FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14780

FusionGeneSummary for GLYR1_DCTN5

check button Fusion gene summary
Fusion gene informationFusion gene name: GLYR1_DCTN5
Fusion gene ID: 14780
HgeneTgene
Gene symbol

GLYR1

DCTN5

Gene ID

84656

84516

Gene nameglyoxylate reductase 1 homologdynactin subunit 5
SynonymsBM045|HIBDL|N-PAC|NP60-
Cytomap

16p13.3

16p12.2

Type of geneprotein-codingprotein-coding
Descriptionputative oxidoreductase GLYR13-hydroxyisobutyrate dehydrogenase-like proteincytokine-like nuclear factor n-pacnuclear protein 60 kDanuclear protein 60kDanuclear protein NP60nuclear protein of 60 kDadynactin subunit 5dynactin 4dynactin 5 (p25)dynactin subunit p25
Modification date2018052320180519
UniProtAcc

Q49A26

Q9BTE1

Ensembl transtripts involved in fusion geneENST00000436648, ENST00000321919, 
ENST00000381983, ENST00000591451, 
ENST00000586901, 
ENST00000300087, 
ENST00000563998, ENST00000568589, 
ENST00000568272, 
Fusion gene scores* DoF score5 X 4 X 4=801 X 1 X 1=1
# samples 51
** MAII scorelog2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: GLYR1 [Title/Abstract] AND DCTN5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTranscription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1BI832490GLYR1chr16

4872875

-DCTN5chr16

23654274

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000436648ENST00000300087GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000436648ENST00000563998GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000436648ENST00000568589GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000436648ENST00000568272GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000321919ENST00000300087GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000321919ENST00000563998GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000321919ENST00000568589GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000321919ENST00000568272GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000381983ENST00000300087GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000381983ENST00000563998GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000381983ENST00000568589GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000381983ENST00000568272GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000591451ENST00000300087GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000591451ENST00000563998GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000591451ENST00000568589GLYR1chr16

4872875

-DCTN5chr16

23654274

+
In-frameENST00000591451ENST00000568272GLYR1chr16

4872875

-DCTN5chr16

23654274

+
intron-3CDSENST00000586901ENST00000300087GLYR1chr16

4872875

-DCTN5chr16

23654274

+
intron-3CDSENST00000586901ENST00000563998GLYR1chr16

4872875

-DCTN5chr16

23654274

+
intron-3CDSENST00000586901ENST00000568589GLYR1chr16

4872875

-DCTN5chr16

23654274

+
intron-3CDSENST00000586901ENST00000568272GLYR1chr16

4872875

-DCTN5chr16

23654274

+

Top

FusionProtFeatures for GLYR1_DCTN5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GLYR1

Q49A26

DCTN5

Q9BTE1


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGLYR1chr16:4872875chr16:23654274ENST00000321919-716168_180227554DNA bindingA.T hook
HgeneGLYR1chr16:4872875chr16:23654274ENST00000381983-715168_180227537DNA bindingA.T hook
HgeneGLYR1chr16:4872875chr16:23654274ENST00000591451-716168_180227548DNA bindingA.T hook
HgeneGLYR1chr16:4872875chr16:23654274ENST00000321919-7168_66227554DomainPWWP
HgeneGLYR1chr16:4872875chr16:23654274ENST00000381983-7158_66227537DomainPWWP
HgeneGLYR1chr16:4872875chr16:23654274ENST00000436648-6158_66146473DomainPWWP
HgeneGLYR1chr16:4872875chr16:23654274ENST00000591451-7168_66227548DomainPWWP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGLYR1chr16:4872875chr16:23654274ENST00000436648-615168_180146473DNA bindingA.T hook
HgeneGLYR1chr16:4872875chr16:23654274ENST00000321919-716271_285227554Nucleotide bindingNAD
HgeneGLYR1chr16:4872875chr16:23654274ENST00000381983-715271_285227537Nucleotide bindingNAD
HgeneGLYR1chr16:4872875chr16:23654274ENST00000436648-615271_285146473Nucleotide bindingNAD
HgeneGLYR1chr16:4872875chr16:23654274ENST00000591451-716271_285227548Nucleotide bindingNAD


Top

FusionGeneSequence for GLYR1_DCTN5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GLYR1_ENST00000436648_chr16_4872875_-_DCTN5_ENST00000300087_chr16_23654274_+_167aa
ASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGS

>In-frame_GLYR1_ENST00000436648_chr16_4872875_-_DCTN5_ENST00000563998_chr16_23654274_+_137aa
ASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGS

>In-frame_GLYR1_ENST00000436648_chr16_4872875_-_DCTN5_ENST00000568589_chr16_23654274_+_140aa
ASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGS

>In-frame_GLYR1_ENST00000436648_chr16_4872875_-_DCTN5_ENST00000568272_chr16_23654274_+_69aa

>In-frame_GLYR1_ENST00000321919_chr16_4872875_-_DCTN5_ENST00000300087_chr16_23654274_+_167aa
ASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGS

>In-frame_GLYR1_ENST00000321919_chr16_4872875_-_DCTN5_ENST00000563998_chr16_23654274_+_137aa
ASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGS

>In-frame_GLYR1_ENST00000321919_chr16_4872875_-_DCTN5_ENST00000568589_chr16_23654274_+_140aa
ASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGS

>In-frame_GLYR1_ENST00000321919_chr16_4872875_-_DCTN5_ENST00000568272_chr16_23654274_+_69aa

>In-frame_GLYR1_ENST00000381983_chr16_4872875_-_DCTN5_ENST00000300087_chr16_23654274_+_167aa
ASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGS

>In-frame_GLYR1_ENST00000381983_chr16_4872875_-_DCTN5_ENST00000563998_chr16_23654274_+_137aa
ASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGS

>In-frame_GLYR1_ENST00000381983_chr16_4872875_-_DCTN5_ENST00000568589_chr16_23654274_+_140aa
ASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGS

>In-frame_GLYR1_ENST00000381983_chr16_4872875_-_DCTN5_ENST00000568272_chr16_23654274_+_69aa

>In-frame_GLYR1_ENST00000591451_chr16_4872875_-_DCTN5_ENST00000300087_chr16_23654274_+_167aa
ASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGS

>In-frame_GLYR1_ENST00000591451_chr16_4872875_-_DCTN5_ENST00000563998_chr16_23654274_+_137aa
ASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGS

>In-frame_GLYR1_ENST00000591451_chr16_4872875_-_DCTN5_ENST00000568589_chr16_23654274_+_140aa
ASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGS

>In-frame_GLYR1_ENST00000591451_chr16_4872875_-_DCTN5_ENST00000568272_chr16_23654274_+_69aa


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GLYR1_ENST00000436648_chr16_4872875_-_DCTN5_ENST00000300087_chr16_23654274_+_501nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGT
ATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTC
AGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCC
TATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCA
GAAACTGTGGTTCCACCATTCACTGTCTTCTCAGGCTGCCCAGGACTCTTCTCAGGGGAGCTCCCGGAGTGCACTCAGGAGCTGATGATT

>In-frame_GLYR1_ENST00000436648_chr16_4872875_-_DCTN5_ENST00000563998_chr16_23654274_+_411nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGT
ATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTC
AGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCC
TATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCA

>In-frame_GLYR1_ENST00000436648_chr16_4872875_-_DCTN5_ENST00000568589_chr16_23654274_+_420nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGT
ATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTC
AGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCC
TATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCA

>In-frame_GLYR1_ENST00000436648_chr16_4872875_-_DCTN5_ENST00000568272_chr16_23654274_+_207nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGAACTTTGTCATTTCTGTTTTC
CTGAGCCCATATATCAGATGTCACAGTGCCTGCAGGGATAGAAAGAGATCAGATGAGTCAGTAAGACTGAGTGTGAACAATAGAGAGTGG

>In-frame_GLYR1_ENST00000321919_chr16_4872875_-_DCTN5_ENST00000300087_chr16_23654274_+_501nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGT
ATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTC
AGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCC
TATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCA
GAAACTGTGGTTCCACCATTCACTGTCTTCTCAGGCTGCCCAGGACTCTTCTCAGGGGAGCTCCCGGAGTGCACTCAGGAGCTGATGATT

>In-frame_GLYR1_ENST00000321919_chr16_4872875_-_DCTN5_ENST00000563998_chr16_23654274_+_411nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGT
ATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTC
AGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCC
TATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCA

>In-frame_GLYR1_ENST00000321919_chr16_4872875_-_DCTN5_ENST00000568589_chr16_23654274_+_420nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGT
ATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTC
AGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCC
TATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCA

