FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1477

FusionGeneSummary for ALDH2_LRBA

check button Fusion gene summary
Fusion gene informationFusion gene name: ALDH2_LRBA
Fusion gene ID: 1477
HgeneTgene
Gene symbol

ALDH2

LRBA

Gene ID

217

987

Gene namealdehyde dehydrogenase 2 family memberLPS responsive beige-like anchor protein
SynonymsALDH-E2|ALDHI|ALDMBGL|CDC4L|CVID8|LAB300|LBA
Cytomap

12q24.12

4q31.3

Type of geneprotein-codingprotein-coding
Descriptionaldehyde dehydrogenase, mitochondrialALDH class 2acetaldehyde dehydrogenase 2aldehyde dehydrogenase 2 family (mitochondrial)liver mitochondrial ALDHnucleus-encoded mitochondrial aldehyde dehydrogenase 2lipopolysaccharide-responsive and beige-like anchor proteinCDC4-like proteinLPS-responsive vesicle trafficking, beach and anchor containingvesicle trafficking, beach and anchor containing
Modification date2018052720180519
UniProtAcc

P05091

P50851

Ensembl transtripts involved in fusion geneENST00000416293, ENST00000261733, 
ENST00000535741, ENST00000510413, 
ENST00000503716, ENST00000357115, 
ENST00000507224, 
Fusion gene scores* DoF score7 X 6 X 5=21015 X 15 X 7=1575
# samples 718
** MAII scorelog2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(18/1575*10)=-3.12928301694497
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ALDH2 [Title/Abstract] AND LRBA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-85-A50Z-01AALDH2chr12

112237867

+LRBAchr4

151793907

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000416293ENST00000535741ALDH2chr12

112237867

+LRBAchr4

151793907

-
In-frameENST00000416293ENST00000510413ALDH2chr12

112237867

+LRBAchr4

151793907

-
5CDS-intronENST00000416293ENST00000503716ALDH2chr12

112237867

+LRBAchr4

151793907

-
5CDS-intronENST00000416293ENST00000357115ALDH2chr12

112237867

+LRBAchr4

151793907

-
5CDS-intronENST00000416293ENST00000507224ALDH2chr12

112237867

+LRBAchr4

151793907

-
In-frameENST00000261733ENST00000535741ALDH2chr12

112237867

+LRBAchr4

151793907

-
In-frameENST00000261733ENST00000510413ALDH2chr12

112237867

+LRBAchr4

151793907

-
5CDS-intronENST00000261733ENST00000503716ALDH2chr12

112237867

+LRBAchr4

151793907

-
5CDS-intronENST00000261733ENST00000357115ALDH2chr12

112237867

+LRBAchr4

151793907

-
5CDS-intronENST00000261733ENST00000507224ALDH2chr12

112237867

+LRBAchr4

151793907

-

Top

FusionProtFeatures for ALDH2_LRBA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ALDH2

P05091

LRBA

P50851

May be involved in coupling signal transduction andvesicle trafficking to enable polarized secretion and/or membranedeposition of immune effector molecules. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneALDH2chr12:112237867chr4:151793907ENST00000261733+1113262_267468518Nucleotide bindingNAD
HgeneALDH2chr12:112237867chr4:151793907ENST00000416293+1012262_267421471Nucleotide bindingNAD
TgeneLRBAchr12:112237867chr4:151793907ENST00000357115-16581006_10537212864Coiled coilOntology_term=ECO:0000255
TgeneLRBAchr12:112237867chr4:151793907ENST00000510413-16571006_10537212852Coiled coilOntology_term=ECO:0000255
TgeneLRBAchr12:112237867chr4:151793907ENST00000357115-16581990_19947212864Compositional biasNote=Poly-Arg
TgeneLRBAchr12:112237867chr4:151793907ENST00000510413-16571990_19947212852Compositional biasNote=Poly-Arg
TgeneLRBAchr12:112237867chr4:151793907ENST00000357115-16582073_21817212864DomainBEACH-type PH
TgeneLRBAchr12:112237867chr4:151793907ENST00000357115-16582200_24897212864DomainBEACH
TgeneLRBAchr12:112237867chr4:151793907ENST00000510413-16572073_21817212852DomainBEACH-type PH
TgeneLRBAchr12:112237867chr4:151793907ENST00000510413-16572200_24897212852DomainBEACH
TgeneLRBAchr12:112237867chr4:151793907ENST00000357115-16581301_13437212864RepeatNote=WD 1
TgeneLRBAchr12:112237867chr4:151793907ENST00000357115-16582591_26337212864RepeatNote=WD 2
TgeneLRBAchr12:112237867chr4:151793907ENST00000357115-16582636_26797212864RepeatNote=WD 3
TgeneLRBAchr12:112237867chr4:151793907ENST00000357115-16582695_27357212864RepeatNote=WD 4
TgeneLRBAchr12:112237867chr4:151793907ENST00000357115-16582777_28167212864RepeatNote=WD 5
TgeneLRBAchr12:112237867chr4:151793907ENST00000357115-16582819_28587212864RepeatNote=WD 6
TgeneLRBAchr12:112237867chr4:151793907ENST00000510413-16571301_13437212852RepeatNote=WD 1
TgeneLRBAchr12:112237867chr4:151793907ENST00000510413-16572591_26337212852RepeatNote=WD 2
TgeneLRBAchr12:112237867chr4:151793907ENST00000510413-16572636_26797212852RepeatNote=WD 3
TgeneLRBAchr12:112237867chr4:151793907ENST00000510413-16572695_27357212852RepeatNote=WD 4
TgeneLRBAchr12:112237867chr4:151793907ENST00000510413-16572777_28167212852RepeatNote=WD 5
TgeneLRBAchr12:112237867chr4:151793907ENST00000510413-16572819_28587212852RepeatNote=WD 6
TgeneLRBAchr12:112237867chr4:151793907ENST00000357115-16581531_15487212864TransmembraneHelical
TgeneLRBAchr12:112237867chr4:151793907ENST00000510413-16571531_15487212852TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ALDH2_LRBA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ALDH2_ENST00000416293_chr12_112237867_+_LRBA_ENST00000535741_chr4_151793907_-_2553aa
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKALETLDNGKPTVISYLV
DLDMVLKCLRTTAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALTVANLIKE
AGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQ
CCCAGSRTFVQEDITDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVCVIYKLLASKSEGIRVQALKAMGTFLKHL
APKRKAEVMLGHGLFSLLAERLMLQTNLITMTTTNVLFEILIEQIGTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSPQCPESMEVRR
AFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCTFNPKNSDEQKITEMVYAIFRILLYHAVKTEWGGWRVWVDTLSITHSKVTFEIHKE
NLANIFREQQGKVDEEIGLCSSTSVQAASGIRRDINVSVGSQQPDTKDSPVCPHFTTNGNENSSIEKTSSLESASNIELQTTNTSTEEMK
AEQENQELPDEGTLEETLTNETRNADDLEVSSDIIEAVAISSNSFITTGKDSMTVSEVTASISSPSEEDASEMPEFLDKSIVEEEEDDDT
VELKVEGSPTEEANLPTELQDNSLSPAASEAGEKLDMFGNDDKLIFQEGKPVTEKQTDTETQDSKDSGIQTMTASGSSAMSPETTVSQIA
VESDLGQMLEEGKKATNLTRETKLINDCHGSVSEASSEQKIAKLDVSNVATDTERLELKASPNVEAPQPHRHVLEISRQHEQPGQGIAPD
AVNGQRRDSRSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLS
AATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKTRGDK
ALKPMHSLIPLGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQNERHS
QSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNK
SPETKNDRGNDLDTKATPSVSVSKNVNVKDILRSLVNIPADGVTVDPALLPPACLGALGDLSVEQPVQFRSFDRSVIVAAKKSAVSPSTF
NTSIPTNAVSVVSSVDSAQASDMGGESPGSRSSNAKLPSVPTVDSVSQDPVSNMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSH
GQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESL
CAQTSADKREDEKMCDHLIRAAKTRDHVTATQLIQKIINILTDKHGAWGNSAVSRPLEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLK
TAVEHATDEDILAKGKQSIRSQALGNQNSENEILLEGDDDTLSSVDEKDLENLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELTFEVDEE
DPNFKKIDPKILATTEGLHGKWLFTEIRSIFSRRTLLQNTALEIFMANRVAVMFNFPDPATVKKVVNTLPRVGVGTSFGLPQTRRISLAS
PRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSTNDLNQTPVFPWVITNTESEELDLTLPTNFRDLSKPIGALNPKRAAFFAERTESW
EDDQVPKFHTGTHYSTASFVLAWLLRIEPFTTTFLNLQGGKFDHADRTFSSISRAWRNSQRDTSDIKELIPEFTTLPEMFVNFNNTNLGV
MDDGTVVSDVELPPWAKTSEEFVHINRLALESEFVSCQLHQWIDLIFGTKQQGPEAVRALNVFTYLTTEGAVNLNSITDPVLREAVEAQI
RSFGQTPSQLLIEPHPPRGSAMQVSPLMFTDKAQQDVIMVLKFPSNSPVTHVAANTQPGLATPAVITVTANRLFAVNKWHNLPAHQGAVQ
DQPYQLPVEIDPLIASNTGMHRRQITDLLDQSIQVHSQCFVITSDNRTILVCGFWDKSFRVTSTDTGRLIQVVFGHWDVVTCLARSESTI
GGNCYILSGSRDATLLLWTWNGKCSGIGDNPGSETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCL
KPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSDLKQLFATPGCDAGIRAMALSY

>In-frame_ALDH2_ENST00000416293_chr12_112237867_+_LRBA_ENST00000510413_chr4_151793907_-_2552aa
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKALETLDNGKPTVISYLV
DLDMVLKCLRTTAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALTVANLIKE
AGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQ
CCCAGSRTFVQEDITDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVCVIYKLLASKSEGIRVQALKAMGTFLKHL
APKRKAEVMLGHGLFSLLAERLMLQTNLITMTTTNVLFEILIEQIGTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSPQCPESMEVRR
AFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCTFNPKNSDEQKITEMVYAIFRILLYHAVKTEWGGWRVWVDTLSITHSKVTFEIHKE
NLANIFREQQGKVDEEIGLCSSTSVQAASGIRRDINVSVGSQQPDTKDSPVCPHFTTNGNENSSIEKTSSLESASNIELQTTNTSTEEMK
AEQENQELPDEGTLEETLTNETRNADDLEVSSDIIEAVAISSNSFITTGKDSMTVSEVTASISSPSEEDASEMPEFLDKSIVEEEEDDDT
VELKVEGSPTEEANLPTELQDNSLSPAASEAGEKLDMFGNDDKLIFQEGKPVTEKQTDTETQDSKDSGIQTMTASGSSAMSPETTVSQIA
VESDLGQMLEEGKKATNLTRETKLINDCHGSVSEASSEQKIAKLDVSNVATDTERLELKASPNVEAPQPHRHVLEISRQHEQPGQGIAPD
AVNGQRRDSRSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLS
AATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKTRGDK
ALKPMHSLIPLGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQNERHS
QSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNK
SPETKNDRGNDLDTKATPSVSVSKNVNVKDILRSLVNIPADGVTVDPALLPPACLGALGDLSVEQPVQFRSFDRSVIVAAKKSAVSPSTF
NTSIPTNAVSVVSSVDSAQASDMGGESPGSRSSNAKLPSVPTVDSVSQDPVSNMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSH
GQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESL
CAQTSADKREDEKMCDHLIRAAKTRDHVTATQLIQKIINILTDKHGAWGNSAVSRPLEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLK
TAVEHATDEDILAKGKQSIRSQALGNQNSENEILLEGDDDTLSSVDEKDLENLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELTFEVDEE
DPNFKKIDPKILATTEGLHGKWLFTEIRSIFSRRTLLQNTALEIFMANRVAVMFNFPDPATVKKVVNTLPRVGVGTSFGLPQTRRISLAS
PRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSTNDLNQTPVFPWVITNTESEELDLTLPTNFRDLSKPIGALNPKRAAFFAERTESW
EDDQVPKFHTGTHYSTASFVLAWLLRIEPFTTTFLNLQGGKFDHADRTFSSISRAWRNSQRDTSDIKELIPEFTTLPEMFVNFNNTNLGV
MDDGTVVSDVELPPWAKTSEEFVHINRLALESEFVSCQLHQWIDLIFGTKQQGPEAVRALNVFTYLTTEGAVNLNSITDPVLREAVEAQI
RSFGQTPSQLLIEPHPPRGSAMQVSPLMFTDKAQQDVIMVLKFPSNSPVTHVAANTQPGLATPAVITVTANRLFAVNKWHNLPAHQGAVQ
DQPYQLPVEIDPLIASNTGMHRRQITDLLDQSIQVHSQCFVITSDNRTILVCGFWDKSFRVTSTDTGRLIQVVFGHWDVVTCLARSESTI
GGNCYILSGSRDATLLLWTWNGKCSGIGDNPGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLK
PKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSDLKQLFATPGCDAGIRAMALSYD

