAACTCCTCACAAACTGGATGTCCGTCTGCCTTTCTGGATTTCTCCGGGAGACTGTCGGAGAGCCCTT
CTATTTGCTGGTGACGACTCTGAACCAGAAAATTAACAAGGGTCCCGTGGATGTAATCACTTGCAAAGCCCTGTACACACTTAATGAAGA
CTGGCTGTTGTGGCAGGTTCCGGAATTCAGTACTGTGGCATTAAACGTCGTCTTTGAAAAAATCCCGGAAAACGAGAGTGCAGATGTCTG
TCGGAATATTTCAGTCAATGTTCTCGACTGTGACACCATTGGCCAAGCCAAAGAAAAGATTTTCCAAGCATTCTTAAGCAAAAATGGCTC
TCCTTATGGACTTCAGCTTAATGAAATTGGTCTTGAGCTTCAAATGGGCACACGACAGAAAGAACTTCTGGACATCGACAGTTCCTCCGT
GATTCTTGAAGATGGAATCACCAAGCTAAACACCATTGGCCACTATGAGATATCAAATGGATCCACTATAAAAGTCTTTAAGAAGATAGC
AAATTTTACTTCAGATGTGGAGTACTCGGATGACCACTGCCATTTGATTTTACCAGATTCGGAAGCATTCCAAGATGTGCAAGGAAAGAG
ACATCGAGGGAAGCACAAGTTCAAAGTAAAAGAAATGTATCTGACAAAGCTGCTGTCGACCAAGGTGGCAATTCATTCTGTGCTTGAAAA
ACTTTTTAGAAGCATTTGGAGTTTACCCAACAGCAGAGCTCCATTTGCTATAAAATACTTTTTTGACTTTTTGGACGCCCAGGCTGAAAA
CAAAAAAATCACAGATCCTGACGTCGTACATATTTGGAAAACAAACAGCCTTCCTCTTCGCTTCTGGGTAAACATCCTGAAGAACCCTCA
GTTTGTCTTTGACATTAAGAAGACACCACATATAGACGGCTGTTTGTCAGTGATTGCCCAGGCATTCATGGATGCATTTTCTCTCACAGA
GCAGCAACTAGGGAAGGAAGCACCAACTAATAAGCTTCTCTATGCCAAGGATATCCCAACCTACAAAGAAGAAGTAAAATCTTATTACAA
AGCAATCAGGGATTTGCCTCCATTGTCATCCTCAGAAATGGAAGAATTTTTAACTCAGGAATCTAAGAAACATGAAAATGAATTTAATGA
AGAAGTGGCCTTGACAGAAATTTACAAATACATCGTAAAATATTTTGATGAGATTCTAAATAAACTAGAAAGAGAACGAGGGCTGGAAGA
AGCTCAGAAACAACTCTTGCATGTAAAAGTCTTATTTGATGAAAAGAAGAAATGCAAGTGGATGTAAGCACTCTGGGGCCTGGCTTAATC
TGGCAAAGTTCTTCAGACGACTTGGGAGCAAAATGGCTGCTTGAGCTACTCTGTGTCGTTAATTTGTTGTTTGCACATAGGTTCCACTTT
GGGCACTGTCTTTTTAAGAGACCAAGGCACATGCACAGCTTTTAGAAAGCATACCAACCCTTGTGCCTGTGTGTATACCGTGGGAACCCT
TCTGTAAATAGAGTTGAAGTGGTTGTTGCAAACAGCCTCCTTGTTTACAGAGAATACAAGGCCAGTAAGCGAATGTCAGTATTGTAACTA
CAGTCTCCACTTAAGCACAATGATATAAGTGGTTTTGTTTGAAAACTACAGCTATGTAGCACTTGTGCTACACTGCACCTCTGCATTGTA
AAGGGATACTGCCAGTGCTCAAAACAAAATGTGAAATGAGTCATTTGGAAACAAGGTGGGGGTGTTAGGGCAACCTCGAGGATTTGCAGC
ATTGAAACTTTCCCCAGTAGTTCTTGGAAAAGCTGACCGCAGAATTTGGTAGTGTACACTTAGCATTTGTGAGTGTGTGTGTGTGTTTAA
ACCAAAAACTAACAGTGTTGCAACATTGTTGAAAGGGCTCGTGTTTTTCAGTGGTCATCAACTGCACTCCATCAAACTCACCTCCATTTC
ACCAAGGAGCTCTAAAGTAAGGAGAGTGGGCTTTATTTAAATGAACAGCATTTTAACCAGATACTTTGTCCTAATGTATGTTCCTTTTCT
TCATCTGTTTTTTCATACTAAATGTATTTGATAGTGGACATGTTGGATATTATACAAAAAAATCATTAATTCATTTCTGTTCCAAAACCT