>In-frame_GLYR1_ENST00000321919_chr16_4872875_-_DCTN5_ENST00000568272_chr16_23654274_+_207nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGAACTTTGTCATTTCTGTTTTC
CTGAGCCCATATATCAGATGTCACAGTGCCTGCAGGGATAGAAAGAGATCAGATGAGTCAGTAAGACTGAGTGTGAACAATAGAGAGTGG

>In-frame_GLYR1_ENST00000381983_chr16_4872875_-_DCTN5_ENST00000300087_chr16_23654274_+_501nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGT
ATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTC
AGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCC
TATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCA
GAAACTGTGGTTCCACCATTCACTGTCTTCTCAGGCTGCCCAGGACTCTTCTCAGGGGAGCTCCCGGAGTGCACTCAGGAGCTGATGATT

>In-frame_GLYR1_ENST00000381983_chr16_4872875_-_DCTN5_ENST00000563998_chr16_23654274_+_411nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGT
ATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTC
AGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCC
TATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCA

>In-frame_GLYR1_ENST00000381983_chr16_4872875_-_DCTN5_ENST00000568589_chr16_23654274_+_420nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGT
ATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTC
AGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCC
TATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCA

>In-frame_GLYR1_ENST00000381983_chr16_4872875_-_DCTN5_ENST00000568272_chr16_23654274_+_207nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGAACTTTGTCATTTCTGTTTTC
CTGAGCCCATATATCAGATGTCACAGTGCCTGCAGGGATAGAAAGAGATCAGATGAGTCAGTAAGACTGAGTGTGAACAATAGAGAGTGG

>In-frame_GLYR1_ENST00000591451_chr16_4872875_-_DCTN5_ENST00000300087_chr16_23654274_+_501nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGT
ATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTC
AGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCC
TATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCA
GAAACTGTGGTTCCACCATTCACTGTCTTCTCAGGCTGCCCAGGACTCTTCTCAGGGGAGCTCCCGGAGTGCACTCAGGAGCTGATGATT

>In-frame_GLYR1_ENST00000591451_chr16_4872875_-_DCTN5_ENST00000563998_chr16_23654274_+_411nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGT
ATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTC
AGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCC
TATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCA

>In-frame_GLYR1_ENST00000591451_chr16_4872875_-_DCTN5_ENST00000568589_chr16_23654274_+_420nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGT
ATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTC
AGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCC
TATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCA

>In-frame_GLYR1_ENST00000591451_chr16_4872875_-_DCTN5_ENST00000568272_chr16_23654274_+_207nt
GCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGAACTTTGTCATTTCTGTTTTC
CTGAGCCCATATATCAGATGTCACAGTGCCTGCAGGGATAGAAAGAGATCAGATGAGTCAGTAAGACTGAGTGTGAACAATAGAGAGTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_GLYR1_ENST00000436648_chr16_4872875_-_DCTN5_ENST00000300087_chr16_23654274_+_3683nt
GGTTGGGTGGTAAGATGGCGGCTGTGAGTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAAGA
TTGTTAATCCACCAAAGGACTTGAAGAAACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGATCA
AAGTGGAACAGCTGAAGCCATATCATGCTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGCTG
TCGAAGAGTTCCTCAGGAGAGCCAAAGGGAAAGACCAGGATCTCACCATCCCGGAGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGA
TGGCCGCGTTTAAATGGCAGCCAACCGCAAGCGAGCCTGTTAAAGATGCAGATCCTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGA
AGGCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACT
GTATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGT
TCAGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTT
CCTATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTC
CAGAAACTGTGGTTCCACCATTCACTGTCTTCTCAGGCTGCCCAGGACTCTTCTCAGGGGAGCTCCCGGAGTGCACTCAGGAGCTGATGA
TTGACGTCACCAAGAGCTACTACCAGAAGTTTTTGCCCCTGACGCAAGTCTAGCATCTCTGCCTCATGTCTTGAATCTGCTTGAGCTCTA
AGATGAACCTGGGGACAAAGTGAGCCAGTCAGCACCTACAAAGAGCTTTTGTGTCTTTGACATCTACCACCCTCCTCCTTTTAAAAAATT
TCTTTAGAATTTCTCAATCTTCAAGGCTCTAAGTGCTTAAGAATTCACTAACAGACAGACCATCTGGAGGAGCTGTCTTCAAATGCTGTG
CTTACACCTTATCTATGAACAGTCACTTTGTACCATTATCTGTGGAACACAGAATCATCTGTTCCCAACACTCCAGCCCCTTGGTCCTGT
GGATGGCTGGATCCCGCCTGAAACGGACCTGCAGAGCAGCAGCACCCTTCCGGTGTGGAGGCTATGTAGCTGGTGCGCTGCTCACGGCCA
TTCACTGCCCATGCTGAGCGCCTCTCACACAGGTAATGCCCAGCTTTTCTGCTGCTAACACATTTGGCCAGTTGTTGCAGTTGCTCATCA
TCTTGGGAAAGGTGTTTGTGACTTTTCAGAGCCCAGATTCCTGTTGTCTATTAAAACTTGAAGGGAGGGGTGAATAGTGTTTCTCTCTTC
TTCCCAAAATGACCTTAGCTGTCCTAGGATAGTTAGTAAAAGACTTTTTAGCATTTTGACCTAGGGCCTTTGGCTTTCACTAAAAGTGGG
GACCTCAGTATCCCAGATTGTAATTTTGCCAAGTGTTAGATTTGAGTCTCTCATGTGGATGCATTAGTCAGGTGGTTACTCCTTGCTTCA
AGGTACTTACCTTATTTCATTGAAGACACCGCATTTGTGAACTCTTGCTTCCTGGCCTAGAACCATTCAGCCTACCCTGTATTTGCCATA
AACTCCACAATTCACACCAAAATGTCTGTACTTAGAGCTAATTCGCATATATACAGGAAGGGCTCTTAGAATCAGTTTGTGGGCACAGAG
CCTCAGGAGTAAATGAAGTTACTAGGGCTGTTCTTACCATCTCCTTCTGGCCAAATAGCACAACATTTCCTCGTTCTGCTCTGACCTCTT
AGCTTAGAAGGAAGATTCAGAAGTGAGGGGCTAAGAAGGTTGTCCTTGCCTAATGCTCTGATCTGTAAGTGAATAGGGCAGAACAGTTCA
GCCTTGAGGTTAGAATTTAGCAGGAGCTATCCTGACTTAATATCCAGTTGTGGGGTTTGCAAAACAAAACAGCTGTATGTAATCATTGCC
ACTAGTTCCATCTAGAACTCCTTTCTAGTTTGTTATTTTTAAAATGTTTATACATAAAACCACCAAAATACATAGCTTCGACAAGATGGA
AGTTTATTTCTCTCTCCCATAACAGTGCAGTGATAGTCAGCTGGTCCAGGCCAGGCAAGGGGCTGGTCCATGATGTCATCAGGCACCCAG
GTTCCTACTGTCTTGCCATGTGGCCACAGTTAGCAACAAAGGAGGCTGTAAATTTAGTTTCTACTTGGGCAGCCAAAACTCTGAGGAAGG
AGATTCTGCTAGTAAAAAGGAGTGGGGGAAGAATGGCCATTGGGAGACAACAAGCAGACTCAACCAGGCCTCTTTGTTGGCTTCCTTTCC
TCCTGCTGCACATGAGCCTTCGCCGTGCATTTGGAGCCATGACAGCTGATAGCTCCAGACCTGCATCCTCCTAGCTTGGGGGCTCTGAAT
GAAAGGTTTCTTCCCTTCCAGTTCGAATTTGGAAACTCCCAAAGTTCTCAATGGTTTGTTGTGAGTTCCATGTCCTCTTGGATCAGTCAC
TGTGGCCATGCATGTTTGGCCACATGATTAATCCAGTCTGGGTCATGACCTTTTCTTCATCCAAAACAAGGTGATGGGAAGACAAAAACA
ATAGCTACTACAAACAATAGGAGTTTATAATTATGTGCTGATGTATTCGAAGATGTGTTGACAGTCGTGAGTGTGTATCCTAGGAAAGGC
GAGCTGGACTCTGTCTCCATGGTGGCTCTCACCCCAGGGACCTAGGAACAGCCTGTCACCACACAATTACTTTTATAACCCTGGAGATGA
AAATCTCCTTGTCCTCAAAATACTTCCAGAAGAACAACCAGATGGGAAGGACCTTGGTTGGGACTCTTTCCAGTTCACTTGGGGCAGAGG
GAATTTAATGGCTCACGTAGCTGAAAAGGATGGGCTAGATTGGGCTTCAGGCTGCATCCCAGGACTCCAAACAGGGATCTGTCTCTTTGG
CTCTCAGCTCTGCTTTCATTTGAGTTGGCTTTATTCTTGGGCTTCACAGTGTGGCCCCACAGCACCAGTTATTGATAAAAAGAGCTCCCC
TTTGCTGACAGAACTGCTGGATTTGGTTCTCATTGGTCCAGACGAGGAAGGTATCCAGCCTCAAGTCATCATTGTGGCCAGGAAGATGGA
ATACACCAAATGGACAGGCCTGGCATGTACCCACAGAGACTGAGAGTTGGTGCTGGTGGTTGTGGTGGCAGATGATATTACCTGAAGAAG
GGACGAATGGGTGCTGGGCAGGACAAAGCATCAGCTGTCCAGTTCAGGCCTCTCCTCTTTCCCTGGTGTCTTCATTTTCCTCCGTCTCCC
TGCTGTCCCTTACCCTCTGCCCAATCTCTCATTACTCCTGGTCTTGGGAGTTGCCTTCTGAGGATACTCCACTGGGGGTACCTGAGCCTG

