FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14817

FusionGeneSummary for GNA11_TMCO3

check button Fusion gene summary
Fusion gene informationFusion gene name: GNA11_TMCO3
Fusion gene ID: 14817
HgeneTgene
Gene symbol

GNA11

TMCO3

Gene ID

2767

55002

Gene nameG protein subunit alpha 11transmembrane and coiled-coil domains 3
SynonymsFBH|FBH2|FHH2|GNA-11|HHC2|HYPOC2C13orf11
Cytomap

19p13.3

13q34

Type of geneprotein-codingprotein-coding
Descriptionguanine nucleotide-binding protein subunit alpha-11g alpha-11guanine nucleotide binding protein (G protein), alpha 11 (Gq class)guanine nucleotide-binding protein G(y) subunit alphatransmembrane and coiled-coil domain-containing protein 3putative LAG1-interacting protein
Modification date2018052320180519
UniProtAcc

P29992

Q6UWJ1

Ensembl transtripts involved in fusion geneENST00000078429, ENST00000586180, 
ENST00000434316, ENST00000375391, 
ENST00000474393, 
Fusion gene scores* DoF score4 X 3 X 3=365 X 5 X 6=150
# samples 66
** MAII scorelog2(6/36*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(6/150*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: GNA11 [Title/Abstract] AND TMCO3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-HB-A3YV-01AGNA11chr19

3094785

+TMCO3chr13

114174931

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000078429ENST00000434316GNA11chr19

3094785

+TMCO3chr13

114174931

+
5CDS-intronENST00000078429ENST00000375391GNA11chr19

3094785

+TMCO3chr13

114174931

+
5CDS-3UTRENST00000078429ENST00000474393GNA11chr19

3094785

+TMCO3chr13

114174931

+
intron-3CDSENST00000586180ENST00000434316GNA11chr19

3094785

+TMCO3chr13

114174931

+
intron-intronENST00000586180ENST00000375391GNA11chr19

3094785

+TMCO3chr13

114174931

+
intron-3UTRENST00000586180ENST00000474393GNA11chr19

3094785

+TMCO3chr13

114174931

+

Top

FusionProtFeatures for GNA11_TMCO3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GNA11

P29992

TMCO3

Q6UWJ1

Guanine nucleotide-binding proteins (G proteins) areinvolved as modulators or transducers in various transmembranesignaling systems. Acts as an activator of phospholipase C. Probable Na(+)/H(+) antiporter. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTMCO3chr19:3094785chr13:114174931ENST00000375391+08124_204-104415Coiled coilOntology_term=ECO:0000255
TgeneTMCO3chr19:3094785chr13:114174931ENST00000375391+08221_224-104415Compositional biasNote=Poly-Glu
TgeneTMCO3chr19:3094785chr13:114174931ENST00000375391+08286_306-104415TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000375391+08317_337-104415TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000375391+08350_370-104415TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000375391+08416_436-104415TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000375391+08456_476-104415TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000375391+08498_518-104415TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000375391+08554_574-104415TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000375391+08578_598-104415TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000375391+08608_628-104415TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000375391+08640_660-104415TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000434316+613416_436408678TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000434316+613456_476408678TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000434316+613498_518408678TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000434316+613554_574408678TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000434316+613578_598408678TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000434316+613608_628408678TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000434316+613640_660408678TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGNA11chr19:3094785chr13:114174931ENST00000078429+17180_18645360Nucleotide bindingGTP
HgeneGNA11chr19:3094785chr13:114174931ENST00000078429+17205_20945360Nucleotide bindingGTP
HgeneGNA11chr19:3094785chr13:114174931ENST00000078429+17274_27745360Nucleotide bindingGTP
HgeneGNA11chr19:3094785chr13:114174931ENST00000078429+1746_5345360Nucleotide bindingGTP
TgeneTMCO3chr19:3094785chr13:114174931ENST00000434316+613124_204408678Coiled coilOntology_term=ECO:0000255
TgeneTMCO3chr19:3094785chr13:114174931ENST00000434316+613221_224408678Compositional biasNote=Poly-Glu
TgeneTMCO3chr19:3094785chr13:114174931ENST00000434316+613286_306408678TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000434316+613317_337408678TransmembraneHelical
TgeneTMCO3chr19:3094785chr13:114174931ENST00000434316+613350_370408678TransmembraneHelical