TTGATCAGAACGATCTGTGGAAGAGTAACTCCATTTCTATATGAGTGAGTGTCTCCTTGCTTTAGATTTCTGGTGAACCCTGTGGTTATG
AATACTTGTGTGTGATTTAAAAAAAAAAAGATACATTTTACATTTTATCGAATTGCTGTTCACACTGGAGTATTATATATAAATATATAT
ATTTGAGGCCCAAGGCCTGAAAAATATTAGTATACAACTTGGTATCTTAGTCTTACTATGTACTTTTTGAAAGTATTCCTCGCAGGAGAA
AGAATTTAAAATACCCATTTTATTCATGCCTTTCTTTTTAAAGAATTCTCTATCCAGTTATACTGTAGTCTTTTTAGTGCTGATTTTTTA
ATTCCTGAATTTTTGCTGCTCATGACCAGTTTTAATACCACTGTGTTTTCCTTCTATTAAACCAGAAGAAGTAAACAGCATAATTGGCAA
CTCTTGAGCTTTTCTTGTGGCAGGCACCTTTTACCCTTGGTGCTCCAAATCCCCCATCTAGGAAAGAAAATTTTTTCAAGTCAAATAACA
TTGATCACATATTCCTTGAAATCATTTACCAACACTGTATGGAGCATTAGGATTTAAATATGAATTTGTCTTAAAGGCAATTCCTTTTTG
CTTCTGTATTATCTGGAAAAGCATGAGAGAGGTGACACCTCAACAAACTGATCAGAGAAAATAAGCAGTTACTACCCTGATAGGCACCTT
CCCAATCCTGTTGCTTTTGACCATTGTCTGTCCAACGGACACACCTCAAACAAACAAAACTACCAAATAGATGACAGATCAGAATAAAGG
TGAGAGGTCTGGTCCCCATTGAAGGCTGCTACAGTCTTCAAAGAGGTGAAGGAGTTCATAAGAGAACAACAGTAGGAAAGTTGAGAGCCA
AGGGTAGGAGAGTTGCCCAAAAGACTTCCCCTACTACTTTAGGGTACTGAAAACTCAAAGGATCAGCTACAGCTTTATCTAAGTATTTAC
TAAATGCTACATGAGGGTGTCCCTGTCCAGCTTTCTGGCACATGAGTCCTGTGTGGAGAGTTACCTCCTCTTCCAGGGACTGTGCTGTTG
GGAACTTTGGGCAAGTCACTTACCTCTTTGTGCCTCAATTTCTGTATAATATTTCTAAGCTACCTCACTGAGGTGGTATGAAGATTCACT
AATGTATGTAGCGTGTTTGTCAATCCTCCAGTGAAAAGCACTATCTAGATCACATTTTGGATCACATTAGCCAAATGCAGTAAATGGCCA
AATTAGATGTGTGCTGAAGACAATCAGTCACTGGGTCTATATTAAACAGCAACCAGAGCAACAAATGGCAAACAATTTCTATTTTCAAGT
TTCTTTGCATATTTTTTTGGTGCAAAACCATTTATAAACTTTTTTTTCTAACACTAGTGTCTACAGCAGCATTCAAAAAAATTCTGTTAC
CTTTTCTGTATTAGGATTTAAAGTCTATTTCTTATTGTATACCTGATTGAAGCTGTTCTTGGAGATGAATGTTTTAAATGTCTATATCCA


Top

FusionGenePPI for GNAS_PLXNC1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GNASFSCN1, PAICS, RUVBL1, SHMT2, TTC1, ADCY6, CRHR1, RGS2, SNX13, VIPR1, GNAS, MDM2, CALM1, GNG2, PCK1, ADRB2, AVPR2, TBXA2R, GNB1, GNAQ, GNA11, SLC25A12, LAMTOR1, NUCB1, NUCB2, HLA-A, OPTN, PTGIR, FUS, AXIN1, PANX1, CCDC8, EGFR, JAK3, GNAL, GNG4, TRO, MAGED2, GNB2, GNB4, C1QBP, METAP2, CPT2, YBEY, GNG10, OCIAD1, GNA12, ARMCX3, GNG5, EIF4H, EML2, GIPC1, DIS3, PFAS, NTRK1, RIC8B, CHEK2, HERC2, XPO1, CAT, DBN1, FLNA, MYH9, DNAJC7, SYNPO, THOC2, ELMSAN1, ADCY2, CDC5L, CD47, GLP1R, NAP1L1, MTNR1B, TRIM25PLXNC1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GNAS_PLXNC1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GNAS_PLXNC1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGNASC3494506Pseudohypoparathyroidism, Type