>In-frame_GLYR1_ENST00000436648_chr16_4872875_-_DCTN5_ENST00000563998_chr16_23654274_+_1210nt
GGTTGGGTGGTAAGATGGCGGCTGTGAGTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAAGA
TTGTTAATCCACCAAAGGACTTGAAGAAACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGATCA
AAGTGGAACAGCTGAAGCCATATCATGCTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGCTG
TCGAAGAGTTCCTCAGGAGAGCCAAAGGGAAAGACCAGGATCTCACCATCCCGGAGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGA
TGGCCGCGTTTAAATGGCAGCCAACCGCAAGCGAGCCTGTTAAAGATGCAGATCCTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGA
AGGCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACT
GTATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGT
TCAGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTT
CCTATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTC
CAGAAACTGTGGTTCCACCATTCACTGTCTTCTCAGGCTGCCCAGCTCCTTAGAGCTGGGTCTTTCTTTCCCCAGGACTCTTCTCAGGGG
AGCTCCCGGAGTGCACTCAGGAGCTGATGATTGACGTCACCAAGAGCTACTACCAGAAGTTTTTGCCCCTGACGCAAGTCTAGCATCTCT
GCCTCATGTCTTGAATCTGCTTGAGCTCTAAGATGAACCTGGGGACAAAGTGAGCCAGTCAGCACCTACAAAGAGCTTTTGTGTCTTTGA
CATCTACCACCCTCCTCCTTTTAAAAAATTTCTTTAGAATTTCTCAATCTTCAAGGCTCTAAGTGCTTAAGAATTCACTAACAGACAGAC

>In-frame_GLYR1_ENST00000436648_chr16_4872875_-_DCTN5_ENST00000568589_chr16_23654274_+_1144nt
GGTTGGGTGGTAAGATGGCGGCTGTGAGTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAAGA
TTGTTAATCCACCAAAGGACTTGAAGAAACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGATCA
AAGTGGAACAGCTGAAGCCATATCATGCTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGCTG
TCGAAGAGTTCCTCAGGAGAGCCAAAGGGAAAGACCAGGATCTCACCATCCCGGAGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGA
TGGCCGCGTTTAAATGGCAGCCAACCGCAAGCGAGCCTGTTAAAGATGCAGATCCTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGA
AGGCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACT
GTATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGT
TCAGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTT
CCTATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTC
CAGAAACTGTGGTTCCACCATTCACTGTCTTCTCAGGCTGCCCAGGTAACCTTGGCTGTTGATTAATTTTATTTTAACTTCCTAAAACTC
AGTTGTATTTTCCATCGCAAAAGTAATGCTTACGATTCCTATCTCTGGCAATATGTTGATAGAGCTAACTTAGAAATTCACCTGTACAAA
GTACCTAGAAATGCTACCTAACATATAACAAGCATCTGTTTAAATGCATAATTGGGTTCACCAGAAAATAAGGAAATTATGAAGGGCCAA

>In-frame_GLYR1_ENST00000436648_chr16_4872875_-_DCTN5_ENST00000568272_chr16_23654274_+_913nt
GGTTGGGTGGTAAGATGGCGGCTGTGAGTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAAGA
TTGTTAATCCACCAAAGGACTTGAAGAAACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGATCA
AAGTGGAACAGCTGAAGCCATATCATGCTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGCTG
TCGAAGAGTTCCTCAGGAGAGCCAAAGGGAAAGACCAGGATCTCACCATCCCGGAGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGA
TGGCCGCGTTTAAATGGCAGCCAACCGCAAGCGAGCCTGTTAAAGATGCAGATCCTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGA
AGGCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGAACTTTGTCATTTCTGTTT
TCCTGAGCCCATATATCAGATGTCACAGTGCCTGCAGGGATAGAAAGAGATCAGATGAGTCAGTAAGACTGAGTGTGAACAATAGAGAGT
GGTGGGGCCTGGTGAATTGGAGAATGTGACCAATCTAAGCCCAAGCTGGTTGTTACTGTGTGGGAATACAGGCCCACGTGGCAACAATCA
GCTTTCCAGAGCGTCTGATTCTTTTTCAAAAGCAACTGGAAATCTCACTTTTTAAAATGCAAGATGTTCCACTACTCAAATAGTAATGTT
TAATTTTAAATGATTTGTTAAAATGCCACGTGTCCTTCCTGTAGGAGATAGCTAAAAAAAATTAAAAGAAATAAATAATAAAAATGCTGC