>In-frame_ALDH2_ENST00000261733_chr12_112237867_+_LRBA_ENST00000535741_chr4_151793907_-_2600aa
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLG
SPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPTVISYLVDLDMVLKCLRTTAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALTVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVI
QVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDITDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFT
KDLDKANYLSQALQAGTVCVIYKLLASKSEGIRVQALKAMGTFLKHLAPKRKAEVMLGHGLFSLLAERLMLQTNLITMTTTNVLFEILIE
QIGTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCTFNPKNSDE
QKITEMVYAIFRILLYHAVKTEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREQQGKVDEEIGLCSSTSVQAASGIRRDINVSVGSQQ
PDTKDSPVCPHFTTNGNENSSIEKTSSLESASNIELQTTNTSTEEMKAEQENQELPDEGTLEETLTNETRNADDLEVSSDIIEAVAISSN
SFITTGKDSMTVSEVTASISSPSEEDASEMPEFLDKSIVEEEEDDDTVELKVEGSPTEEANLPTELQDNSLSPAASEAGEKLDMFGNDDK
LIFQEGKPVTEKQTDTETQDSKDSGIQTMTASGSSAMSPETTVSQIAVESDLGQMLEEGKKATNLTRETKLINDCHGSVSEASSEQKIAK
LDVSNVATDTERLELKASPNVEAPQPHRHVLEISRQHEQPGQGIAPDAVNGQRRDSRSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMW
RSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSL
GFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKTRGDKALKPMHSLIPLGKSAAKSPVDIVTGGISPVRDLDRLLQDMDIN
RLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRR
DSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSVSKNVNVKDILRSLVNIPADGV
TVDPALLPPACLGALGDLSVEQPVQFRSFDRSVIVAAKKSAVSPSTFNTSIPTNAVSVVSSVDSAQASDMGGESPGSRSSNAKLPSVPTV
DSVSQDPVSNMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLA
FIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQTSADKREDEKMCDHLIRAAKTRDHVTATQLIQKIINILTD
KHGAWGNSAVSRPLEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTAVEHATDEDILAKGKQSIRSQALGNQNSENEILLEGDDDTLS
SVDEKDLENLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELTFEVDEEDPNFKKIDPKILATTEGLHGKWLFTEIRSIFSRRTLLQNTALE
IFMANRVAVMFNFPDPATVKKVVNTLPRVGVGTSFGLPQTRRISLASPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSTNDLNQTP
VFPWVITNTESEELDLTLPTNFRDLSKPIGALNPKRAAFFAERTESWEDDQVPKFHTGTHYSTASFVLAWLLRIEPFTTTFLNLQGGKFD
HADRTFSSISRAWRNSQRDTSDIKELIPEFTTLPEMFVNFNNTNLGVMDDGTVVSDVELPPWAKTSEEFVHINRLALESEFVSCQLHQWI
DLIFGTKQQGPEAVRALNVFTYLTTEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQVSPLMFTDKAQQDVIMVLKF
PSNSPVTHVAANTQPGLATPAVITVTANRLFAVNKWHNLPAHQGAVQDQPYQLPVEIDPLIASNTGMHRRQITDLLDQSIQVHSQCFVIT
SDNRTILVCGFWDKSFRVTSTDTGRLIQVVFGHWDVVTCLARSESTIGGNCYILSGSRDATLLLWTWNGKCSGIGDNPGSETAAPRAILT
GHDTEVTCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRA

>In-frame_ALDH2_ENST00000261733_chr12_112237867_+_LRBA_ENST00000510413_chr4_151793907_-_2599aa
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLG
SPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPTVISYLVDLDMVLKCLRTTAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALTVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVI
QVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDITDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFT
KDLDKANYLSQALQAGTVCVIYKLLASKSEGIRVQALKAMGTFLKHLAPKRKAEVMLGHGLFSLLAERLMLQTNLITMTTTNVLFEILIE
QIGTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCTFNPKNSDE
QKITEMVYAIFRILLYHAVKTEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREQQGKVDEEIGLCSSTSVQAASGIRRDINVSVGSQQ
PDTKDSPVCPHFTTNGNENSSIEKTSSLESASNIELQTTNTSTEEMKAEQENQELPDEGTLEETLTNETRNADDLEVSSDIIEAVAISSN
SFITTGKDSMTVSEVTASISSPSEEDASEMPEFLDKSIVEEEEDDDTVELKVEGSPTEEANLPTELQDNSLSPAASEAGEKLDMFGNDDK
LIFQEGKPVTEKQTDTETQDSKDSGIQTMTASGSSAMSPETTVSQIAVESDLGQMLEEGKKATNLTRETKLINDCHGSVSEASSEQKIAK
LDVSNVATDTERLELKASPNVEAPQPHRHVLEISRQHEQPGQGIAPDAVNGQRRDSRSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMW
RSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSL
GFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKTRGDKALKPMHSLIPLGKSAAKSPVDIVTGGISPVRDLDRLLQDMDIN
RLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRR
DSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSVSKNVNVKDILRSLVNIPADGV
TVDPALLPPACLGALGDLSVEQPVQFRSFDRSVIVAAKKSAVSPSTFNTSIPTNAVSVVSSVDSAQASDMGGESPGSRSSNAKLPSVPTV
DSVSQDPVSNMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLA
FIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQTSADKREDEKMCDHLIRAAKTRDHVTATQLIQKIINILTD
KHGAWGNSAVSRPLEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTAVEHATDEDILAKGKQSIRSQALGNQNSENEILLEGDDDTLS
SVDEKDLENLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELTFEVDEEDPNFKKIDPKILATTEGLHGKWLFTEIRSIFSRRTLLQNTALE
IFMANRVAVMFNFPDPATVKKVVNTLPRVGVGTSFGLPQTRRISLASPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSTNDLNQTP
VFPWVITNTESEELDLTLPTNFRDLSKPIGALNPKRAAFFAERTESWEDDQVPKFHTGTHYSTASFVLAWLLRIEPFTTTFLNLQGGKFD
HADRTFSSISRAWRNSQRDTSDIKELIPEFTTLPEMFVNFNNTNLGVMDDGTVVSDVELPPWAKTSEEFVHINRLALESEFVSCQLHQWI
DLIFGTKQQGPEAVRALNVFTYLTTEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQVSPLMFTDKAQQDVIMVLKF
PSNSPVTHVAANTQPGLATPAVITVTANRLFAVNKWHNLPAHQGAVQDQPYQLPVEIDPLIASNTGMHRRQITDLLDQSIQVHSQCFVIT
SDNRTILVCGFWDKSFRVTSTDTGRLIQVVFGHWDVVTCLARSESTIGGNCYILSGSRDATLLLWTWNGKCSGIGDNPGETAAPRAILTG
HDTEVTCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ALDH2_ENST00000416293_chr12_112237867_+_LRBA_ENST00000535741_chr4_151793907_-_7659nt
ATGTTGCGCGCTGCCGCCCGCTTCGGGCCCCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCCAACCAG
CAGCCCGAGGTCTTCTGCAACCAGATTTTCATAAACAATGAATGGCACGATGCCGTCAGCAGGAAAACATTCCCCACCGTCAATCCGTCC
ACTGGAGAGGTCATCTGTCAGGTAGCTGAAGGGGACAAGGCCTTGGAGACCCTGGACAATGGCAAGCCCTATGTCATCTCCTACCTGGTG
GATTTGGACATGGTCCTCAAATGTCTCCGGTATTATGCCGGCTGGGCTGATAAGTACCACGGGAAAACCATCCCCATTGACGGAGACTTC
TTCAGCTACACACGCCATGAACCTGTGGGGGTGTGCGGGCAGATCATTCCGTGGAATTTCCCGCTCCTGATGCAAGCATGGAAGCTGGGC
CCAGCCTTGGCAACTGGAAACGTGGTTGTGATGAAGGTAGCTGAGCAGACACCCCTCACCGCCCTCTATGTGGCCAACCTGATCAAGGAG
GCTGGCTTTCCCCCTGGTGTGGTCAACATTGTGCCTGGATTTGGCCCCACGGCTGGGGCCGCCATTGCCTCCCATGAGGATGTGGACAAA
GTGGCATTCACAGGCTCCACTGAGATTGGCCGCGTAATCCAGGTTGCTGCTGGGAGCAGCAACCTCAAGAGAGTGACCTTGGAGCTGGGG
GGGAAGAGCCCCAACATCATCATGTCAGATGCCGATATGGATTGGGCCGTGGAACAGGCCCACTTCGCCCTGTTCTTCAACCAGGGCCAG
TGCTGCTGTGCCGGCTCCCGGACCTTCGTGCAGGAGGACATCTATGATGAGTTTGTGGAGCGGAGCGTTGCCCGGGCCAAGTCTCGGGTG
GTCGGGAACCCCTTTGATAGCAAGACCGAGCAGGGGCCGCAGGTGGATGAAACTCAGTTTAAGAAGATCCTCGGCTACATCAACACGGGG
AAGCAAGAGGGGGCGAAGCTGCTGTGTGGTGGGGGCATTGCTGCTGACCGTGGTTACTTCATCCAGCCCACTGTGTTTGGAGATGTGCAG
GATGGCATGACCATCGCCAAGGAGGAGATCTTCGGGCCAGTGATGCAGATCCTGAAGTTCAAGACCATAGAGGAGGTTGTTGGGAGAGCC
AACAATTCCACGTACGGGCTGGCCGCAGCTGTCTTCACAAAGGATTTGGACAAGGCCAATTACCTGTCCCAGGCCCTCCAGGCGGGCACT
GTGTGTGTTATCTACAAACTTCTGGCATCGAAAAGTGAAGGAATCAGGGTACAAGCTCTTAAGGCAATGGGTTATTTTTTAAAACATCTG
GCCCCAAAGAGGAAAGCAGAAGTCATGCTTGGACATGGATTGTTTTCATTGCTAGCTGAAAGGCTCATGCTTCAGACAAATTTAATCACA
ATGACCACATATAATGTGCTGTTTGAGATTCTTATAGAACAGATTGGTACTCAGGTGATACATAAACAGCATCCAGATCCTGATTCTTCA
GTGAAGATACAAAACCCTCAGATACTAAAAGTAATTGCGACCCTACTTCGAAATTCTCCCCAGTGCCCAGAGAGCATGGAGGTTCGCAGA
GCCTTTCTTTCTGACATGATTAAACTTTTTAATAACAGTAGAGAAAACAGGAGGAGCTTGCTACAATGCTCTGTGTGGCAAGAATGGATG
CTTTCTCTCTGCTATTTTAATCCTAAGAATTCAGATGAGCAAAAGATAACAGAAATGGTATACGCCATATTCAGAATCCTGCTTTACCAT
GCAGTCAAATATGAGTGGGGTGGCTGGCGTGTATGGGTAGACACTTTATCAATCACTCATTCAAAGGTCACTTTTGAAATACACAAAGAA
AACCTTGCCAATATATTTAGGGAACAGCAAGGAAAAGTTGATGAAGAAATAGGGCTGTGTTCTTCAACTTCAGTTCAAGCAGCCTCTGGC
ATTAGAAGGGATATTAATGTTTCAGTAGGATCCCAGCAACCAGATACGAAGGATTCTCCTGTCTGTCCTCATTTCACCACAAATGGTAAT
GAAAATTCAAGTATAGAGAAGACAAGTTCACTAGAATCTGCATCTAATATTGAACTGCAAACTACTAATACATCTTATGAAGAAATGAAA
GCTGAGCAAGAAAATCAGGAGTTACCAGATGAAGGCACTTTGGAAGAAACACTGACAAATGAGACAAGGAATGCAGATGATTTAGAAGTA
TCTTCTGACATAATAGAAGCTGTGGCTATTTCCTCTAATTCTTTTATAACAACTGGCAAAGATTCAATGACTGTCAGTGAAGTAACTGCT
TCTATAAGTTCTCCTTCAGAAGAGGATGCCTCAGAGATGCCAGAATTCTTGGATAAATCTATAGTAGAGGAAGAGGAAGATGATGATTAT
GTGGAACTGAAAGTAGAAGGCAGTCCTACTGAGGAAGCTAATCTACCCACAGAGCTCCAAGATAACAGTTTGTCTCCAGCTGCATCTGAA
GCCGGTGAAAAACTGGACATGTTTGGTAATGATGACAAATTAATATTTCAAGAAGGAAAACCTGTTACTGAAAAGCAAACTGATACTGAA
ACTCAAGATTCTAAAGATTCTGGAATTCAGACTATGACAGCATCAGGGTCTTCAGCTATGTCACCAGAAACTACTGTTTCCCAAATAGCT
GTAGAATCAGACCTTGGTCAGATGCTGGAGGAAGGGAAGAAAGCAACTAACCTCACTAGAGAAACCAAATTAATTAATGATTGTCATGGT
AGTGTCTCTGAGGCTTCTTCTGAGCAAAAGATTGCGAAGTTGGATGTTTCCAATGTTGCTACAGATACTGAGAGGCTGGAGTTGAAGGCC
AGTCCCAACGTGGAAGCACCTCAACCTCATCGACATGTGCTTGAGATATCAAGGCAACATGAGCAGCCAGGGCAAGGAATAGCACCAGAT
GCAGTTAATGGACAAAGGAGGGATTCCAGATCTACTGTGTTTCGTATTCCTGAGTTCAACTGGTCTCAGATGCATCAACGTTTGCTCACT
GATCTATTATTTTCAATAGAAACAGATATACAGATGTGGAGAAGCCATTCAACAAAGACAGTTATGGACTTCGTGAATAGCAGTGATAAT
GTCATCTTTGTACACAACACAATTCATCTCATCTCTCAAGTGATGGACAATATGGTCATGGCTTGTGGGGGTATACTGCCATTGCTTTCA
GCTGCTACATCGGCTACACATGAACTGGAAAATATTGAACCTACTCAAGGCCTTTCAATAGAAGCCTCTGTGACATTTTTGCAGAGGCTA
ATTAGCCTTGTGGATGTGCTTATATTTGCAAGTTCTCTTGGCTTTACTGAAATTGAAGCTGAAAAAAGTATGTCATCTGGAGGAATTTTG
CGGCAGTGTCTCCGACTAGTTTGTGCAGTCGCAGTAAGGAATTGCTTGGAGTGTCAACAGCATTCACAACTGAAAACTAGGGGAGATAAA
GCCTTGAAACCAATGCATAGCCTTATTCCTTTAGGGAAATCTGCAGCGAAGAGCCCAGTGGACATTGTGACTGGCGGTATATCTCCAGTA
AGAGATCTTGACAGGCTTCTACAGGACATGGATATTAATCGGCTTAGGGCAGTTGTTTTCAGAGACATAGAGGATAGCAAACAAGCTCAA
TTTTTAGCCTTGGCAGTAGTATACTTTATCTCTGTTCTTATGGTCTCCAAGTACAGAGACATTTTGGAACCCCAAAATGAAAGGCATAGC
CAGTCATGTACAGAAACTGGCAGTGAAAATGAGAATGTATCACTCTCTGAAATCACACCAGCAGCATTCAGCACTTTAACTACGGCATCA
GTGGAAGAATCTGAAAGCACATCATCTGCTCGAAGGAGGGACTCAGGCATTGGGGAAGAAACAGCCACTGGTTTAGGAAGCCATGTGGAA
GTAACTCCTCACACAGCACCTCCTGGTGTCAGTGCAGGCCCAGATGCAATCAGCGAGGTGCTATCTACTCTTTCTTTAGAAGTCAATAAG
TCTCCGGAAACCAAAAATGATAGAGGAAATGACTTGGACACTAAGGCTACACCGTCAGTTTCAGTTTCAAAAAACGTCAATGTGAAAGAC
ATTCTCCGAAGCTTGGTTAACATACCAGCAGATGGAGTCACAGTGGATCCTGCCCTTCTGCCACCAGCCTGCCTTGGAGCCCTTGGTGAT
CTATCTGTGGAACAACCCGTGCAGTTCAGATCTTTTGACAGAAGTGTCATTGTTGCAGCAAAAAAGTCAGCAGTCTCACCTTCCACCTTT
AATACAAGCATACCTACCAATGCTGTCAGTGTGGTTTCCTCAGTAGATTCAGCCCAAGCCTCAGATATGGGAGGAGAATCACCAGGCAGT
AGATCATCTAATGCAAAATTGCCCTCAGTTCCAACAGTTGATTCAGTTTCACAAGATCCGGTTTCAAATATGAGTATTACAGAGAGGCTT
GAACACGCTTTGGAAAAGGCAGCTCCTCTCCTTCGTGAGATTTTTGTGGATTTTGCACCTTTTCTTTCTCGGACACTTTTGGGTAGCCAT
GGACAAGAACTGCTTATAGAAGGAACAAGTCTGGTTTGCATGAAGTCGAGTAGTTCAGTTGTGGAATTGGTTATGCTACTGTGTTCTCAG
GAGTGGCAAAATTCTATTCAGAAGAATGCAGGCCTTGCTTTTATCGAACTTGTCAATGAAGGAAGGTTGCTTAGCCAGACAATGAAGGAT
CATCTAGTAAGAGTAGCAAATGAAGCTGAATTTATCCTGAGCAGGCAGAGAGCAGAAGATATTCACAGACATGCGGAATTTGAGTCACTG
TGTGCCCAGTATTCTGCAGACAAACGAGAAGATGAGAAGATGTGTGATCATTTGATAAGAGCAGCAAAATATCGTGACCACGTGACAGCA
ACTCAACTAATCCAGAAAATTATCAACATTCTCACAGACAAGCATGGAGCCTGGGGAAATTCTGCAGTGAGTCGTCCTCTTGAGTTCTGG
CGCCTTGACTACTGGGAAGATGACTTGCGGCGCCGGCGACGATTTGTGCGTAACCCTCTAGGATCGACACATCCTGAAGCGACACTAAAA
ACAGCCGTGGAACATGCCACAGATGAAGATATCCTTGCTAAAGGAAAACAGTCCATCAGGAGTCAGGCTTTAGGAAATCAGAACTCAGAA
AACGAGATCCTCCTGGAAGGCGATGATGATACTCTGTCATCCGTGGATGAGAAAGATTTAGAGAATCTTGCCGGTCCTGTTAGCCTGAGC
ACACCAGCTCAGCTTGTGGCCCCCTCTGTTGTAGTAAAGGGCACTCTTTCTGTCACCTCCTCCGAACTCTATTTTGAGGTGGATGAAGAG
GATCCTAACTTCAAAAAAATCGACCCCAAGATCTTGGCATATACAGAAGGGCTGCATGGAAAATGGCTGTTCACAGAGATACGATCAATC
TTTTCTCGTCGTTATCTTTTGCAAAATACAGCCCTGGAGATCTTTATGGCAAACAGAGTTGCTGTGATGTTCAACTTCCCAGACCCTGCA
ACAGTAAAGAAAGTGGTTAACTATCTACCTCGTGTTGGCGTTGGAACAAGTTTTGGATTGCCTCAAACCAGACGTATTTCATTAGCTAGT
CCACGTCAGCTTTTTAAGGCTTCTAATATGACCCAGCGATGGCAACACAGAGAGATATCTAATTTTGAGTACTTGATGTTTCTCAACACG
ATAGCAGGACGGAGTTATAATGACTTAAATCAGTATCCAGTGTTTCCTTGGGTCATCACTAATTATGAATCAGAAGAACTGGATCTTACC
TTGCCCACCAACTTCAGAGATTTGTCCAAGCCAATAGGAGCTCTGAACCCAAAAAGAGCAGCATTCTTCGCTGAGCGTTATGAATCATGG
GAAGATGATCAAGTTCCAAAGTTTCACTATGGTACTCATTACTCAACTGCAAGTTTTGTTCTTGCATGGCTGCTAAGAATAGAACCCTTT
ACAACTTATTTCCTAAATTTGCAAGGAGGCAAATTTGATCATGCAGATCGAACTTTTTCATCAATTTCCAGAGCTTGGCGAAACAGTCAG
CGTGATACCTCTGATATTAAGGAGTTGATCCCTGAATTTTATTATCTCCCTGAGATGTTTGTCAACTTCAATAATTATAATCTTGGAGTG
ATGGATGATGGGACAGTAGTGTCTGATGTCGAACTTCCTCCTTGGGCCAAAACCTCAGAAGAATTTGTTCACATAAACAGATTGGCCCTG
GAGAGTGAATTTGTTTCCTGCCAGCTTCACCAATGGATTGATCTCATTTTTGGCTATAAACAGCAAGGACCAGAAGCTGTCCGAGCCCTC
AATGTGTTCTATTACTTGACCTATGAAGGAGCTGTCAATCTGAATTCAATAACTGATCCTGTGTTGAGAGAGGCTGTTGAAGCTCAAATC
CGAAGTTTTGGACAGACTCCTTCTCAACTACTCATAGAGCCCCATCCTCCCAGAGGTTCTGCCATGCAAGTGAGTCCATTGATGTTCACA
GACAAAGCCCAGCAGGATGTTATCATGGTCCTCAAGTTTCCCTCCAACTCCCCTGTTACTCACGTGGCAGCCAACACCCAGCCTGGTTTG
GCAACTCCCGCTGTGATCACAGTCACTGCTAACAGGTTATTTGCGGTGAACAAATGGCACAACCTTCCTGCTCATCAAGGTGCTGTACAA
GACCAGCCATACCAGCTGCCAGTGGAAATCGATCCTCTCATAGCCAGCAATACAGGAATGCACAGGAGGCAAATCACTGACCTTTTAGAC
CAAAGTATTCAAGTGCATTCCCAGTGCTTTGTCATCACTTCAGACAACCGCTATATTCTCGTCTGTGGCTTCTGGGATAAAAGTTTCAGA
GTCTATTCTACAGACACAGGAAGATTGATCCAAGTGGTGTTTGGCCATTGGGATGTCGTCACTTGCCTTGCTCGTTCTGAGTCATATATT
GGGGGAAATTGCTACATTCTCTCAGGGTCACGTGATGCAACTCTTTTGCTGTGGTATTGGAATGGAAAATGCAGTGGGATTGGAGATAAC
CCAGGCAGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTG
GTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTG
AAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAA
CTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGA
GTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTAC
GACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCGGTGGCATCATGAATACCAAACC

>In-frame_ALDH2_ENST00000416293_chr12_112237867_+_LRBA_ENST00000510413_chr4_151793907_-_7656nt
ATGTTGCGCGCTGCCGCCCGCTTCGGGCCCCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCCAACCAG
CAGCCCGAGGTCTTCTGCAACCAGATTTTCATAAACAATGAATGGCACGATGCCGTCAGCAGGAAAACATTCCCCACCGTCAATCCGTCC
ACTGGAGAGGTCATCTGTCAGGTAGCTGAAGGGGACAAGGCCTTGGAGACCCTGGACAATGGCAAGCCCTATGTCATCTCCTACCTGGTG
GATTTGGACATGGTCCTCAAATGTCTCCGGTATTATGCCGGCTGGGCTGATAAGTACCACGGGAAAACCATCCCCATTGACGGAGACTTC
TTCAGCTACACACGCCATGAACCTGTGGGGGTGTGCGGGCAGATCATTCCGTGGAATTTCCCGCTCCTGATGCAAGCATGGAAGCTGGGC
CCAGCCTTGGCAACTGGAAACGTGGTTGTGATGAAGGTAGCTGAGCAGACACCCCTCACCGCCCTCTATGTGGCCAACCTGATCAAGGAG
GCTGGCTTTCCCCCTGGTGTGGTCAACATTGTGCCTGGATTTGGCCCCACGGCTGGGGCCGCCATTGCCTCCCATGAGGATGTGGACAAA
GTGGCATTCACAGGCTCCACTGAGATTGGCCGCGTAATCCAGGTTGCTGCTGGGAGCAGCAACCTCAAGAGAGTGACCTTGGAGCTGGGG
GGGAAGAGCCCCAACATCATCATGTCAGATGCCGATATGGATTGGGCCGTGGAACAGGCCCACTTCGCCCTGTTCTTCAACCAGGGCCAG
TGCTGCTGTGCCGGCTCCCGGACCTTCGTGCAGGAGGACATCTATGATGAGTTTGTGGAGCGGAGCGTTGCCCGGGCCAAGTCTCGGGTG
GTCGGGAACCCCTTTGATAGCAAGACCGAGCAGGGGCCGCAGGTGGATGAAACTCAGTTTAAGAAGATCCTCGGCTACATCAACACGGGG
AAGCAAGAGGGGGCGAAGCTGCTGTGTGGTGGGGGCATTGCTGCTGACCGTGGTTACTTCATCCAGCCCACTGTGTTTGGAGATGTGCAG
GATGGCATGACCATCGCCAAGGAGGAGATCTTCGGGCCAGTGATGCAGATCCTGAAGTTCAAGACCATAGAGGAGGTTGTTGGGAGAGCC
AACAATTCCACGTACGGGCTGGCCGCAGCTGTCTTCACAAAGGATTTGGACAAGGCCAATTACCTGTCCCAGGCCCTCCAGGCGGGCACT
GTGTGTGTTATCTACAAACTTCTGGCATCGAAAAGTGAAGGAATCAGGGTACAAGCTCTTAAGGCAATGGGTTATTTTTTAAAACATCTG
GCCCCAAAGAGGAAAGCAGAAGTCATGCTTGGACATGGATTGTTTTCATTGCTAGCTGAAAGGCTCATGCTTCAGACAAATTTAATCACA
ATGACCACATATAATGTGCTGTTTGAGATTCTTATAGAACAGATTGGTACTCAGGTGATACATAAACAGCATCCAGATCCTGATTCTTCA
GTGAAGATACAAAACCCTCAGATACTAAAAGTAATTGCGACCCTACTTCGAAATTCTCCCCAGTGCCCAGAGAGCATGGAGGTTCGCAGA
GCCTTTCTTTCTGACATGATTAAACTTTTTAATAACAGTAGAGAAAACAGGAGGAGCTTGCTACAATGCTCTGTGTGGCAAGAATGGATG
CTTTCTCTCTGCTATTTTAATCCTAAGAATTCAGATGAGCAAAAGATAACAGAAATGGTATACGCCATATTCAGAATCCTGCTTTACCAT
GCAGTCAAATATGAGTGGGGTGGCTGGCGTGTATGGGTAGACACTTTATCAATCACTCATTCAAAGGTCACTTTTGAAATACACAAAGAA
AACCTTGCCAATATATTTAGGGAACAGCAAGGAAAAGTTGATGAAGAAATAGGGCTGTGTTCTTCAACTTCAGTTCAAGCAGCCTCTGGC
ATTAGAAGGGATATTAATGTTTCAGTAGGATCCCAGCAACCAGATACGAAGGATTCTCCTGTCTGTCCTCATTTCACCACAAATGGTAAT
GAAAATTCAAGTATAGAGAAGACAAGTTCACTAGAATCTGCATCTAATATTGAACTGCAAACTACTAATACATCTTATGAAGAAATGAAA
GCTGAGCAAGAAAATCAGGAGTTACCAGATGAAGGCACTTTGGAAGAAACACTGACAAATGAGACAAGGAATGCAGATGATTTAGAAGTA
TCTTCTGACATAATAGAAGCTGTGGCTATTTCCTCTAATTCTTTTATAACAACTGGCAAAGATTCAATGACTGTCAGTGAAGTAACTGCT
TCTATAAGTTCTCCTTCAGAAGAGGATGCCTCAGAGATGCCAGAATTCTTGGATAAATCTATAGTAGAGGAAGAGGAAGATGATGATTAT
GTGGAACTGAAAGTAGAAGGCAGTCCTACTGAGGAAGCTAATCTACCCACAGAGCTCCAAGATAACAGTTTGTCTCCAGCTGCATCTGAA
GCCGGTGAAAAACTGGACATGTTTGGTAATGATGACAAATTAATATTTCAAGAAGGAAAACCTGTTACTGAAAAGCAAACTGATACTGAA
ACTCAAGATTCTAAAGATTCTGGAATTCAGACTATGACAGCATCAGGGTCTTCAGCTATGTCACCAGAAACTACTGTTTCCCAAATAGCT
GTAGAATCAGACCTTGGTCAGATGCTGGAGGAAGGGAAGAAAGCAACTAACCTCACTAGAGAAACCAAATTAATTAATGATTGTCATGGT
AGTGTCTCTGAGGCTTCTTCTGAGCAAAAGATTGCGAAGTTGGATGTTTCCAATGTTGCTACAGATACTGAGAGGCTGGAGTTGAAGGCC
AGTCCCAACGTGGAAGCACCTCAACCTCATCGACATGTGCTTGAGATATCAAGGCAACATGAGCAGCCAGGGCAAGGAATAGCACCAGAT
GCAGTTAATGGACAAAGGAGGGATTCCAGATCTACTGTGTTTCGTATTCCTGAGTTCAACTGGTCTCAGATGCATCAACGTTTGCTCACT
GATCTATTATTTTCAATAGAAACAGATATACAGATGTGGAGAAGCCATTCAACAAAGACAGTTATGGACTTCGTGAATAGCAGTGATAAT
GTCATCTTTGTACACAACACAATTCATCTCATCTCTCAAGTGATGGACAATATGGTCATGGCTTGTGGGGGTATACTGCCATTGCTTTCA
GCTGCTACATCGGCTACACATGAACTGGAAAATATTGAACCTACTCAAGGCCTTTCAATAGAAGCCTCTGTGACATTTTTGCAGAGGCTA
ATTAGCCTTGTGGATGTGCTTATATTTGCAAGTTCTCTTGGCTTTACTGAAATTGAAGCTGAAAAAAGTATGTCATCTGGAGGAATTTTG
CGGCAGTGTCTCCGACTAGTTTGTGCAGTCGCAGTAAGGAATTGCTTGGAGTGTCAACAGCATTCACAACTGAAAACTAGGGGAGATAAA
GCCTTGAAACCAATGCATAGCCTTATTCCTTTAGGGAAATCTGCAGCGAAGAGCCCAGTGGACATTGTGACTGGCGGTATATCTCCAGTA
AGAGATCTTGACAGGCTTCTACAGGACATGGATATTAATCGGCTTAGGGCAGTTGTTTTCAGAGACATAGAGGATAGCAAACAAGCTCAA
TTTTTAGCCTTGGCAGTAGTATACTTTATCTCTGTTCTTATGGTCTCCAAGTACAGAGACATTTTGGAACCCCAAAATGAAAGGCATAGC
CAGTCATGTACAGAAACTGGCAGTGAAAATGAGAATGTATCACTCTCTGAAATCACACCAGCAGCATTCAGCACTTTAACTACGGCATCA
GTGGAAGAATCTGAAAGCACATCATCTGCTCGAAGGAGGGACTCAGGCATTGGGGAAGAAACAGCCACTGGTTTAGGAAGCCATGTGGAA
GTAACTCCTCACACAGCACCTCCTGGTGTCAGTGCAGGCCCAGATGCAATCAGCGAGGTGCTATCTACTCTTTCTTTAGAAGTCAATAAG
TCTCCGGAAACCAAAAATGATAGAGGAAATGACTTGGACACTAAGGCTACACCGTCAGTTTCAGTTTCAAAAAACGTCAATGTGAAAGAC
ATTCTCCGAAGCTTGGTTAACATACCAGCAGATGGAGTCACAGTGGATCCTGCCCTTCTGCCACCAGCCTGCCTTGGAGCCCTTGGTGAT
CTATCTGTGGAACAACCCGTGCAGTTCAGATCTTTTGACAGAAGTGTCATTGTTGCAGCAAAAAAGTCAGCAGTCTCACCTTCCACCTTT
AATACAAGCATACCTACCAATGCTGTCAGTGTGGTTTCCTCAGTAGATTCAGCCCAAGCCTCAGATATGGGAGGAGAATCACCAGGCAGT
AGATCATCTAATGCAAAATTGCCCTCAGTTCCAACAGTTGATTCAGTTTCACAAGATCCGGTTTCAAATATGAGTATTACAGAGAGGCTT
GAACACGCTTTGGAAAAGGCAGCTCCTCTCCTTCGTGAGATTTTTGTGGATTTTGCACCTTTTCTTTCTCGGACACTTTTGGGTAGCCAT
GGACAAGAACTGCTTATAGAAGGAACAAGTCTGGTTTGCATGAAGTCGAGTAGTTCAGTTGTGGAATTGGTTATGCTACTGTGTTCTCAG
GAGTGGCAAAATTCTATTCAGAAGAATGCAGGCCTTGCTTTTATCGAACTTGTCAATGAAGGAAGGTTGCTTAGCCAGACAATGAAGGAT
CATCTAGTAAGAGTAGCAAATGAAGCTGAATTTATCCTGAGCAGGCAGAGAGCAGAAGATATTCACAGACATGCGGAATTTGAGTCACTG
TGTGCCCAGTATTCTGCAGACAAACGAGAAGATGAGAAGATGTGTGATCATTTGATAAGAGCAGCAAAATATCGTGACCACGTGACAGCA
ACTCAACTAATCCAGAAAATTATCAACATTCTCACAGACAAGCATGGAGCCTGGGGAAATTCTGCAGTGAGTCGTCCTCTTGAGTTCTGG
CGCCTTGACTACTGGGAAGATGACTTGCGGCGCCGGCGACGATTTGTGCGTAACCCTCTAGGATCGACACATCCTGAAGCGACACTAAAA
ACAGCCGTGGAACATGCCACAGATGAAGATATCCTTGCTAAAGGAAAACAGTCCATCAGGAGTCAGGCTTTAGGAAATCAGAACTCAGAA
AACGAGATCCTCCTGGAAGGCGATGATGATACTCTGTCATCCGTGGATGAGAAAGATTTAGAGAATCTTGCCGGTCCTGTTAGCCTGAGC
ACACCAGCTCAGCTTGTGGCCCCCTCTGTTGTAGTAAAGGGCACTCTTTCTGTCACCTCCTCCGAACTCTATTTTGAGGTGGATGAAGAG
GATCCTAACTTCAAAAAAATCGACCCCAAGATCTTGGCATATACAGAAGGGCTGCATGGAAAATGGCTGTTCACAGAGATACGATCAATC
TTTTCTCGTCGTTATCTTTTGCAAAATACAGCCCTGGAGATCTTTATGGCAAACAGAGTTGCTGTGATGTTCAACTTCCCAGACCCTGCA
ACAGTAAAGAAAGTGGTTAACTATCTACCTCGTGTTGGCGTTGGAACAAGTTTTGGATTGCCTCAAACCAGACGTATTTCATTAGCTAGT
CCACGTCAGCTTTTTAAGGCTTCTAATATGACCCAGCGATGGCAACACAGAGAGATATCTAATTTTGAGTACTTGATGTTTCTCAACACG
ATAGCAGGACGGAGTTATAATGACTTAAATCAGTATCCAGTGTTTCCTTGGGTCATCACTAATTATGAATCAGAAGAACTGGATCTTACC
TTGCCCACCAACTTCAGAGATTTGTCCAAGCCAATAGGAGCTCTGAACCCAAAAAGAGCAGCATTCTTCGCTGAGCGTTATGAATCATGG
GAAGATGATCAAGTTCCAAAGTTTCACTATGGTACTCATTACTCAACTGCAAGTTTTGTTCTTGCATGGCTGCTAAGAATAGAACCCTTT
ACAACTTATTTCCTAAATTTGCAAGGAGGCAAATTTGATCATGCAGATCGAACTTTTTCATCAATTTCCAGAGCTTGGCGAAACAGTCAG
CGTGATACCTCTGATATTAAGGAGTTGATCCCTGAATTTTATTATCTCCCTGAGATGTTTGTCAACTTCAATAATTATAATCTTGGAGTG
ATGGATGATGGGACAGTAGTGTCTGATGTCGAACTTCCTCCTTGGGCCAAAACCTCAGAAGAATTTGTTCACATAAACAGATTGGCCCTG
GAGAGTGAATTTGTTTCCTGCCAGCTTCACCAATGGATTGATCTCATTTTTGGCTATAAACAGCAAGGACCAGAAGCTGTCCGAGCCCTC
AATGTGTTCTATTACTTGACCTATGAAGGAGCTGTCAATCTGAATTCAATAACTGATCCTGTGTTGAGAGAGGCTGTTGAAGCTCAAATC
CGAAGTTTTGGACAGACTCCTTCTCAACTACTCATAGAGCCCCATCCTCCCAGAGGTTCTGCCATGCAAGTGAGTCCATTGATGTTCACA
GACAAAGCCCAGCAGGATGTTATCATGGTCCTCAAGTTTCCCTCCAACTCCCCTGTTACTCACGTGGCAGCCAACACCCAGCCTGGTTTG
GCAACTCCCGCTGTGATCACAGTCACTGCTAACAGGTTATTTGCGGTGAACAAATGGCACAACCTTCCTGCTCATCAAGGTGCTGTACAA
GACCAGCCATACCAGCTGCCAGTGGAAATCGATCCTCTCATAGCCAGCAATACAGGAATGCACAGGAGGCAAATCACTGACCTTTTAGAC
CAAAGTATTCAAGTGCATTCCCAGTGCTTTGTCATCACTTCAGACAACCGCTATATTCTCGTCTGTGGCTTCTGGGATAAAAGTTTCAGA
GTCTATTCTACAGACACAGGAAGATTGATCCAAGTGGTGTTTGGCCATTGGGATGTCGTCACTTGCCTTGCTCGTTCTGAGTCATATATT
GGGGGAAATTGCTACATTCTCTCAGGGTCACGTGATGCAACTCTTTTGCTGTGGTATTGGAATGGAAAATGCAGTGGGATTGGAGATAAC
CCAGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTG
TTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAA
CCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTC
CAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTG
GTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGAC
CAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGC

>In-frame_ALDH2_ENST00000261733_chr12_112237867_+_LRBA_ENST00000535741_chr4_151793907_-_7800nt
ATGTTGCGCGCTGCCGCCCGCTTCGGGCCCCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCCAACCAG
CAGCCCGAGGTCTTCTGCAACCAGATTTTCATAAACAATGAATGGCACGATGCCGTCAGCAGGAAAACATTCCCCACCGTCAATCCGTCC
ACTGGAGAGGTCATCTGTCAGGTAGCTGAAGGGGACAAGGAAGATGTGGACAAGGCAGTGAAGGCCGCCCGGGCCGCCTTCCAGCTGGGC
TCACCTTGGCGCCGCATGGACGCATCACACAGGGGCCGGCTGCTGAACCGCCTGGCCGATCTGATCGAGCGGGACCGGACCTACCTGGCG
GCCTTGGAGACCCTGGACAATGGCAAGCCCTATGTCATCTCCTACCTGGTGGATTTGGACATGGTCCTCAAATGTCTCCGGTATTATGCC
GGCTGGGCTGATAAGTACCACGGGAAAACCATCCCCATTGACGGAGACTTCTTCAGCTACACACGCCATGAACCTGTGGGGGTGTGCGGG
CAGATCATTCCGTGGAATTTCCCGCTCCTGATGCAAGCATGGAAGCTGGGCCCAGCCTTGGCAACTGGAAACGTGGTTGTGATGAAGGTA
GCTGAGCAGACACCCCTCACCGCCCTCTATGTGGCCAACCTGATCAAGGAGGCTGGCTTTCCCCCTGGTGTGGTCAACATTGTGCCTGGA
TTTGGCCCCACGGCTGGGGCCGCCATTGCCTCCCATGAGGATGTGGACAAAGTGGCATTCACAGGCTCCACTGAGATTGGCCGCGTAATC
CAGGTTGCTGCTGGGAGCAGCAACCTCAAGAGAGTGACCTTGGAGCTGGGGGGGAAGAGCCCCAACATCATCATGTCAGATGCCGATATG
GATTGGGCCGTGGAACAGGCCCACTTCGCCCTGTTCTTCAACCAGGGCCAGTGCTGCTGTGCCGGCTCCCGGACCTTCGTGCAGGAGGAC
ATCTATGATGAGTTTGTGGAGCGGAGCGTTGCCCGGGCCAAGTCTCGGGTGGTCGGGAACCCCTTTGATAGCAAGACCGAGCAGGGGCCG
CAGGTGGATGAAACTCAGTTTAAGAAGATCCTCGGCTACATCAACACGGGGAAGCAAGAGGGGGCGAAGCTGCTGTGTGGTGGGGGCATT
GCTGCTGACCGTGGTTACTTCATCCAGCCCACTGTGTTTGGAGATGTGCAGGATGGCATGACCATCGCCAAGGAGGAGATCTTCGGGCCA
GTGATGCAGATCCTGAAGTTCAAGACCATAGAGGAGGTTGTTGGGAGAGCCAACAATTCCACGTACGGGCTGGCCGCAGCTGTCTTCACA
AAGGATTTGGACAAGGCCAATTACCTGTCCCAGGCCCTCCAGGCGGGCACTGTGTGTGTTATCTACAAACTTCTGGCATCGAAAAGTGAA
GGAATCAGGGTACAAGCTCTTAAGGCAATGGGTTATTTTTTAAAACATCTGGCCCCAAAGAGGAAAGCAGAAGTCATGCTTGGACATGGA
TTGTTTTCATTGCTAGCTGAAAGGCTCATGCTTCAGACAAATTTAATCACAATGACCACATATAATGTGCTGTTTGAGATTCTTATAGAA
CAGATTGGTACTCAGGTGATACATAAACAGCATCCAGATCCTGATTCTTCAGTGAAGATACAAAACCCTCAGATACTAAAAGTAATTGCG
ACCCTACTTCGAAATTCTCCCCAGTGCCCAGAGAGCATGGAGGTTCGCAGAGCCTTTCTTTCTGACATGATTAAACTTTTTAATAACAGT
AGAGAAAACAGGAGGAGCTTGCTACAATGCTCTGTGTGGCAAGAATGGATGCTTTCTCTCTGCTATTTTAATCCTAAGAATTCAGATGAG
CAAAAGATAACAGAAATGGTATACGCCATATTCAGAATCCTGCTTTACCATGCAGTCAAATATGAGTGGGGTGGCTGGCGTGTATGGGTA
GACACTTTATCAATCACTCATTCAAAGGTCACTTTTGAAATACACAAAGAAAACCTTGCCAATATATTTAGGGAACAGCAAGGAAAAGTT
GATGAAGAAATAGGGCTGTGTTCTTCAACTTCAGTTCAAGCAGCCTCTGGCATTAGAAGGGATATTAATGTTTCAGTAGGATCCCAGCAA
CCAGATACGAAGGATTCTCCTGTCTGTCCTCATTTCACCACAAATGGTAATGAAAATTCAAGTATAGAGAAGACAAGTTCACTAGAATCT
GCATCTAATATTGAACTGCAAACTACTAATACATCTTATGAAGAAATGAAAGCTGAGCAAGAAAATCAGGAGTTACCAGATGAAGGCACT
TTGGAAGAAACACTGACAAATGAGACAAGGAATGCAGATGATTTAGAAGTATCTTCTGACATAATAGAAGCTGTGGCTATTTCCTCTAAT
TCTTTTATAACAACTGGCAAAGATTCAATGACTGTCAGTGAAGTAACTGCTTCTATAAGTTCTCCTTCAGAAGAGGATGCCTCAGAGATG
CCAGAATTCTTGGATAAATCTATAGTAGAGGAAGAGGAAGATGATGATTATGTGGAACTGAAAGTAGAAGGCAGTCCTACTGAGGAAGCT
AATCTACCCACAGAGCTCCAAGATAACAGTTTGTCTCCAGCTGCATCTGAAGCCGGTGAAAAACTGGACATGTTTGGTAATGATGACAAA
TTAATATTTCAAGAAGGAAAACCTGTTACTGAAAAGCAAACTGATACTGAAACTCAAGATTCTAAAGATTCTGGAATTCAGACTATGACA
GCATCAGGGTCTTCAGCTATGTCACCAGAAACTACTGTTTCCCAAATAGCTGTAGAATCAGACCTTGGTCAGATGCTGGAGGAAGGGAAG
AAAGCAACTAACCTCACTAGAGAAACCAAATTAATTAATGATTGTCATGGTAGTGTCTCTGAGGCTTCTTCTGAGCAAAAGATTGCGAAG
TTGGATGTTTCCAATGTTGCTACAGATACTGAGAGGCTGGAGTTGAAGGCCAGTCCCAACGTGGAAGCACCTCAACCTCATCGACATGTG
CTTGAGATATCAAGGCAACATGAGCAGCCAGGGCAAGGAATAGCACCAGATGCAGTTAATGGACAAAGGAGGGATTCCAGATCTACTGTG
TTTCGTATTCCTGAGTTCAACTGGTCTCAGATGCATCAACGTTTGCTCACTGATCTATTATTTTCAATAGAAACAGATATACAGATGTGG
AGAAGCCATTCAACAAAGACAGTTATGGACTTCGTGAATAGCAGTGATAATGTCATCTTTGTACACAACACAATTCATCTCATCTCTCAA
GTGATGGACAATATGGTCATGGCTTGTGGGGGTATACTGCCATTGCTTTCAGCTGCTACATCGGCTACACATGAACTGGAAAATATTGAA
CCTACTCAAGGCCTTTCAATAGAAGCCTCTGTGACATTTTTGCAGAGGCTAATTAGCCTTGTGGATGTGCTTATATTTGCAAGTTCTCTT
GGCTTTACTGAAATTGAAGCTGAAAAAAGTATGTCATCTGGAGGAATTTTGCGGCAGTGTCTCCGACTAGTTTGTGCAGTCGCAGTAAGG
AATTGCTTGGAGTGTCAACAGCATTCACAACTGAAAACTAGGGGAGATAAAGCCTTGAAACCAATGCATAGCCTTATTCCTTTAGGGAAA
TCTGCAGCGAAGAGCCCAGTGGACATTGTGACTGGCGGTATATCTCCAGTAAGAGATCTTGACAGGCTTCTACAGGACATGGATATTAAT
CGGCTTAGGGCAGTTGTTTTCAGAGACATAGAGGATAGCAAACAAGCTCAATTTTTAGCCTTGGCAGTAGTATACTTTATCTCTGTTCTT
ATGGTCTCCAAGTACAGAGACATTTTGGAACCCCAAAATGAAAGGCATAGCCAGTCATGTACAGAAACTGGCAGTGAAAATGAGAATGTA
TCACTCTCTGAAATCACACCAGCAGCATTCAGCACTTTAACTACGGCATCAGTGGAAGAATCTGAAAGCACATCATCTGCTCGAAGGAGG
GACTCAGGCATTGGGGAAGAAACAGCCACTGGTTTAGGAAGCCATGTGGAAGTAACTCCTCACACAGCACCTCCTGGTGTCAGTGCAGGC
CCAGATGCAATCAGCGAGGTGCTATCTACTCTTTCTTTAGAAGTCAATAAGTCTCCGGAAACCAAAAATGATAGAGGAAATGACTTGGAC
ACTAAGGCTACACCGTCAGTTTCAGTTTCAAAAAACGTCAATGTGAAAGACATTCTCCGAAGCTTGGTTAACATACCAGCAGATGGAGTC
ACAGTGGATCCTGCCCTTCTGCCACCAGCCTGCCTTGGAGCCCTTGGTGATCTATCTGTGGAACAACCCGTGCAGTTCAGATCTTTTGAC
AGAAGTGTCATTGTTGCAGCAAAAAAGTCAGCAGTCTCACCTTCCACCTTTAATACAAGCATACCTACCAATGCTGTCAGTGTGGTTTCC
TCAGTAGATTCAGCCCAAGCCTCAGATATGGGAGGAGAATCACCAGGCAGTAGATCATCTAATGCAAAATTGCCCTCAGTTCCAACAGTT
GATTCAGTTTCACAAGATCCGGTTTCAAATATGAGTATTACAGAGAGGCTTGAACACGCTTTGGAAAAGGCAGCTCCTCTCCTTCGTGAG
ATTTTTGTGGATTTTGCACCTTTTCTTTCTCGGACACTTTTGGGTAGCCATGGACAAGAACTGCTTATAGAAGGAACAAGTCTGGTTTGC
ATGAAGTCGAGTAGTTCAGTTGTGGAATTGGTTATGCTACTGTGTTCTCAGGAGTGGCAAAATTCTATTCAGAAGAATGCAGGCCTTGCT
TTTATCGAACTTGTCAATGAAGGAAGGTTGCTTAGCCAGACAATGAAGGATCATCTAGTAAGAGTAGCAAATGAAGCTGAATTTATCCTG
AGCAGGCAGAGAGCAGAAGATATTCACAGACATGCGGAATTTGAGTCACTGTGTGCCCAGTATTCTGCAGACAAACGAGAAGATGAGAAG
ATGTGTGATCATTTGATAAGAGCAGCAAAATATCGTGACCACGTGACAGCAACTCAACTAATCCAGAAAATTATCAACATTCTCACAGAC
AAGCATGGAGCCTGGGGAAATTCTGCAGTGAGTCGTCCTCTTGAGTTCTGGCGCCTTGACTACTGGGAAGATGACTTGCGGCGCCGGCGA
CGATTTGTGCGTAACCCTCTAGGATCGACACATCCTGAAGCGACACTAAAAACAGCCGTGGAACATGCCACAGATGAAGATATCCTTGCT
AAAGGAAAACAGTCCATCAGGAGTCAGGCTTTAGGAAATCAGAACTCAGAAAACGAGATCCTCCTGGAAGGCGATGATGATACTCTGTCA
TCCGTGGATGAGAAAGATTTAGAGAATCTTGCCGGTCCTGTTAGCCTGAGCACACCAGCTCAGCTTGTGGCCCCCTCTGTTGTAGTAAAG
GGCACTCTTTCTGTCACCTCCTCCGAACTCTATTTTGAGGTGGATGAAGAGGATCCTAACTTCAAAAAAATCGACCCCAAGATCTTGGCA
TATACAGAAGGGCTGCATGGAAAATGGCTGTTCACAGAGATACGATCAATCTTTTCTCGTCGTTATCTTTTGCAAAATACAGCCCTGGAG
ATCTTTATGGCAAACAGAGTTGCTGTGATGTTCAACTTCCCAGACCCTGCAACAGTAAAGAAAGTGGTTAACTATCTACCTCGTGTTGGC
GTTGGAACAAGTTTTGGATTGCCTCAAACCAGACGTATTTCATTAGCTAGTCCACGTCAGCTTTTTAAGGCTTCTAATATGACCCAGCGA
TGGCAACACAGAGAGATATCTAATTTTGAGTACTTGATGTTTCTCAACACGATAGCAGGACGGAGTTATAATGACTTAAATCAGTATCCA
GTGTTTCCTTGGGTCATCACTAATTATGAATCAGAAGAACTGGATCTTACCTTGCCCACCAACTTCAGAGATTTGTCCAAGCCAATAGGA
GCTCTGAACCCAAAAAGAGCAGCATTCTTCGCTGAGCGTTATGAATCATGGGAAGATGATCAAGTTCCAAAGTTTCACTATGGTACTCAT
TACTCAACTGCAAGTTTTGTTCTTGCATGGCTGCTAAGAATAGAACCCTTTACAACTTATTTCCTAAATTTGCAAGGAGGCAAATTTGAT
CATGCAGATCGAACTTTTTCATCAATTTCCAGAGCTTGGCGAAACAGTCAGCGTGATACCTCTGATATTAAGGAGTTGATCCCTGAATTT
TATTATCTCCCTGAGATGTTTGTCAACTTCAATAATTATAATCTTGGAGTGATGGATGATGGGACAGTAGTGTCTGATGTCGAACTTCCT
CCTTGGGCCAAAACCTCAGAAGAATTTGTTCACATAAACAGATTGGCCCTGGAGAGTGAATTTGTTTCCTGCCAGCTTCACCAATGGATT
GATCTCATTTTTGGCTATAAACAGCAAGGACCAGAAGCTGTCCGAGCCCTCAATGTGTTCTATTACTTGACCTATGAAGGAGCTGTCAAT
CTGAATTCAATAACTGATCCTGTGTTGAGAGAGGCTGTTGAAGCTCAAATCCGAAGTTTTGGACAGACTCCTTCTCAACTACTCATAGAG
CCCCATCCTCCCAGAGGTTCTGCCATGCAAGTGAGTCCATTGATGTTCACAGACAAAGCCCAGCAGGATGTTATCATGGTCCTCAAGTTT
CCCTCCAACTCCCCTGTTACTCACGTGGCAGCCAACACCCAGCCTGGTTTGGCAACTCCCGCTGTGATCACAGTCACTGCTAACAGGTTA
TTTGCGGTGAACAAATGGCACAACCTTCCTGCTCATCAAGGTGCTGTACAAGACCAGCCATACCAGCTGCCAGTGGAAATCGATCCTCTC
ATAGCCAGCAATACAGGAATGCACAGGAGGCAAATCACTGACCTTTTAGACCAAAGTATTCAAGTGCATTCCCAGTGCTTTGTCATCACT
TCAGACAACCGCTATATTCTCGTCTGTGGCTTCTGGGATAAAAGTTTCAGAGTCTATTCTACAGACACAGGAAGATTGATCCAAGTGGTG
TTTGGCCATTGGGATGTCGTCACTTGCCTTGCTCGTTCTGAGTCATATATTGGGGGAAATTGCTACATTCTCTCAGGGTCACGTGATGCA
ACTCTTTTGCTGTGGTATTGGAATGGAAAATGCAGTGGGATTGGAGATAACCCAGGCAGTGAGACTGCTGCTCCTCGGGCCATTTTGACC
GGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACAT
TCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGT
GTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCC
ATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTC
TTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGC

>In-frame_ALDH2_ENST00000261733_chr12_112237867_+_LRBA_ENST00000510413_chr4_151793907_-_7797nt
ATGTTGCGCGCTGCCGCCCGCTTCGGGCCCCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCCAACCAG
CAGCCCGAGGTCTTCTGCAACCAGATTTTCATAAACAATGAATGGCACGATGCCGTCAGCAGGAAAACATTCCCCACCGTCAATCCGTCC
ACTGGAGAGGTCATCTGTCAGGTAGCTGAAGGGGACAAGGAAGATGTGGACAAGGCAGTGAAGGCCGCCCGGGCCGCCTTCCAGCTGGGC
TCACCTTGGCGCCGCATGGACGCATCACACAGGGGCCGGCTGCTGAACCGCCTGGCCGATCTGATCGAGCGGGACCGGACCTACCTGGCG
GCCTTGGAGACCCTGGACAATGGCAAGCCCTATGTCATCTCCTACCTGGTGGATTTGGACATGGTCCTCAAATGTCTCCGGTATTATGCC
GGCTGGGCTGATAAGTACCACGGGAAAACCATCCCCATTGACGGAGACTTCTTCAGCTACACACGCCATGAACCTGTGGGGGTGTGCGGG
CAGATCATTCCGTGGAATTTCCCGCTCCTGATGCAAGCATGGAAGCTGGGCCCAGCCTTGGCAACTGGAAACGTGGTTGTGATGAAGGTA
GCTGAGCAGACACCCCTCACCGCCCTCTATGTGGCCAACCTGATCAAGGAGGCTGGCTTTCCCCCTGGTGTGGTCAACATTGTGCCTGGA
TTTGGCCCCACGGCTGGGGCCGCCATTGCCTCCCATGAGGATGTGGACAAAGTGGCATTCACAGGCTCCACTGAGATTGGCCGCGTAATC
CAGGTTGCTGCTGGGAGCAGCAACCTCAAGAGAGTGACCTTGGAGCTGGGGGGGAAGAGCCCCAACATCATCATGTCAGATGCCGATATG
GATTGGGCCGTGGAACAGGCCCACTTCGCCCTGTTCTTCAACCAGGGCCAGTGCTGCTGTGCCGGCTCCCGGACCTTCGTGCAGGAGGAC
ATCTATGATGAGTTTGTGGAGCGGAGCGTTGCCCGGGCCAAGTCTCGGGTGGTCGGGAACCCCTTTGATAGCAAGACCGAGCAGGGGCCG
CAGGTGGATGAAACTCAGTTTAAGAAGATCCTCGGCTACATCAACACGGGGAAGCAAGAGGGGGCGAAGCTGCTGTGTGGTGGGGGCATT
GCTGCTGACCGTGGTTACTTCATCCAGCCCACTGTGTTTGGAGATGTGCAGGATGGCATGACCATCGCCAAGGAGGAGATCTTCGGGCCA
GTGATGCAGATCCTGAAGTTCAAGACCATAGAGGAGGTTGTTGGGAGAGCCAACAATTCCACGTACGGGCTGGCCGCAGCTGTCTTCACA
AAGGATTTGGACAAGGCCAATTACCTGTCCCAGGCCCTCCAGGCGGGCACTGTGTGTGTTATCTACAAACTTCTGGCATCGAAAAGTGAA
GGAATCAGGGTACAAGCTCTTAAGGCAATGGGTTATTTTTTAAAACATCTGGCCCCAAAGAGGAAAGCAGAAGTCATGCTTGGACATGGA
TTGTTTTCATTGCTAGCTGAAAGGCTCATGCTTCAGACAAATTTAATCACAATGACCACATATAATGTGCTGTTTGAGATTCTTATAGAA
CAGATTGGTACTCAGGTGATACATAAACAGCATCCAGATCCTGATTCTTCAGTGAAGATACAAAACCCTCAGATACTAAAAGTAATTGCG
ACCCTACTTCGAAATTCTCCCCAGTGCCCAGAGAGCATGGAGGTTCGCAGAGCCTTTCTTTCTGACATGATTAAACTTTTTAATAACAGT
AGAGAAAACAGGAGGAGCTTGCTACAATGCTCTGTGTGGCAAGAATGGATGCTTTCTCTCTGCTATTTTAATCCTAAGAATTCAGATGAG
CAAAAGATAACAGAAATGGTATACGCCATATTCAGAATCCTGCTTTACCATGCAGTCAAATATGAGTGGGGTGGCTGGCGTGTATGGGTA
GACACTTTATCAATCACTCATTCAAAGGTCACTTTTGAAATACACAAAGAAAACCTTGCCAATATATTTAGGGAACAGCAAGGAAAAGTT
GATGAAGAAATAGGGCTGTGTTCTTCAACTTCAGTTCAAGCAGCCTCTGGCATTAGAAGGGATATTAATGTTTCAGTAGGATCCCAGCAA
CCAGATACGAAGGATTCTCCTGTCTGTCCTCATTTCACCACAAATGGTAATGAAAATTCAAGTATAGAGAAGACAAGTTCACTAGAATCT
GCATCTAATATTGAACTGCAAACTACTAATACATCTTATGAAGAAATGAAAGCTGAGCAAGAAAATCAGGAGTTACCAGATGAAGGCACT
TTGGAAGAAACACTGACAAATGAGACAAGGAATGCAGATGATTTAGAAGTATCTTCTGACATAATAGAAGCTGTGGCTATTTCCTCTAAT
TCTTTTATAACAACTGGCAAAGATTCAATGACTGTCAGTGAAGTAACTGCTTCTATAAGTTCTCCTTCAGAAGAGGATGCCTCAGAGATG
CCAGAATTCTTGGATAAATCTATAGTAGAGGAAGAGGAAGATGATGATTATGTGGAACTGAAAGTAGAAGGCAGTCCTACTGAGGAAGCT
AATCTACCCACAGAGCTCCAAGATAACAGTTTGTCTCCAGCTGCATCTGAAGCCGGTGAAAAACTGGACATGTTTGGTAATGATGACAAA
TTAATATTTCAAGAAGGAAAACCTGTTACTGAAAAGCAAACTGATACTGAAACTCAAGATTCTAAAGATTCTGGAATTCAGACTATGACA
GCATCAGGGTCTTCAGCTATGTCACCAGAAACTACTGTTTCCCAAATAGCTGTAGAATCAGACCTTGGTCAGATGCTGGAGGAAGGGAAG
AAAGCAACTAACCTCACTAGAGAAACCAAATTAATTAATGATTGTCATGGTAGTGTCTCTGAGGCTTCTTCTGAGCAAAAGATTGCGAAG
TTGGATGTTTCCAATGTTGCTACAGATACTGAGAGGCTGGAGTTGAAGGCCAGTCCCAACGTGGAAGCACCTCAACCTCATCGACATGTG
CTTGAGATATCAAGGCAACATGAGCAGCCAGGGCAAGGAATAGCACCAGATGCAGTTAATGGACAAAGGAGGGATTCCAGATCTACTGTG
TTTCGTATTCCTGAGTTCAACTGGTCTCAGATGCATCAACGTTTGCTCACTGATCTATTATTTTCAATAGAAACAGATATACAGATGTGG
AGAAGCCATTCAACAAAGACAGTTATGGACTTCGTGAATAGCAGTGATAATGTCATCTTTGTACACAACACAATTCATCTCATCTCTCAA
GTGATGGACAATATGGTCATGGCTTGTGGGGGTATACTGCCATTGCTTTCAGCTGCTACATCGGCTACACATGAACTGGAAAATATTGAA
CCTACTCAAGGCCTTTCAATAGAAGCCTCTGTGACATTTTTGCAGAGGCTAATTAGCCTTGTGGATGTGCTTATATTTGCAAGTTCTCTT
GGCTTTACTGAAATTGAAGCTGAAAAAAGTATGTCATCTGGAGGAATTTTGCGGCAGTGTCTCCGACTAGTTTGTGCAGTCGCAGTAAGG
AATTGCTTGGAGTGTCAACAGCATTCACAACTGAAAACTAGGGGAGATAAAGCCTTGAAACCAATGCATAGCCTTATTCCTTTAGGGAAA
TCTGCAGCGAAGAGCCCAGTGGACATTGTGACTGGCGGTATATCTCCAGTAAGAGATCTTGACAGGCTTCTACAGGACATGGATATTAAT
CGGCTTAGGGCAGTTGTTTTCAGAGACATAGAGGATAGCAAACAAGCTCAATTTTTAGCCTTGGCAGTAGTATACTTTATCTCTGTTCTT
ATGGTCTCCAAGTACAGAGACATTTTGGAACCCCAAAATGAAAGGCATAGCCAGTCATGTACAGAAACTGGCAGTGAAAATGAGAATGTA
TCACTCTCTGAAATCACACCAGCAGCATTCAGCACTTTAACTACGGCATCAGTGGAAGAATCTGAAAGCACATCATCTGCTCGAAGGAGG
GACTCAGGCATTGGGGAAGAAACAGCCACTGGTTTAGGAAGCCATGTGGAAGTAACTCCTCACACAGCACCTCCTGGTGTCAGTGCAGGC
CCAGATGCAATCAGCGAGGTGCTATCTACTCTTTCTTTAGAAGTCAATAAGTCTCCGGAAACCAAAAATGATAGAGGAAATGACTTGGAC
ACTAAGGCTACACCGTCAGTTTCAGTTTCAAAAAACGTCAATGTGAAAGACATTCTCCGAAGCTTGGTTAACATACCAGCAGATGGAGTC
ACAGTGGATCCTGCCCTTCTGCCACCAGCCTGCCTTGGAGCCCTTGGTGATCTATCTGTGGAACAACCCGTGCAGTTCAGATCTTTTGAC
AGAAGTGTCATTGTTGCAGCAAAAAAGTCAGCAGTCTCACCTTCCACCTTTAATACAAGCATACCTACCAATGCTGTCAGTGTGGTTTCC
TCAGTAGATTCAGCCCAAGCCTCAGATATGGGAGGAGAATCACCAGGCAGTAGATCATCTAATGCAAAATTGCCCTCAGTTCCAACAGTT
GATTCAGTTTCACAAGATCCGGTTTCAAATATGAGTATTACAGAGAGGCTTGAACACGCTTTGGAAAAGGCAGCTCCTCTCCTTCGTGAG
ATTTTTGTGGATTTTGCACCTTTTCTTTCTCGGACACTTTTGGGTAGCCATGGACAAGAACTGCTTATAGAAGGAACAAGTCTGGTTTGC
ATGAAGTCGAGTAGTTCAGTTGTGGAATTGGTTATGCTACTGTGTTCTCAGGAGTGGCAAAATTCTATTCAGAAGAATGCAGGCCTTGCT
TTTATCGAACTTGTCAATGAAGGAAGGTTGCTTAGCCAGACAATGAAGGATCATCTAGTAAGAGTAGCAAATGAAGCTGAATTTATCCTG
AGCAGGCAGAGAGCAGAAGATATTCACAGACATGCGGAATTTGAGTCACTGTGTGCCCAGTATTCTGCAGACAAACGAGAAGATGAGAAG
ATGTGTGATCATTTGATAAGAGCAGCAAAATATCGTGACCACGTGACAGCAACTCAACTAATCCAGAAAATTATCAACATTCTCACAGAC
AAGCATGGAGCCTGGGGAAATTCTGCAGTGAGTCGTCCTCTTGAGTTCTGGCGCCTTGACTACTGGGAAGATGACTTGCGGCGCCGGCGA
CGATTTGTGCGTAACCCTCTAGGATCGACACATCCTGAAGCGACACTAAAAACAGCCGTGGAACATGCCACAGATGAAGATATCCTTGCT
AAAGGAAAACAGTCCATCAGGAGTCAGGCTTTAGGAAATCAGAACTCAGAAAACGAGATCCTCCTGGAAGGCGATGATGATACTCTGTCA