Ia13CTD_human;ORPHANET;UNIPROT
HgeneGNASC0242292McCune-Albright Syndrome5ORPHANET;UNIPROT
HgeneGNASC2931404Albright's hereditary osteodystrophy4CTD_human
HgeneGNASC0016065Polyostotic fibrous dysplasia3CTD_human;HPO;ORPHANET
HgeneGNASC0033806Pseudohypoparathyroidism3CTD_human;HPO
HgeneGNASC1857451Acth-Independent Macronodular Adrenal Hyperplasia3ORPHANET;UNIPROT
HgeneGNASC0014130Endocrine System Diseases2CTD_human
HgeneGNASC0034013Precocious Puberty2CTD_human;HPO
HgeneGNASC0221263Cafe-au-Lait Spots2CTD_human
HgeneGNASC0001206Acromegaly1CTD_human;HPO
HgeneGNASC0001624Adrenal Gland Neoplasms1CTD_human
HgeneGNASC0011573Endogenous depression1PSYGENET
HgeneGNASC0019087Hemorrhagic Disorders1CTD_human
HgeneGNASC0020538Hypertensive disease1CTD_human;HPO
HgeneGNASC0021655Insulin Resistance1CTD_human
HgeneGNASC0023897Liver Diseases, Parasitic1CTD_human
HgeneGNASC0027819Neuroblastoma1CTD_human
HgeneGNASC0028754Obesity1CTD_human;HPO
HgeneGNASC0029396Heterotopic Ossification1CTD_human;HPO
HgeneGNASC0032460Polycystic Ovary Syndrome1CTD_human
HgeneGNASC0033835Pseudopseudohypoparathyroidism1CTD_human;ORPHANET
HgeneGNASC0035204Respiration Disorders1CTD_human
HgeneGNASC0036341Schizophrenia1PSYGENET
HgeneGNASC0038587Substance Withdrawal Syndrome1CTD_human
HgeneGNASC0039231Tachycardia1CTD_human
HgeneGNASC0206698Cholangiocarcinoma1CTD_human
HgeneGNASC0221357Brachydactyly1CTD_human;HPO
HgeneGNASC0242184Hypoxia1CTD_human
HgeneGNASC0242216Biliary calculi1CTD_human
HgeneGNASC0334041Osteoma cutis1CTD_human;ORPHANET;UNIPROT
HgeneGNASC0346302Growth Hormone-Secreting Pituitary Adenoma1CTD_human
HgeneGNASC2932715Pseudohypoparathyroidism Type 1B1CTD_human;ORPHANET
HgeneGNASC2932716Pseudohypoparathyroidism Type 1C1ORPHANET;UNIPROT
HgeneGNASC3714756Intellectual Disability1CTD_human;HPO
TgenePLXNC1C0014175Endometriosis1CTD_human