>In-frame_GLYR1_ENST00000321919_chr16_4872875_-_DCTN5_ENST00000300087_chr16_23654274_+_3989nt
GGCCCACTCCAATGGGCGGCGCCGGGGCGACTTGCTGTTCCCGGCGGCCCGTGCGTCGGCGGTGGTTGGGTGGTAAGATGGCGGCTGTGA
GTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAAGATTGTTAATCCACCAAAGGACTTGAAGA
AACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGATCAAAGTGGAACAGCTGAAGCCATATCATG
CTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGCTGTCGAAGAGTTCCTCAGGAGAGCCAAAG
GGAAAGACCAGACGTCATCCCACAATTCTTCTGATGACAAGAATCGACGTAATTCCAGTGAGGAGAGAAGTAGGCCAAACTCAGGTGATG
AGAAGCGCAAACTTAGCCTGTCTGAAGGGAAGGTGAAGAAGAACATGGGAGAAGGAAAGAAGAGGGTGTCTTCAGGCTCTTCAGAGAGAG
GCTCCAAATCCCCTCTGAAAAGAGCCCAAGAGCAAAGTCCCCGGAAGCGGGGTCGGCCCCCAAAGGATGAGAAGGATCTCACCATCCCGG
AGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGATGGCCGCGTTTAAATGGCAGCCAACCGCAAGCGAGCCTGTTAAAGATGCAGATC
CTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGAAGGCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACA
TCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGTATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGA
AAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTCAGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTG
AGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCCTATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAG
ACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCAGAAACTGTGGTTCCACCATTCACTGTCTTCTCAGGCTGCCCAGGACTCTTCT
CAGGGGAGCTCCCGGAGTGCACTCAGGAGCTGATGATTGACGTCACCAAGAGCTACTACCAGAAGTTTTTGCCCCTGACGCAAGTCTAGC
ATCTCTGCCTCATGTCTTGAATCTGCTTGAGCTCTAAGATGAACCTGGGGACAAAGTGAGCCAGTCAGCACCTACAAAGAGCTTTTGTGT
CTTTGACATCTACCACCCTCCTCCTTTTAAAAAATTTCTTTAGAATTTCTCAATCTTCAAGGCTCTAAGTGCTTAAGAATTCACTAACAG
ACAGACCATCTGGAGGAGCTGTCTTCAAATGCTGTGCTTACACCTTATCTATGAACAGTCACTTTGTACCATTATCTGTGGAACACAGAA
TCATCTGTTCCCAACACTCCAGCCCCTTGGTCCTGTGGATGGCTGGATCCCGCCTGAAACGGACCTGCAGAGCAGCAGCACCCTTCCGGT
GTGGAGGCTATGTAGCTGGTGCGCTGCTCACGGCCATTCACTGCCCATGCTGAGCGCCTCTCACACAGGTAATGCCCAGCTTTTCTGCTG
CTAACACATTTGGCCAGTTGTTGCAGTTGCTCATCATCTTGGGAAAGGTGTTTGTGACTTTTCAGAGCCCAGATTCCTGTTGTCTATTAA
AACTTGAAGGGAGGGGTGAATAGTGTTTCTCTCTTCTTCCCAAAATGACCTTAGCTGTCCTAGGATAGTTAGTAAAAGACTTTTTAGCAT
TTTGACCTAGGGCCTTTGGCTTTCACTAAAAGTGGGGACCTCAGTATCCCAGATTGTAATTTTGCCAAGTGTTAGATTTGAGTCTCTCAT
GTGGATGCATTAGTCAGGTGGTTACTCCTTGCTTCAAGGTACTTACCTTATTTCATTGAAGACACCGCATTTGTGAACTCTTGCTTCCTG
GCCTAGAACCATTCAGCCTACCCTGTATTTGCCATAAACTCCACAATTCACACCAAAATGTCTGTACTTAGAGCTAATTCGCATATATAC
AGGAAGGGCTCTTAGAATCAGTTTGTGGGCACAGAGCCTCAGGAGTAAATGAAGTTACTAGGGCTGTTCTTACCATCTCCTTCTGGCCAA
ATAGCACAACATTTCCTCGTTCTGCTCTGACCTCTTAGCTTAGAAGGAAGATTCAGAAGTGAGGGGCTAAGAAGGTTGTCCTTGCCTAAT
GCTCTGATCTGTAAGTGAATAGGGCAGAACAGTTCAGCCTTGAGGTTAGAATTTAGCAGGAGCTATCCTGACTTAATATCCAGTTGTGGG
GTTTGCAAAACAAAACAGCTGTATGTAATCATTGCCACTAGTTCCATCTAGAACTCCTTTCTAGTTTGTTATTTTTAAAATGTTTATACA
TAAAACCACCAAAATACATAGCTTCGACAAGATGGAAGTTTATTTCTCTCTCCCATAACAGTGCAGTGATAGTCAGCTGGTCCAGGCCAG
GCAAGGGGCTGGTCCATGATGTCATCAGGCACCCAGGTTCCTACTGTCTTGCCATGTGGCCACAGTTAGCAACAAAGGAGGCTGTAAATT
TAGTTTCTACTTGGGCAGCCAAAACTCTGAGGAAGGAGATTCTGCTAGTAAAAAGGAGTGGGGGAAGAATGGCCATTGGGAGACAACAAG
CAGACTCAACCAGGCCTCTTTGTTGGCTTCCTTTCCTCCTGCTGCACATGAGCCTTCGCCGTGCATTTGGAGCCATGACAGCTGATAGCT
CCAGACCTGCATCCTCCTAGCTTGGGGGCTCTGAATGAAAGGTTTCTTCCCTTCCAGTTCGAATTTGGAAACTCCCAAAGTTCTCAATGG
TTTGTTGTGAGTTCCATGTCCTCTTGGATCAGTCACTGTGGCCATGCATGTTTGGCCACATGATTAATCCAGTCTGGGTCATGACCTTTT
CTTCATCCAAAACAAGGTGATGGGAAGACAAAAACAATAGCTACTACAAACAATAGGAGTTTATAATTATGTGCTGATGTATTCGAAGAT
GTGTTGACAGTCGTGAGTGTGTATCCTAGGAAAGGCGAGCTGGACTCTGTCTCCATGGTGGCTCTCACCCCAGGGACCTAGGAACAGCCT
GTCACCACACAATTACTTTTATAACCCTGGAGATGAAAATCTCCTTGTCCTCAAAATACTTCCAGAAGAACAACCAGATGGGAAGGACCT
TGGTTGGGACTCTTTCCAGTTCACTTGGGGCAGAGGGAATTTAATGGCTCACGTAGCTGAAAAGGATGGGCTAGATTGGGCTTCAGGCTG
CATCCCAGGACTCCAAACAGGGATCTGTCTCTTTGGCTCTCAGCTCTGCTTTCATTTGAGTTGGCTTTATTCTTGGGCTTCACAGTGTGG
CCCCACAGCACCAGTTATTGATAAAAAGAGCTCCCCTTTGCTGACAGAACTGCTGGATTTGGTTCTCATTGGTCCAGACGAGGAAGGTAT
CCAGCCTCAAGTCATCATTGTGGCCAGGAAGATGGAATACACCAAATGGACAGGCCTGGCATGTACCCACAGAGACTGAGAGTTGGTGCT
GGTGGTTGTGGTGGCAGATGATATTACCTGAAGAAGGGACGAATGGGTGCTGGGCAGGACAAAGCATCAGCTGTCCAGTTCAGGCCTCTC
CTCTTTCCCTGGTGTCTTCATTTTCCTCCGTCTCCCTGCTGTCCCTTACCCTCTGCCCAATCTCTCATTACTCCTGGTCTTGGGAGTTGC
CTTCTGAGGATACTCCACTGGGGGTACCTGAGCCTGGATTAGAGGGCAGGGGGAGGATATTGCCTAGCCAAAGTGGGTGTTCAATAAAGA

>In-frame_GLYR1_ENST00000321919_chr16_4872875_-_DCTN5_ENST00000563998_chr16_23654274_+_1516nt
GGCCCACTCCAATGGGCGGCGCCGGGGCGACTTGCTGTTCCCGGCGGCCCGTGCGTCGGCGGTGGTTGGGTGGTAAGATGGCGGCTGTGA
GTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAAGATTGTTAATCCACCAAAGGACTTGAAGA
AACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGATCAAAGTGGAACAGCTGAAGCCATATCATG
CTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGCTGTCGAAGAGTTCCTCAGGAGAGCCAAAG
GGAAAGACCAGACGTCATCCCACAATTCTTCTGATGACAAGAATCGACGTAATTCCAGTGAGGAGAGAAGTAGGCCAAACTCAGGTGATG
AGAAGCGCAAACTTAGCCTGTCTGAAGGGAAGGTGAAGAAGAACATGGGAGAAGGAAAGAAGAGGGTGTCTTCAGGCTCTTCAGAGAGAG
GCTCCAAATCCCCTCTGAAAAGAGCCCAAGAGCAAAGTCCCCGGAAGCGGGGTCGGCCCCCAAAGGATGAGAAGGATCTCACCATCCCGG
AGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGATGGCCGCGTTTAAATGGCAGCCAACCGCAAGCGAGCCTGTTAAAGATGCAGATC
CTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGAAGGCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACA
TCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGTATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGA
AAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTCAGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTG
AGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCCTATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAG
ACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCAGAAACTGTGGTTCCACCATTCACTGTCTTCTCAGGCTGCCCAGCTCCTTAGA
GCTGGGTCTTTCTTTCCCCAGGACTCTTCTCAGGGGAGCTCCCGGAGTGCACTCAGGAGCTGATGATTGACGTCACCAAGAGCTACTACC
AGAAGTTTTTGCCCCTGACGCAAGTCTAGCATCTCTGCCTCATGTCTTGAATCTGCTTGAGCTCTAAGATGAACCTGGGGACAAAGTGAG
CCAGTCAGCACCTACAAAGAGCTTTTGTGTCTTTGACATCTACCACCCTCCTCCTTTTAAAAAATTTCTTTAGAATTTCTCAATCTTCAA

>In-frame_GLYR1_ENST00000321919_chr16_4872875_-_DCTN5_ENST00000568589_chr16_23654274_+_1450nt
GGCCCACTCCAATGGGCGGCGCCGGGGCGACTTGCTGTTCCCGGCGGCCCGTGCGTCGGCGGTGGTTGGGTGGTAAGATGGCGGCTGTGA
GTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAAGATTGTTAATCCACCAAAGGACTTGAAGA
AACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGATCAAAGTGGAACAGCTGAAGCCATATCATG
CTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGCTGTCGAAGAGTTCCTCAGGAGAGCCAAAG
GGAAAGACCAGACGTCATCCCACAATTCTTCTGATGACAAGAATCGACGTAATTCCAGTGAGGAGAGAAGTAGGCCAAACTCAGGTGATG
AGAAGCGCAAACTTAGCCTGTCTGAAGGGAAGGTGAAGAAGAACATGGGAGAAGGAAAGAAGAGGGTGTCTTCAGGCTCTTCAGAGAGAG
GCTCCAAATCCCCTCTGAAAAGAGCCCAAGAGCAAAGTCCCCGGAAGCGGGGTCGGCCCCCAAAGGATGAGAAGGATCTCACCATCCCGG
AGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGATGGCCGCGTTTAAATGGCAGCCAACCGCAAGCGAGCCTGTTAAAGATGCAGATC
CTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGAAGGCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACA
TCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGTATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGTCATTGTGTTGTGA
AAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTCAGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGACCATGTCTTTATTG
AGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCCTATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGATGTGTGTTGAAAG
ACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCAGAAACTGTGGTTCCACCATTCACTGTCTTCTCAGGCTGCCCAGGTAACCTTG
GCTGTTGATTAATTTTATTTTAACTTCCTAAAACTCAGTTGTATTTTCCATCGCAAAAGTAATGCTTACGATTCCTATCTCTGGCAATAT
GTTGATAGAGCTAACTTAGAAATTCACCTGTACAAAGTACCTAGAAATGCTACCTAACATATAACAAGCATCTGTTTAAATGCATAATTG
GGTTCACCAGAAAATAAGGAAATTATGAAGGGCCAAACACAAAGAGGAAACTAAGCCCAAGCTGTGAGATTGCACGGGTTAATGCTGTCT