TCCGTGGATGAGAAAGATTTAGAGAATCTTGCCGGTCCTGTTAGCCTGAGCACACCAGCTCAGCTTGTGGCCCCCTCTGTTGTAGTAAAG
GGCACTCTTTCTGTCACCTCCTCCGAACTCTATTTTGAGGTGGATGAAGAGGATCCTAACTTCAAAAAAATCGACCCCAAGATCTTGGCA
TATACAGAAGGGCTGCATGGAAAATGGCTGTTCACAGAGATACGATCAATCTTTTCTCGTCGTTATCTTTTGCAAAATACAGCCCTGGAG
ATCTTTATGGCAAACAGAGTTGCTGTGATGTTCAACTTCCCAGACCCTGCAACAGTAAAGAAAGTGGTTAACTATCTACCTCGTGTTGGC
GTTGGAACAAGTTTTGGATTGCCTCAAACCAGACGTATTTCATTAGCTAGTCCACGTCAGCTTTTTAAGGCTTCTAATATGACCCAGCGA
TGGCAACACAGAGAGATATCTAATTTTGAGTACTTGATGTTTCTCAACACGATAGCAGGACGGAGTTATAATGACTTAAATCAGTATCCA
GTGTTTCCTTGGGTCATCACTAATTATGAATCAGAAGAACTGGATCTTACCTTGCCCACCAACTTCAGAGATTTGTCCAAGCCAATAGGA
GCTCTGAACCCAAAAAGAGCAGCATTCTTCGCTGAGCGTTATGAATCATGGGAAGATGATCAAGTTCCAAAGTTTCACTATGGTACTCAT
TACTCAACTGCAAGTTTTGTTCTTGCATGGCTGCTAAGAATAGAACCCTTTACAACTTATTTCCTAAATTTGCAAGGAGGCAAATTTGAT
CATGCAGATCGAACTTTTTCATCAATTTCCAGAGCTTGGCGAAACAGTCAGCGTGATACCTCTGATATTAAGGAGTTGATCCCTGAATTT
TATTATCTCCCTGAGATGTTTGTCAACTTCAATAATTATAATCTTGGAGTGATGGATGATGGGACAGTAGTGTCTGATGTCGAACTTCCT
CCTTGGGCCAAAACCTCAGAAGAATTTGTTCACATAAACAGATTGGCCCTGGAGAGTGAATTTGTTTCCTGCCAGCTTCACCAATGGATT
GATCTCATTTTTGGCTATAAACAGCAAGGACCAGAAGCTGTCCGAGCCCTCAATGTGTTCTATTACTTGACCTATGAAGGAGCTGTCAAT
CTGAATTCAATAACTGATCCTGTGTTGAGAGAGGCTGTTGAAGCTCAAATCCGAAGTTTTGGACAGACTCCTTCTCAACTACTCATAGAG
CCCCATCCTCCCAGAGGTTCTGCCATGCAAGTGAGTCCATTGATGTTCACAGACAAAGCCCAGCAGGATGTTATCATGGTCCTCAAGTTT
CCCTCCAACTCCCCTGTTACTCACGTGGCAGCCAACACCCAGCCTGGTTTGGCAACTCCCGCTGTGATCACAGTCACTGCTAACAGGTTA
TTTGCGGTGAACAAATGGCACAACCTTCCTGCTCATCAAGGTGCTGTACAAGACCAGCCATACCAGCTGCCAGTGGAAATCGATCCTCTC
ATAGCCAGCAATACAGGAATGCACAGGAGGCAAATCACTGACCTTTTAGACCAAAGTATTCAAGTGCATTCCCAGTGCTTTGTCATCACT
TCAGACAACCGCTATATTCTCGTCTGTGGCTTCTGGGATAAAAGTTTCAGAGTCTATTCTACAGACACAGGAAGATTGATCCAAGTGGTG
TTTGGCCATTGGGATGTCGTCACTTGCCTTGCTCGTTCTGAGTCATATATTGGGGGAAATTGCTACATTCTCTCAGGGTCACGTGATGCA
ACTCTTTTGCTGTGGTATTGGAATGGAAAATGCAGTGGGATTGGAGATAACCCAGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGC
CATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCC
ATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTC
ATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATC
CAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTT
GCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ALDH2_ENST00000416293_chr12_112237867_+_LRBA_ENST00000535741_chr4_151793907_-_9035nt
ATTGGCTGCCGCGCGGGGCGGGGAGCGGGGTCGGCTCAGTGGCCCTGAGACCCTAGCTCTGCTCTCGGTCCGCTCGCTGTCCGCTAGCCC
GCTGCGATGTTGCGCGCTGCCGCCCGCTTCGGGCCCCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCC
AACCAGCAGCCCGAGGTCTTCTGCAACCAGATTTTCATAAACAATGAATGGCACGATGCCGTCAGCAGGAAAACATTCCCCACCGTCAAT
CCGTCCACTGGAGAGGTCATCTGTCAGGTAGCTGAAGGGGACAAGGCCTTGGAGACCCTGGACAATGGCAAGCCCTATGTCATCTCCTAC
CTGGTGGATTTGGACATGGTCCTCAAATGTCTCCGGTATTATGCCGGCTGGGCTGATAAGTACCACGGGAAAACCATCCCCATTGACGGA
GACTTCTTCAGCTACACACGCCATGAACCTGTGGGGGTGTGCGGGCAGATCATTCCGTGGAATTTCCCGCTCCTGATGCAAGCATGGAAG
CTGGGCCCAGCCTTGGCAACTGGAAACGTGGTTGTGATGAAGGTAGCTGAGCAGACACCCCTCACCGCCCTCTATGTGGCCAACCTGATC
AAGGAGGCTGGCTTTCCCCCTGGTGTGGTCAACATTGTGCCTGGATTTGGCCCCACGGCTGGGGCCGCCATTGCCTCCCATGAGGATGTG
GACAAAGTGGCATTCACAGGCTCCACTGAGATTGGCCGCGTAATCCAGGTTGCTGCTGGGAGCAGCAACCTCAAGAGAGTGACCTTGGAG
CTGGGGGGGAAGAGCCCCAACATCATCATGTCAGATGCCGATATGGATTGGGCCGTGGAACAGGCCCACTTCGCCCTGTTCTTCAACCAG
GGCCAGTGCTGCTGTGCCGGCTCCCGGACCTTCGTGCAGGAGGACATCTATGATGAGTTTGTGGAGCGGAGCGTTGCCCGGGCCAAGTCT
CGGGTGGTCGGGAACCCCTTTGATAGCAAGACCGAGCAGGGGCCGCAGGTGGATGAAACTCAGTTTAAGAAGATCCTCGGCTACATCAAC
ACGGGGAAGCAAGAGGGGGCGAAGCTGCTGTGTGGTGGGGGCATTGCTGCTGACCGTGGTTACTTCATCCAGCCCACTGTGTTTGGAGAT
GTGCAGGATGGCATGACCATCGCCAAGGAGGAGATCTTCGGGCCAGTGATGCAGATCCTGAAGTTCAAGACCATAGAGGAGGTTGTTGGG
AGAGCCAACAATTCCACGTACGGGCTGGCCGCAGCTGTCTTCACAAAGGATTTGGACAAGGCCAATTACCTGTCCCAGGCCCTCCAGGCG
GGCACTGTGTGTGTTATCTACAAACTTCTGGCATCGAAAAGTGAAGGAATCAGGGTACAAGCTCTTAAGGCAATGGGTTATTTTTTAAAA
CATCTGGCCCCAAAGAGGAAAGCAGAAGTCATGCTTGGACATGGATTGTTTTCATTGCTAGCTGAAAGGCTCATGCTTCAGACAAATTTA
ATCACAATGACCACATATAATGTGCTGTTTGAGATTCTTATAGAACAGATTGGTACTCAGGTGATACATAAACAGCATCCAGATCCTGAT
TCTTCAGTGAAGATACAAAACCCTCAGATACTAAAAGTAATTGCGACCCTACTTCGAAATTCTCCCCAGTGCCCAGAGAGCATGGAGGTT
CGCAGAGCCTTTCTTTCTGACATGATTAAACTTTTTAATAACAGTAGAGAAAACAGGAGGAGCTTGCTACAATGCTCTGTGTGGCAAGAA
TGGATGCTTTCTCTCTGCTATTTTAATCCTAAGAATTCAGATGAGCAAAAGATAACAGAAATGGTATACGCCATATTCAGAATCCTGCTT
TACCATGCAGTCAAATATGAGTGGGGTGGCTGGCGTGTATGGGTAGACACTTTATCAATCACTCATTCAAAGGTCACTTTTGAAATACAC
AAAGAAAACCTTGCCAATATATTTAGGGAACAGCAAGGAAAAGTTGATGAAGAAATAGGGCTGTGTTCTTCAACTTCAGTTCAAGCAGCC
TCTGGCATTAGAAGGGATATTAATGTTTCAGTAGGATCCCAGCAACCAGATACGAAGGATTCTCCTGTCTGTCCTCATTTCACCACAAAT
GGTAATGAAAATTCAAGTATAGAGAAGACAAGTTCACTAGAATCTGCATCTAATATTGAACTGCAAACTACTAATACATCTTATGAAGAA
ATGAAAGCTGAGCAAGAAAATCAGGAGTTACCAGATGAAGGCACTTTGGAAGAAACACTGACAAATGAGACAAGGAATGCAGATGATTTA
GAAGTATCTTCTGACATAATAGAAGCTGTGGCTATTTCCTCTAATTCTTTTATAACAACTGGCAAAGATTCAATGACTGTCAGTGAAGTA
ACTGCTTCTATAAGTTCTCCTTCAGAAGAGGATGCCTCAGAGATGCCAGAATTCTTGGATAAATCTATAGTAGAGGAAGAGGAAGATGAT
GATTATGTGGAACTGAAAGTAGAAGGCAGTCCTACTGAGGAAGCTAATCTACCCACAGAGCTCCAAGATAACAGTTTGTCTCCAGCTGCA
TCTGAAGCCGGTGAAAAACTGGACATGTTTGGTAATGATGACAAATTAATATTTCAAGAAGGAAAACCTGTTACTGAAAAGCAAACTGAT
ACTGAAACTCAAGATTCTAAAGATTCTGGAATTCAGACTATGACAGCATCAGGGTCTTCAGCTATGTCACCAGAAACTACTGTTTCCCAA
ATAGCTGTAGAATCAGACCTTGGTCAGATGCTGGAGGAAGGGAAGAAAGCAACTAACCTCACTAGAGAAACCAAATTAATTAATGATTGT
CATGGTAGTGTCTCTGAGGCTTCTTCTGAGCAAAAGATTGCGAAGTTGGATGTTTCCAATGTTGCTACAGATACTGAGAGGCTGGAGTTG
AAGGCCAGTCCCAACGTGGAAGCACCTCAACCTCATCGACATGTGCTTGAGATATCAAGGCAACATGAGCAGCCAGGGCAAGGAATAGCA
CCAGATGCAGTTAATGGACAAAGGAGGGATTCCAGATCTACTGTGTTTCGTATTCCTGAGTTCAACTGGTCTCAGATGCATCAACGTTTG
CTCACTGATCTATTATTTTCAATAGAAACAGATATACAGATGTGGAGAAGCCATTCAACAAAGACAGTTATGGACTTCGTGAATAGCAGT