Top

FusionGeneSequence for GNA11_TMCO3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GNA11_ENST00000078429_chr19_3094785_+_TMCO3_ENST00000434316_chr13_114174931_+_315aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGDIDYSTVLLGMLVTQDVQLGLFMAVMPTLIQAGASASSSIVVEV
LRILVLIGQILFSLAAVFLLCLVIKKTLIGPTTRKLHMESKGNKEILILGISAFIFLMLTVTELLDVSMELGCFLAGALVSSQGPVVTEE
IATSIEPIRDFLAIVFFASIGLHVFPTFVAYELTVLVFLTLSVVVMKFLLAALVLSLILPRSSQYIKWIVSAGLAQVSEFSFVLGSRARR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GNA11_ENST00000078429_chr19_3094785_+_TMCO3_ENST00000434316_chr13_114174931_+_945nt
ATGACTCTGGAGTCCATGATGGCGTGTTGCCTGAGCGATGAGGTGAAGGAGTCCAAGCGGATCAACGCCGAGATCGAGAAGCAGCTGCGG
CGGGACAAGCGCGACGCCCGGCGCGAGCTCAAGCTGCTGCTGCTCGGCGACATTGACTACAGCACCGTGCTCCTCGGCATGCTGGTGACG
CAGGACGTGCAGCTCGGGCTCTTCATGGCCGTCATGCCGACTCTCATACAGGCGGGCGCCAGTGCATCTTCTAGCATTGTCGTGGAAGTT
CTCCGAATCCTGGTTTTGATTGGTCAGATTCTTTTTTCACTAGCGGCGGTTTTTCTTTTATGTCTTGTTATAAAGAAGTATCTCATTGGA
CCCTATTATCGGAAGCTGCACATGGAAAGCAAGGGGAACAAAGAAATCCTGATCTTGGGAATATCTGCCTTTATCTTCTTAATGTTAACG
GTCACGGAGCTGCTGGACGTCTCCATGGAGCTGGGCTGTTTCCTGGCTGGAGCGCTCGTCTCCTCTCAGGGCCCCGTGGTCACCGAGGAG
ATCGCCACCTCCATCGAACCCATCCGCGACTTCCTGGCCATCGTTTTCTTCGCCTCCATAGGGCTCCACGTGTTCCCCACGTTTGTGGCG
TACGAGCTCACGGTGCTGGTGTTCCTCACCTTGTCAGTGGTGGTGATGAAGTTTCTCCTGGCGGCGCTGGTCCTGTCTCTCATTCTGCCG
AGGAGCAGCCAGTACATCAAGTGGATCGTCTCTGCGGGGCTTGCCCAGGTCAGCGAGTTTTCCTTTGTCCTGGGGAGCCGGGCGCGAAGA
GCGGGCGTCATCTCTCGGGAGGTGTACCTCCTTATACTGAGTGTGACCACGCTCAGCCTCTTGCTCGCCCCGGTGCTGTGGAGAGCTGCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_GNA11_ENST00000078429_chr19_3094785_+_TMCO3_ENST00000434316_chr13_114174931_+_1844nt
GCTGCGGCGGCGGCGCGGGCTGAGTGCGGCCGCGCGGGAGTCCGCGGCTGGCGCGGCCCGAGCGGGGACCCGGCGGCTCGCCAGGCGGCG
GCCGAGGCGGGGCGGGCCGGCCCGGGGCCGAGGGCCGGTGGCCGAGGCCGGAGGGCCGCGGCGGGCGGCGGCCGAGGCGGCTCCGGCCAG
GGCCGGGCCGGGGGCCGGGGGGCGGCGGCGGGCAGGCGGCCGCGTCGGCCGGGGCCGGGACGATGACTCTGGAGTCCATGATGGCGTGTT
GCCTGAGCGATGAGGTGAAGGAGTCCAAGCGGATCAACGCCGAGATCGAGAAGCAGCTGCGGCGGGACAAGCGCGACGCCCGGCGCGAGC
TCAAGCTGCTGCTGCTCGGCGACATTGACTACAGCACCGTGCTCCTCGGCATGCTGGTGACGCAGGACGTGCAGCTCGGGCTCTTCATGG
CCGTCATGCCGACTCTCATACAGGCGGGCGCCAGTGCATCTTCTAGCATTGTCGTGGAAGTTCTCCGAATCCTGGTTTTGATTGGTCAGA
TTCTTTTTTCACTAGCGGCGGTTTTTCTTTTATGTCTTGTTATAAAGAAGTATCTCATTGGACCCTATTATCGGAAGCTGCACATGGAAA
GCAAGGGGAACAAAGAAATCCTGATCTTGGGAATATCTGCCTTTATCTTCTTAATGTTAACGGTCACGGAGCTGCTGGACGTCTCCATGG
AGCTGGGCTGTTTCCTGGCTGGAGCGCTCGTCTCCTCTCAGGGCCCCGTGGTCACCGAGGAGATCGCCACCTCCATCGAACCCATCCGCG
ACTTCCTGGCCATCGTTTTCTTCGCCTCCATAGGGCTCCACGTGTTCCCCACGTTTGTGGCGTACGAGCTCACGGTGCTGGTGTTCCTCA
CCTTGTCAGTGGTGGTGATGAAGTTTCTCCTGGCGGCGCTGGTCCTGTCTCTCATTCTGCCGAGGAGCAGCCAGTACATCAAGTGGATCG
TCTCTGCGGGGCTTGCCCAGGTCAGCGAGTTTTCCTTTGTCCTGGGGAGCCGGGCGCGAAGAGCGGGCGTCATCTCTCGGGAGGTGTACC
TCCTTATACTGAGTGTGACCACGCTCAGCCTCTTGCTCGCCCCGGTGCTGTGGAGAGCTGCAATCACGAGGTGTGTGCCCAGACCGGAGA
GACGGTCCAGCCTCTGATGGCTCGGAGATGATGGACCGTGGAAGGGAAGCGTCTGTGGGGAGTGAGCGCTTAGATGGCCAGCAGCTGCTC
CTTCTGGGAAGCTCGCACCTTGGCAACAGAACAGCCCTCTAGCAGAGCGTCAGTGCAGTCGTGTTATCCCGGCTTTTACAGAATATTCTT
GTCCTATTTTAGAATTTTCCGGAGTAGTTTATTTGCAGTCTGTTGATTATGTGCAGTAGACCCGGGACACTGCGTTTTACCGATCACCTT
GAATGTGGTGCCTGGATGTGCCTTTTTTTTTTTTCCCTGAAATTATTATTAATTTTCTATTGTGAGTTCATCAGTTCATAGTTTTTTTAG
TAAAGAAGCAAAATTAAAAGGCTTTTAAAAATGTACAACTTCAGAATTATAATCTGTTAGTCAAATATTTGTTATTAAACATTTCTGTAA
TATGAAGTTGTAATCCTGGCCGTGAGCTTGGAAGCTTACTTTTGATTCTTAAAGCCTATGTTTTCTAAAATGAGACAAATACGGATGTCT
ATTTGCCTTTTATTGTAACTTTTAAATGAAATAATTTCATGTCAATTTCTATTAGATATATCACTTAAAATATTTGGTTTTAAATCACAA