>In-frame_GLYR1_ENST00000321919_chr16_4872875_-_DCTN5_ENST00000568272_chr16_23654274_+_1219nt
GGCCCACTCCAATGGGCGGCGCCGGGGCGACTTGCTGTTCCCGGCGGCCCGTGCGTCGGCGGTGGTTGGGTGGTAAGATGGCGGCTGTGA
GTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAAGATTGTTAATCCACCAAAGGACTTGAAGA
AACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGATCAAAGTGGAACAGCTGAAGCCATATCATG
CTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGCTGTCGAAGAGTTCCTCAGGAGAGCCAAAG
GGAAAGACCAGACGTCATCCCACAATTCTTCTGATGACAAGAATCGACGTAATTCCAGTGAGGAGAGAAGTAGGCCAAACTCAGGTGATG
AGAAGCGCAAACTTAGCCTGTCTGAAGGGAAGGTGAAGAAGAACATGGGAGAAGGAAAGAAGAGGGTGTCTTCAGGCTCTTCAGAGAGAG
GCTCCAAATCCCCTCTGAAAAGAGCCCAAGAGCAAAGTCCCCGGAAGCGGGGTCGGCCCCCAAAGGATGAGAAGGATCTCACCATCCCGG
AGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGATGGCCGCGTTTAAATGGCAGCCAACCGCAAGCGAGCCTGTTAAAGATGCAGATC
CTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGAAGGCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGTGGAAGCCAGAACA
TCGTTCTCAATGGCAAGAACTTTGTCATTTCTGTTTTCCTGAGCCCATATATCAGATGTCACAGTGCCTGCAGGGATAGAAAGAGATCAG
ATGAGTCAGTAAGACTGAGTGTGAACAATAGAGAGTGGTGGGGCCTGGTGAATTGGAGAATGTGACCAATCTAAGCCCAAGCTGGTTGTT
ACTGTGTGGGAATACAGGCCCACGTGGCAACAATCAGCTTTCCAGAGCGTCTGATTCTTTTTCAAAAGCAACTGGAAATCTCACTTTTTA
AAATGCAAGATGTTCCACTACTCAAATAGTAATGTTTAATTTTAAATGATTTGTTAAAATGCCACGTGTCCTTCCTGTAGGAGATAGCTA

>In-frame_GLYR1_ENST00000381983_chr16_4872875_-_DCTN5_ENST00000300087_chr16_23654274_+_3928nt
GTGGTTGGGTGGTAAGATGGCGGCTGTGAGTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAA
GATTGTTAATCCACCAAAGGACTTGAAGAAACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGAT
CAAAGTGGAACAGCTGAAGCCATATCATGCTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGC
TGTCGAAGAGTTCCTCAGGAGAGCCAAAGGGAAAGACCAGACGTCATCCCACAATTCTTCTGATGACAAGAATCGACGTAATTCCAGTGA
GGAGAGAAGTAGGCCAAACTCAGGTGATGAGAAGCGCAAACTTAGCCTGTCTGAAGGGAAGGTGAAGAAGAACATGGGAGAAGGAAAGAA
GAGGGTGTCTTCAGGCTCTTCAGAGAGAGGCTCCAAATCCCCTCTGAAAAGAGCCCAAGAGCAAAGTCCCCGGAAGCGGGGTCGGCCCCC
AAAGGATGAGAAGGATCTCACCATCCCGGAGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGATGGCCGCGTTTAAATGGCAGCCAAC
CGCAAGCGAGCCTGTTAAAGATGCAGATCCTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGAAGGCATCTGGGAACAAAGTCAGTCG
CCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGTATTATCCGAGGGGATCTGGCAAA
TGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTCAGCAAAGGTGTTGCATTCTTTCC
TTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCCTATGTTCATGTTGGGAAGAACTG
TGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCAGAAACTGTGGTTCCACCATTCAC
TGTCTTCTCAGGCTGCCCAGGACTCTTCTCAGGGGAGCTCCCGGAGTGCACTCAGGAGCTGATGATTGACGTCACCAAGAGCTACTACCA
GAAGTTTTTGCCCCTGACGCAAGTCTAGCATCTCTGCCTCATGTCTTGAATCTGCTTGAGCTCTAAGATGAACCTGGGGACAAAGTGAGC
CAGTCAGCACCTACAAAGAGCTTTTGTGTCTTTGACATCTACCACCCTCCTCCTTTTAAAAAATTTCTTTAGAATTTCTCAATCTTCAAG
GCTCTAAGTGCTTAAGAATTCACTAACAGACAGACCATCTGGAGGAGCTGTCTTCAAATGCTGTGCTTACACCTTATCTATGAACAGTCA
CTTTGTACCATTATCTGTGGAACACAGAATCATCTGTTCCCAACACTCCAGCCCCTTGGTCCTGTGGATGGCTGGATCCCGCCTGAAACG
GACCTGCAGAGCAGCAGCACCCTTCCGGTGTGGAGGCTATGTAGCTGGTGCGCTGCTCACGGCCATTCACTGCCCATGCTGAGCGCCTCT
CACACAGGTAATGCCCAGCTTTTCTGCTGCTAACACATTTGGCCAGTTGTTGCAGTTGCTCATCATCTTGGGAAAGGTGTTTGTGACTTT
TCAGAGCCCAGATTCCTGTTGTCTATTAAAACTTGAAGGGAGGGGTGAATAGTGTTTCTCTCTTCTTCCCAAAATGACCTTAGCTGTCCT
AGGATAGTTAGTAAAAGACTTTTTAGCATTTTGACCTAGGGCCTTTGGCTTTCACTAAAAGTGGGGACCTCAGTATCCCAGATTGTAATT
TTGCCAAGTGTTAGATTTGAGTCTCTCATGTGGATGCATTAGTCAGGTGGTTACTCCTTGCTTCAAGGTACTTACCTTATTTCATTGAAG
ACACCGCATTTGTGAACTCTTGCTTCCTGGCCTAGAACCATTCAGCCTACCCTGTATTTGCCATAAACTCCACAATTCACACCAAAATGT
CTGTACTTAGAGCTAATTCGCATATATACAGGAAGGGCTCTTAGAATCAGTTTGTGGGCACAGAGCCTCAGGAGTAAATGAAGTTACTAG
GGCTGTTCTTACCATCTCCTTCTGGCCAAATAGCACAACATTTCCTCGTTCTGCTCTGACCTCTTAGCTTAGAAGGAAGATTCAGAAGTG
AGGGGCTAAGAAGGTTGTCCTTGCCTAATGCTCTGATCTGTAAGTGAATAGGGCAGAACAGTTCAGCCTTGAGGTTAGAATTTAGCAGGA
GCTATCCTGACTTAATATCCAGTTGTGGGGTTTGCAAAACAAAACAGCTGTATGTAATCATTGCCACTAGTTCCATCTAGAACTCCTTTC
TAGTTTGTTATTTTTAAAATGTTTATACATAAAACCACCAAAATACATAGCTTCGACAAGATGGAAGTTTATTTCTCTCTCCCATAACAG
TGCAGTGATAGTCAGCTGGTCCAGGCCAGGCAAGGGGCTGGTCCATGATGTCATCAGGCACCCAGGTTCCTACTGTCTTGCCATGTGGCC
ACAGTTAGCAACAAAGGAGGCTGTAAATTTAGTTTCTACTTGGGCAGCCAAAACTCTGAGGAAGGAGATTCTGCTAGTAAAAAGGAGTGG
GGGAAGAATGGCCATTGGGAGACAACAAGCAGACTCAACCAGGCCTCTTTGTTGGCTTCCTTTCCTCCTGCTGCACATGAGCCTTCGCCG
TGCATTTGGAGCCATGACAGCTGATAGCTCCAGACCTGCATCCTCCTAGCTTGGGGGCTCTGAATGAAAGGTTTCTTCCCTTCCAGTTCG
AATTTGGAAACTCCCAAAGTTCTCAATGGTTTGTTGTGAGTTCCATGTCCTCTTGGATCAGTCACTGTGGCCATGCATGTTTGGCCACAT
GATTAATCCAGTCTGGGTCATGACCTTTTCTTCATCCAAAACAAGGTGATGGGAAGACAAAAACAATAGCTACTACAAACAATAGGAGTT
TATAATTATGTGCTGATGTATTCGAAGATGTGTTGACAGTCGTGAGTGTGTATCCTAGGAAAGGCGAGCTGGACTCTGTCTCCATGGTGG
CTCTCACCCCAGGGACCTAGGAACAGCCTGTCACCACACAATTACTTTTATAACCCTGGAGATGAAAATCTCCTTGTCCTCAAAATACTT
CCAGAAGAACAACCAGATGGGAAGGACCTTGGTTGGGACTCTTTCCAGTTCACTTGGGGCAGAGGGAATTTAATGGCTCACGTAGCTGAA
AAGGATGGGCTAGATTGGGCTTCAGGCTGCATCCCAGGACTCCAAACAGGGATCTGTCTCTTTGGCTCTCAGCTCTGCTTTCATTTGAGT
TGGCTTTATTCTTGGGCTTCACAGTGTGGCCCCACAGCACCAGTTATTGATAAAAAGAGCTCCCCTTTGCTGACAGAACTGCTGGATTTG
GTTCTCATTGGTCCAGACGAGGAAGGTATCCAGCCTCAAGTCATCATTGTGGCCAGGAAGATGGAATACACCAAATGGACAGGCCTGGCA
TGTACCCACAGAGACTGAGAGTTGGTGCTGGTGGTTGTGGTGGCAGATGATATTACCTGAAGAAGGGACGAATGGGTGCTGGGCAGGACA
AAGCATCAGCTGTCCAGTTCAGGCCTCTCCTCTTTCCCTGGTGTCTTCATTTTCCTCCGTCTCCCTGCTGTCCCTTACCCTCTGCCCAAT
CTCTCATTACTCCTGGTCTTGGGAGTTGCCTTCTGAGGATACTCCACTGGGGGTACCTGAGCCTGGATTAGAGGGCAGGGGGAGGATATT

>In-frame_GLYR1_ENST00000381983_chr16_4872875_-_DCTN5_ENST00000563998_chr16_23654274_+_1455nt
GTGGTTGGGTGGTAAGATGGCGGCTGTGAGTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAA
GATTGTTAATCCACCAAAGGACTTGAAGAAACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGAT
CAAAGTGGAACAGCTGAAGCCATATCATGCTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGC
TGTCGAAGAGTTCCTCAGGAGAGCCAAAGGGAAAGACCAGACGTCATCCCACAATTCTTCTGATGACAAGAATCGACGTAATTCCAGTGA
GGAGAGAAGTAGGCCAAACTCAGGTGATGAGAAGCGCAAACTTAGCCTGTCTGAAGGGAAGGTGAAGAAGAACATGGGAGAAGGAAAGAA
GAGGGTGTCTTCAGGCTCTTCAGAGAGAGGCTCCAAATCCCCTCTGAAAAGAGCCCAAGAGCAAAGTCCCCGGAAGCGGGGTCGGCCCCC
AAAGGATGAGAAGGATCTCACCATCCCGGAGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGATGGCCGCGTTTAAATGGCAGCCAAC
CGCAAGCGAGCCTGTTAAAGATGCAGATCCTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGAAGGCATCTGGGAACAAAGTCAGTCG
CCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGTATTATCCGAGGGGATCTGGCAAA
TGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTCAGCAAAGGTGTTGCATTCTTTCC
TTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCCTATGTTCATGTTGGGAAGAACTG
TGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCAGAAACTGTGGTTCCACCATTCAC
TGTCTTCTCAGGCTGCCCAGCTCCTTAGAGCTGGGTCTTTCTTTCCCCAGGACTCTTCTCAGGGGAGCTCCCGGAGTGCACTCAGGAGCT
GATGATTGACGTCACCAAGAGCTACTACCAGAAGTTTTTGCCCCTGACGCAAGTCTAGCATCTCTGCCTCATGTCTTGAATCTGCTTGAG
CTCTAAGATGAACCTGGGGACAAAGTGAGCCAGTCAGCACCTACAAAGAGCTTTTGTGTCTTTGACATCTACCACCCTCCTCCTTTTAAA
AAATTTCTTTAGAATTTCTCAATCTTCAAGGCTCTAAGTGCTTAAGAATTCACTAACAGACAGACCATCTGGAGGAGCTGTCTTCAAATG

>In-frame_GLYR1_ENST00000381983_chr16_4872875_-_DCTN5_ENST00000568589_chr16_23654274_+_1389nt
GTGGTTGGGTGGTAAGATGGCGGCTGTGAGTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAA
GATTGTTAATCCACCAAAGGACTTGAAGAAACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGAT
CAAAGTGGAACAGCTGAAGCCATATCATGCTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGC
TGTCGAAGAGTTCCTCAGGAGAGCCAAAGGGAAAGACCAGACGTCATCCCACAATTCTTCTGATGACAAGAATCGACGTAATTCCAGTGA
GGAGAGAAGTAGGCCAAACTCAGGTGATGAGAAGCGCAAACTTAGCCTGTCTGAAGGGAAGGTGAAGAAGAACATGGGAGAAGGAAAGAA
GAGGGTGTCTTCAGGCTCTTCAGAGAGAGGCTCCAAATCCCCTCTGAAAAGAGCCCAAGAGCAAAGTCCCCGGAAGCGGGGTCGGCCCCC
AAAGGATGAGAAGGATCTCACCATCCCGGAGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGATGGCCGCGTTTAAATGGCAGCCAAC
CGCAAGCGAGCCTGTTAAAGATGCAGATCCTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGAAGGCATCTGGGAACAAAGTCAGTCG
CCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGTATTATCCGAGGGGATCTGGCAAA
TGTAAGAGTTGGACGTCATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTCAGCAAAGGTGTTGCATTCTTTCC
TTTACATATTGGAGACCATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCCTATGTTCATGTTGGGAAGAACTG
TGTGATTGGGCGCCGATGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCAGAAACTGTGGTTCCACCATTCAC
TGTCTTCTCAGGCTGCCCAGGTAACCTTGGCTGTTGATTAATTTTATTTTAACTTCCTAAAACTCAGTTGTATTTTCCATCGCAAAAGTA
ATGCTTACGATTCCTATCTCTGGCAATATGTTGATAGAGCTAACTTAGAAATTCACCTGTACAAAGTACCTAGAAATGCTACCTAACATA
TAACAAGCATCTGTTTAAATGCATAATTGGGTTCACCAGAAAATAAGGAAATTATGAAGGGCCAAACACAAAGAGGAAACTAAGCCCAAG

>In-frame_GLYR1_ENST00000381983_chr16_4872875_-_DCTN5_ENST00000568272_chr16_23654274_+_1158nt
GTGGTTGGGTGGTAAGATGGCGGCTGTGAGTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAA
GATTGTTAATCCACCAAAGGACTTGAAGAAACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGAT
CAAAGTGGAACAGCTGAAGCCATATCATGCTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGC
TGTCGAAGAGTTCCTCAGGAGAGCCAAAGGGAAAGACCAGACGTCATCCCACAATTCTTCTGATGACAAGAATCGACGTAATTCCAGTGA
GGAGAGAAGTAGGCCAAACTCAGGTGATGAGAAGCGCAAACTTAGCCTGTCTGAAGGGAAGGTGAAGAAGAACATGGGAGAAGGAAAGAA
GAGGGTGTCTTCAGGCTCTTCAGAGAGAGGCTCCAAATCCCCTCTGAAAAGAGCCCAAGAGCAAAGTCCCCGGAAGCGGGGTCGGCCCCC
AAAGGATGAGAAGGATCTCACCATCCCGGAGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGATGGCCGCGTTTAAATGGCAGCCAAC
CGCAAGCGAGCCTGTTAAAGATGCAGATCCTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGAAGGCATCTGGGAACAAAGTCAGTCG
CCAGTCAGTGTTGTGTGGAAGCCAGAACATCGTTCTCAATGGCAAGAACTTTGTCATTTCTGTTTTCCTGAGCCCATATATCAGATGTCA
CAGTGCCTGCAGGGATAGAAAGAGATCAGATGAGTCAGTAAGACTGAGTGTGAACAATAGAGAGTGGTGGGGCCTGGTGAATTGGAGAAT
GTGACCAATCTAAGCCCAAGCTGGTTGTTACTGTGTGGGAATACAGGCCCACGTGGCAACAATCAGCTTTCCAGAGCGTCTGATTCTTTT
TCAAAAGCAACTGGAAATCTCACTTTTTAAAATGCAAGATGTTCCACTACTCAAATAGTAATGTTTAATTTTAAATGATTTGTTAAAATG