Top

FusionGenePPI for GNA11_TMCO3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GNA11MTNR1A, RGS3, EDNRA, EDNRB, ELAVL1, RGS14, GNB1, GNAS, CFTR, RGS13, SLC9A3R1, TBXA2R, PLCB1, CXCR5, ABCE1, SLC25A41, FBXL18, HOXB5, NUFIP1, PAPOLA, FYTTD1, TMEM185A, ATM, CCNL2, TMEM180, GNB2, GNB4, TMEM63B, DUSP9, GNG3, DUSP22, GNG4, TRIM25TMCO3EGFR, ELAVL1, HSPB1, GLP1R, TAP2, FNDC5, COG4, IFT57, HEMK1, SLC25A17, TYK2, PSME2, ATG9A, PXMP2, PIGQ, SQLE, GUF1, POTEF, CUL4B, ATP13A2, SREBF2, TUBB8, FADS1, TUBB3, DPH6, TUBA4A, ATP13A3, CUL4A, ADCK2, STX17, SLC26A6, DCAF8, SLC25A6, GGCX, AGPAT5, TMBIM6, DNAAF5, TMEM259, METTL13, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GNA11_TMCO3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GNA11_TMCO3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGNA11C0220633Uveal melanoma3CTD_human;ORPHANET
HgeneGNA11C3809243HYPOCALCEMIA, AUTOSOMAL DOMINANT 22UNIPROT
HgeneGNA11C0018798Congenital Heart Defects1CTD_human
HgeneGNA11C0025202melanoma1CTD_human
HgeneGNA11C1840347HYPOCALCIURIC HYPERCALCEMIA, FAMILIAL, TYPE II (disorder)1ORPHANET;UNIPROT