>In-frame_GLYR1_ENST00000591451_chr16_4872875_-_DCTN5_ENST00000300087_chr16_23654274_+_3912nt
ATGGCGGCTGTGAGTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAAGATTGTTAATCCACCA
AAGGACTTGAAGAAACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGATCAAAGTGGAACAGCTG
AAGCCATATCATGCTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGCTGTCGAAGAGTTCCTC
AGGAGAGCCAAAGGGAAAGACCAGACGTCATCCCACAATTCTTCTGATGACAAGAATCGACGTAATTCCAGTGAGGAGAGAAGTAGGCCA
AACTCAGGTGATGAGAAGCGCAAACTTAGCCTGTCTGAAGGGAAGGTGAAGAAGAACATGGGAGAAGGAAAGAAGAGGGTGTCTTCAGGC
TCTTCAGAGAGAGGCTCCAAATCCCCTCTGAAAAGAGCCCAAGAGCAAAGTCCCCGGAAGCGGGGTCGGCCCCCAAAGGATGAGAAGGAT
CTCACCATCCCGGAGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGATGGCCGCGTTTAAATGGCAGCCAACCGCAAGCGAGCCTGTT
AAAGATGCAGATCCTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGAAGGCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGT
GGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGTATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGT
CATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTCAGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGAC
CATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCCTATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGA
TGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCAGAAACTGTGGTTCCACCATTCACTGTCTTCTCAGGCTGC
CCAGGACTCTTCTCAGGGGAGCTCCCGGAGTGCACTCAGGAGCTGATGATTGACGTCACCAAGAGCTACTACCAGAAGTTTTTGCCCCTG
ACGCAAGTCTAGCATCTCTGCCTCATGTCTTGAATCTGCTTGAGCTCTAAGATGAACCTGGGGACAAAGTGAGCCAGTCAGCACCTACAA
AGAGCTTTTGTGTCTTTGACATCTACCACCCTCCTCCTTTTAAAAAATTTCTTTAGAATTTCTCAATCTTCAAGGCTCTAAGTGCTTAAG
AATTCACTAACAGACAGACCATCTGGAGGAGCTGTCTTCAAATGCTGTGCTTACACCTTATCTATGAACAGTCACTTTGTACCATTATCT
GTGGAACACAGAATCATCTGTTCCCAACACTCCAGCCCCTTGGTCCTGTGGATGGCTGGATCCCGCCTGAAACGGACCTGCAGAGCAGCA
GCACCCTTCCGGTGTGGAGGCTATGTAGCTGGTGCGCTGCTCACGGCCATTCACTGCCCATGCTGAGCGCCTCTCACACAGGTAATGCCC
AGCTTTTCTGCTGCTAACACATTTGGCCAGTTGTTGCAGTTGCTCATCATCTTGGGAAAGGTGTTTGTGACTTTTCAGAGCCCAGATTCC
TGTTGTCTATTAAAACTTGAAGGGAGGGGTGAATAGTGTTTCTCTCTTCTTCCCAAAATGACCTTAGCTGTCCTAGGATAGTTAGTAAAA
GACTTTTTAGCATTTTGACCTAGGGCCTTTGGCTTTCACTAAAAGTGGGGACCTCAGTATCCCAGATTGTAATTTTGCCAAGTGTTAGAT
TTGAGTCTCTCATGTGGATGCATTAGTCAGGTGGTTACTCCTTGCTTCAAGGTACTTACCTTATTTCATTGAAGACACCGCATTTGTGAA
CTCTTGCTTCCTGGCCTAGAACCATTCAGCCTACCCTGTATTTGCCATAAACTCCACAATTCACACCAAAATGTCTGTACTTAGAGCTAA
TTCGCATATATACAGGAAGGGCTCTTAGAATCAGTTTGTGGGCACAGAGCCTCAGGAGTAAATGAAGTTACTAGGGCTGTTCTTACCATC
TCCTTCTGGCCAAATAGCACAACATTTCCTCGTTCTGCTCTGACCTCTTAGCTTAGAAGGAAGATTCAGAAGTGAGGGGCTAAGAAGGTT
GTCCTTGCCTAATGCTCTGATCTGTAAGTGAATAGGGCAGAACAGTTCAGCCTTGAGGTTAGAATTTAGCAGGAGCTATCCTGACTTAAT
ATCCAGTTGTGGGGTTTGCAAAACAAAACAGCTGTATGTAATCATTGCCACTAGTTCCATCTAGAACTCCTTTCTAGTTTGTTATTTTTA
AAATGTTTATACATAAAACCACCAAAATACATAGCTTCGACAAGATGGAAGTTTATTTCTCTCTCCCATAACAGTGCAGTGATAGTCAGC
TGGTCCAGGCCAGGCAAGGGGCTGGTCCATGATGTCATCAGGCACCCAGGTTCCTACTGTCTTGCCATGTGGCCACAGTTAGCAACAAAG
GAGGCTGTAAATTTAGTTTCTACTTGGGCAGCCAAAACTCTGAGGAAGGAGATTCTGCTAGTAAAAAGGAGTGGGGGAAGAATGGCCATT
GGGAGACAACAAGCAGACTCAACCAGGCCTCTTTGTTGGCTTCCTTTCCTCCTGCTGCACATGAGCCTTCGCCGTGCATTTGGAGCCATG
ACAGCTGATAGCTCCAGACCTGCATCCTCCTAGCTTGGGGGCTCTGAATGAAAGGTTTCTTCCCTTCCAGTTCGAATTTGGAAACTCCCA
AAGTTCTCAATGGTTTGTTGTGAGTTCCATGTCCTCTTGGATCAGTCACTGTGGCCATGCATGTTTGGCCACATGATTAATCCAGTCTGG
GTCATGACCTTTTCTTCATCCAAAACAAGGTGATGGGAAGACAAAAACAATAGCTACTACAAACAATAGGAGTTTATAATTATGTGCTGA
TGTATTCGAAGATGTGTTGACAGTCGTGAGTGTGTATCCTAGGAAAGGCGAGCTGGACTCTGTCTCCATGGTGGCTCTCACCCCAGGGAC
CTAGGAACAGCCTGTCACCACACAATTACTTTTATAACCCTGGAGATGAAAATCTCCTTGTCCTCAAAATACTTCCAGAAGAACAACCAG
ATGGGAAGGACCTTGGTTGGGACTCTTTCCAGTTCACTTGGGGCAGAGGGAATTTAATGGCTCACGTAGCTGAAAAGGATGGGCTAGATT
GGGCTTCAGGCTGCATCCCAGGACTCCAAACAGGGATCTGTCTCTTTGGCTCTCAGCTCTGCTTTCATTTGAGTTGGCTTTATTCTTGGG
CTTCACAGTGTGGCCCCACAGCACCAGTTATTGATAAAAAGAGCTCCCCTTTGCTGACAGAACTGCTGGATTTGGTTCTCATTGGTCCAG
ACGAGGAAGGTATCCAGCCTCAAGTCATCATTGTGGCCAGGAAGATGGAATACACCAAATGGACAGGCCTGGCATGTACCCACAGAGACT
GAGAGTTGGTGCTGGTGGTTGTGGTGGCAGATGATATTACCTGAAGAAGGGACGAATGGGTGCTGGGCAGGACAAAGCATCAGCTGTCCA
GTTCAGGCCTCTCCTCTTTCCCTGGTGTCTTCATTTTCCTCCGTCTCCCTGCTGTCCCTTACCCTCTGCCCAATCTCTCATTACTCCTGG
TCTTGGGAGTTGCCTTCTGAGGATACTCCACTGGGGGTACCTGAGCCTGGATTAGAGGGCAGGGGGAGGATATTGCCTAGCCAAAGTGGG

>In-frame_GLYR1_ENST00000591451_chr16_4872875_-_DCTN5_ENST00000563998_chr16_23654274_+_1439nt
ATGGCGGCTGTGAGTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAAGATTGTTAATCCACCA
AAGGACTTGAAGAAACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGATCAAAGTGGAACAGCTG
AAGCCATATCATGCTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGCTGTCGAAGAGTTCCTC
AGGAGAGCCAAAGGGAAAGACCAGACGTCATCCCACAATTCTTCTGATGACAAGAATCGACGTAATTCCAGTGAGGAGAGAAGTAGGCCA
AACTCAGGTGATGAGAAGCGCAAACTTAGCCTGTCTGAAGGGAAGGTGAAGAAGAACATGGGAGAAGGAAAGAAGAGGGTGTCTTCAGGC
TCTTCAGAGAGAGGCTCCAAATCCCCTCTGAAAAGAGCCCAAGAGCAAAGTCCCCGGAAGCGGGGTCGGCCCCCAAAGGATGAGAAGGAT
CTCACCATCCCGGAGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGATGGCCGCGTTTAAATGGCAGCCAACCGCAAGCGAGCCTGTT
AAAGATGCAGATCCTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGAAGGCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGT
GGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGTATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGT
CATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTCAGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGAC
CATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCCTATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGA
TGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCAGAAACTGTGGTTCCACCATTCACTGTCTTCTCAGGCTGC
CCAGCTCCTTAGAGCTGGGTCTTTCTTTCCCCAGGACTCTTCTCAGGGGAGCTCCCGGAGTGCACTCAGGAGCTGATGATTGACGTCACC
AAGAGCTACTACCAGAAGTTTTTGCCCCTGACGCAAGTCTAGCATCTCTGCCTCATGTCTTGAATCTGCTTGAGCTCTAAGATGAACCTG
GGGACAAAGTGAGCCAGTCAGCACCTACAAAGAGCTTTTGTGTCTTTGACATCTACCACCCTCCTCCTTTTAAAAAATTTCTTTAGAATT

>In-frame_GLYR1_ENST00000591451_chr16_4872875_-_DCTN5_ENST00000568589_chr16_23654274_+_1373nt
ATGGCGGCTGTGAGTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAAGATTGTTAATCCACCA
AAGGACTTGAAGAAACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGATCAAAGTGGAACAGCTG
AAGCCATATCATGCTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGCTGTCGAAGAGTTCCTC
AGGAGAGCCAAAGGGAAAGACCAGACGTCATCCCACAATTCTTCTGATGACAAGAATCGACGTAATTCCAGTGAGGAGAGAAGTAGGCCA
AACTCAGGTGATGAGAAGCGCAAACTTAGCCTGTCTGAAGGGAAGGTGAAGAAGAACATGGGAGAAGGAAAGAAGAGGGTGTCTTCAGGC
TCTTCAGAGAGAGGCTCCAAATCCCCTCTGAAAAGAGCCCAAGAGCAAAGTCCCCGGAAGCGGGGTCGGCCCCCAAAGGATGAGAAGGAT
CTCACCATCCCGGAGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGATGGCCGCGTTTAAATGGCAGCCAACCGCAAGCGAGCCTGTT
AAAGATGCAGATCCTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGAAGGCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGT
GGAAGCCAGAACATCGTTCTCAATGGCAAGACCATTGTGATGAATGACTGTATTATCCGAGGGGATCTGGCAAATGTAAGAGTTGGACGT
CATTGTGTTGTGAAAAGTCGTAGTGTCATAAGGCCACCATTCAAGAAGTTCAGCAAAGGTGTTGCATTCTTTCCTTTACATATTGGAGAC
CATGTCTTTATTGAGGAAGATTGTGTGGTCAACGCAGCACAGATTGGTTCCTATGTTCATGTTGGGAAGAACTGTGTGATTGGGCGCCGA
TGTGTGTTGAAAGACTGCTGCAAAATTCTTGACAACACAGTATTACCTCCAGAAACTGTGGTTCCACCATTCACTGTCTTCTCAGGCTGC
CCAGGTAACCTTGGCTGTTGATTAATTTTATTTTAACTTCCTAAAACTCAGTTGTATTTTCCATCGCAAAAGTAATGCTTACGATTCCTA
TCTCTGGCAATATGTTGATAGAGCTAACTTAGAAATTCACCTGTACAAAGTACCTAGAAATGCTACCTAACATATAACAAGCATCTGTTT
AAATGCATAATTGGGTTCACCAGAAAATAAGGAAATTATGAAGGGCCAAACACAAAGAGGAAACTAAGCCCAAGCTGTGAGATTGCACGG

>In-frame_GLYR1_ENST00000591451_chr16_4872875_-_DCTN5_ENST00000568272_chr16_23654274_+_1142nt
ATGGCGGCTGTGAGTCTGCGGCTCGGCGACTTGGTGTGGGGGAAACTCGGCCGATATCCTCCTTGGCCAGGAAAGATTGTTAATCCACCA
AAGGACTTGAAGAAACCTCGCGGAAAGAAATGCTTCTTTGTGAAATTTTTTGGAACAGAAGATCATGCCTGGATCAAAGTGGAACAGCTG
AAGCCATATCATGCTCATAAAGAGGAAATGATAAAAATTAACAAGGGTAAACGATTCCAGCAAGCGGTAGATGCTGTCGAAGAGTTCCTC
AGGAGAGCCAAAGGGAAAGACCAGACGTCATCCCACAATTCTTCTGATGACAAGAATCGACGTAATTCCAGTGAGGAGAGAAGTAGGCCA
AACTCAGGTGATGAGAAGCGCAAACTTAGCCTGTCTGAAGGGAAGGTGAAGAAGAACATGGGAGAAGGAAAGAAGAGGGTGTCTTCAGGC
TCTTCAGAGAGAGGCTCCAAATCCCCTCTGAAAAGAGCCCAAGAGCAAAGTCCCCGGAAGCGGGGTCGGCCCCCAAAGGATGAGAAGGAT
CTCACCATCCCGGAGTCTAGTACCGTGAAGGGGATGATGGCCGGACCGATGGCCGCGTTTAAATGGCAGCCAACCGCAAGCGAGCCTGTT
AAAGATGCAGATCCTCATTTCCATCATTTCCTGCTAAGCCAAACAGAGAAGGCATCTGGGAACAAAGTCAGTCGCCAGTCAGTGTTGTGT
GGAAGCCAGAACATCGTTCTCAATGGCAAGAACTTTGTCATTTCTGTTTTCCTGAGCCCATATATCAGATGTCACAGTGCCTGCAGGGAT
AGAAAGAGATCAGATGAGTCAGTAAGACTGAGTGTGAACAATAGAGAGTGGTGGGGCCTGGTGAATTGGAGAATGTGACCAATCTAAGCC
CAAGCTGGTTGTTACTGTGTGGGAATACAGGCCCACGTGGCAACAATCAGCTTTCCAGAGCGTCTGATTCTTTTTCAAAAGCAACTGGAA
ATCTCACTTTTTAAAATGCAAGATGTTCCACTACTCAAATAGTAATGTTTAATTTTAAATGATTTGTTAAAATGCCACGTGTCCTTCCTG


Top

FusionGenePPI for GLYR1_DCTN5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GLYR1ELAVL1, SIRT7, DHX9, ESR1, GEMIN4, KDM1A, WHSC1L1, CCNC, FHL2, EIF1AD, C6orf165, HIST3H3, SUZ12, EED, RNF2, RPL8, NPM1, MAGEA1, PRR11, ILF2, NEFH, BLK, HAL, KDM1B, LCP1, SERPINA12, CAPNS2, FNTB, ALOXE3, DDX18, FBL, NOP56, NOP58, RCC1, RFC1, TOP2A, TOP2B, NOC2L, IFI16, MED4, HIST1H3E, HNRNPU, FOXL2, CDC14B, WDR46, ZNF2, RPL37A, GLTSCR2, RPL28, CNBP, DGCR8, HIST1H1E, RPL30, ZC3HAV1, RRP8, STAU1, ZCRB1, H2AFY2, PRDM5, PPAN, RPL18A, FGF8, GPATCH4, PDGFB, CDX1, ECM1, PLEKHO1, RRS1, RSBN1, RBM4, RBM34, KNOP1, HIST1H3ADCTN5NINL, RBPMS, FATE1, CSPP1, CAPZA2, DCTN2, ACTR1B, ACTR1A, DCTN4, DCTN6, DCTN1, DBN1, DYNC1H1, PMEPA1, PDGFD, KLHL2, DEFB127, C1orf106, RIC8A, UQCRH, MIS18A, CCDC120


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneGLYR1chr16:4872875chr16:23654274ENST00000321919-716214_217227554histone H3
HgeneGLYR1chr16:4872875chr16:23654274ENST00000381983-715214_217227537histone H3
HgeneGLYR1chr16:4872875chr16:23654274ENST00000591451-716214_217227548histone H3
HgeneGLYR1chr16:4872875chr16:23654274ENST00000321919-716216_225227554KDM1B
HgeneGLYR1chr16:4872875chr16:23654274ENST00000381983-715216_225227537KDM1B
HgeneGLYR1chr16:4872875chr16:23654274ENST00000591451-716216_225227548KDM1B


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneGLYR1chr16:4872875chr16:23654274ENST00000436648-615214_217146473histone H3
HgeneGLYR1chr16:4872875chr16:23654274ENST00000436648-615216_225146473KDM1B


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GLYR1_DCTN5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GLYR1_DCTN5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneDCTN5C0005586Bipolar Disorder1PSYGENET