GATAATGTCATCTTTGTACACAACACAATTCATCTCATCTCTCAAGTGATGGACAATATGGTCATGGCTTGTGGGGGTATACTGCCATTG
CTTTCAGCTGCTACATCGGCTACACATGAACTGGAAAATATTGAACCTACTCAAGGCCTTTCAATAGAAGCCTCTGTGACATTTTTGCAG
AGGCTAATTAGCCTTGTGGATGTGCTTATATTTGCAAGTTCTCTTGGCTTTACTGAAATTGAAGCTGAAAAAAGTATGTCATCTGGAGGA
ATTTTGCGGCAGTGTCTCCGACTAGTTTGTGCAGTCGCAGTAAGGAATTGCTTGGAGTGTCAACAGCATTCACAACTGAAAACTAGGGGA
GATAAAGCCTTGAAACCAATGCATAGCCTTATTCCTTTAGGGAAATCTGCAGCGAAGAGCCCAGTGGACATTGTGACTGGCGGTATATCT
CCAGTAAGAGATCTTGACAGGCTTCTACAGGACATGGATATTAATCGGCTTAGGGCAGTTGTTTTCAGAGACATAGAGGATAGCAAACAA
GCTCAATTTTTAGCCTTGGCAGTAGTATACTTTATCTCTGTTCTTATGGTCTCCAAGTACAGAGACATTTTGGAACCCCAAAATGAAAGG
CATAGCCAGTCATGTACAGAAACTGGCAGTGAAAATGAGAATGTATCACTCTCTGAAATCACACCAGCAGCATTCAGCACTTTAACTACG
GCATCAGTGGAAGAATCTGAAAGCACATCATCTGCTCGAAGGAGGGACTCAGGCATTGGGGAAGAAACAGCCACTGGTTTAGGAAGCCAT
GTGGAAGTAACTCCTCACACAGCACCTCCTGGTGTCAGTGCAGGCCCAGATGCAATCAGCGAGGTGCTATCTACTCTTTCTTTAGAAGTC
AATAAGTCTCCGGAAACCAAAAATGATAGAGGAAATGACTTGGACACTAAGGCTACACCGTCAGTTTCAGTTTCAAAAAACGTCAATGTG
AAAGACATTCTCCGAAGCTTGGTTAACATACCAGCAGATGGAGTCACAGTGGATCCTGCCCTTCTGCCACCAGCCTGCCTTGGAGCCCTT
GGTGATCTATCTGTGGAACAACCCGTGCAGTTCAGATCTTTTGACAGAAGTGTCATTGTTGCAGCAAAAAAGTCAGCAGTCTCACCTTCC
ACCTTTAATACAAGCATACCTACCAATGCTGTCAGTGTGGTTTCCTCAGTAGATTCAGCCCAAGCCTCAGATATGGGAGGAGAATCACCA
GGCAGTAGATCATCTAATGCAAAATTGCCCTCAGTTCCAACAGTTGATTCAGTTTCACAAGATCCGGTTTCAAATATGAGTATTACAGAG
AGGCTTGAACACGCTTTGGAAAAGGCAGCTCCTCTCCTTCGTGAGATTTTTGTGGATTTTGCACCTTTTCTTTCTCGGACACTTTTGGGT
AGCCATGGACAAGAACTGCTTATAGAAGGAACAAGTCTGGTTTGCATGAAGTCGAGTAGTTCAGTTGTGGAATTGGTTATGCTACTGTGT
TCTCAGGAGTGGCAAAATTCTATTCAGAAGAATGCAGGCCTTGCTTTTATCGAACTTGTCAATGAAGGAAGGTTGCTTAGCCAGACAATG
AAGGATCATCTAGTAAGAGTAGCAAATGAAGCTGAATTTATCCTGAGCAGGCAGAGAGCAGAAGATATTCACAGACATGCGGAATTTGAG
TCACTGTGTGCCCAGTATTCTGCAGACAAACGAGAAGATGAGAAGATGTGTGATCATTTGATAAGAGCAGCAAAATATCGTGACCACGTG
ACAGCAACTCAACTAATCCAGAAAATTATCAACATTCTCACAGACAAGCATGGAGCCTGGGGAAATTCTGCAGTGAGTCGTCCTCTTGAG
TTCTGGCGCCTTGACTACTGGGAAGATGACTTGCGGCGCCGGCGACGATTTGTGCGTAACCCTCTAGGATCGACACATCCTGAAGCGACA
CTAAAAACAGCCGTGGAACATGCCACAGATGAAGATATCCTTGCTAAAGGAAAACAGTCCATCAGGAGTCAGGCTTTAGGAAATCAGAAC
TCAGAAAACGAGATCCTCCTGGAAGGCGATGATGATACTCTGTCATCCGTGGATGAGAAAGATTTAGAGAATCTTGCCGGTCCTGTTAGC
CTGAGCACACCAGCTCAGCTTGTGGCCCCCTCTGTTGTAGTAAAGGGCACTCTTTCTGTCACCTCCTCCGAACTCTATTTTGAGGTGGAT
GAAGAGGATCCTAACTTCAAAAAAATCGACCCCAAGATCTTGGCATATACAGAAGGGCTGCATGGAAAATGGCTGTTCACAGAGATACGA
TCAATCTTTTCTCGTCGTTATCTTTTGCAAAATACAGCCCTGGAGATCTTTATGGCAAACAGAGTTGCTGTGATGTTCAACTTCCCAGAC
CCTGCAACAGTAAAGAAAGTGGTTAACTATCTACCTCGTGTTGGCGTTGGAACAAGTTTTGGATTGCCTCAAACCAGACGTATTTCATTA
GCTAGTCCACGTCAGCTTTTTAAGGCTTCTAATATGACCCAGCGATGGCAACACAGAGAGATATCTAATTTTGAGTACTTGATGTTTCTC
AACACGATAGCAGGACGGAGTTATAATGACTTAAATCAGTATCCAGTGTTTCCTTGGGTCATCACTAATTATGAATCAGAAGAACTGGAT
CTTACCTTGCCCACCAACTTCAGAGATTTGTCCAAGCCAATAGGAGCTCTGAACCCAAAAAGAGCAGCATTCTTCGCTGAGCGTTATGAA
TCATGGGAAGATGATCAAGTTCCAAAGTTTCACTATGGTACTCATTACTCAACTGCAAGTTTTGTTCTTGCATGGCTGCTAAGAATAGAA
CCCTTTACAACTTATTTCCTAAATTTGCAAGGAGGCAAATTTGATCATGCAGATCGAACTTTTTCATCAATTTCCAGAGCTTGGCGAAAC
AGTCAGCGTGATACCTCTGATATTAAGGAGTTGATCCCTGAATTTTATTATCTCCCTGAGATGTTTGTCAACTTCAATAATTATAATCTT
GGAGTGATGGATGATGGGACAGTAGTGTCTGATGTCGAACTTCCTCCTTGGGCCAAAACCTCAGAAGAATTTGTTCACATAAACAGATTG
GCCCTGGAGAGTGAATTTGTTTCCTGCCAGCTTCACCAATGGATTGATCTCATTTTTGGCTATAAACAGCAAGGACCAGAAGCTGTCCGA
GCCCTCAATGTGTTCTATTACTTGACCTATGAAGGAGCTGTCAATCTGAATTCAATAACTGATCCTGTGTTGAGAGAGGCTGTTGAAGCT
CAAATCCGAAGTTTTGGACAGACTCCTTCTCAACTACTCATAGAGCCCCATCCTCCCAGAGGTTCTGCCATGCAAGTGAGTCCATTGATG
TTCACAGACAAAGCCCAGCAGGATGTTATCATGGTCCTCAAGTTTCCCTCCAACTCCCCTGTTACTCACGTGGCAGCCAACACCCAGCCT
GGTTTGGCAACTCCCGCTGTGATCACAGTCACTGCTAACAGGTTATTTGCGGTGAACAAATGGCACAACCTTCCTGCTCATCAAGGTGCT
GTACAAGACCAGCCATACCAGCTGCCAGTGGAAATCGATCCTCTCATAGCCAGCAATACAGGAATGCACAGGAGGCAAATCACTGACCTT
TTAGACCAAAGTATTCAAGTGCATTCCCAGTGCTTTGTCATCACTTCAGACAACCGCTATATTCTCGTCTGTGGCTTCTGGGATAAAAGT
TTCAGAGTCTATTCTACAGACACAGGAAGATTGATCCAAGTGGTGTTTGGCCATTGGGATGTCGTCACTTGCCTTGCTCGTTCTGAGTCA
TATATTGGGGGAAATTGCTACATTCTCTCAGGGTCACGTGATGCAACTCTTTTGCTGTGGTATTGGAATGGAAAATGCAGTGGGATTGGA
GATAACCCAGGCAGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTA
GGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAAC
TGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAAT
GGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGAC
AGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTG
TCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCGGTGGCATCATGAATAC
CAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAAGTACCTGGAGCATCATTCTCTTCTACCACATC
TGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATTGCTATTTTTGTAGTCTTTGCTTGACTTTTTTG
GGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTATATTTTTAGTCATAATGAGAAGTCTATTTTCAC
CAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATGAAGAACATTTCCCATGCATCTACAAGCTTGAG
AAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATGCTGTAATTTGGGTCCTGTATTTTTCCAAACAA
CTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGTAAATGTAATTTAAAACATCTCAATTAAGTCTG
TCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAGGCTATTTTATTGTGTGGTTAGCACAAGGAATC
TAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGCACAACAAAACGAAATGATGGAAATGCTCTTGA
GCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCGGTTTGCCTGTGCCTGGACAATGAGGCGGAGCC
ACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCGGGTGCTGTATTCAGCAACACCTGTTTTACTAT
TTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACGAAACAATGTTATTTGGTGGTGTATAATTCTAC
TTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTATTGCATAAATAAATTCTTTGTATGTTGTGAACT
TTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACACTCAGCTCTTCTCTAAAAGCAAGGATTTGGAAT
GAACAATTCAGTTTGACAGAAAAAGCTGAATAAAATGGCATCTGTAATTGAATTGTTGGAAATGCCTTTTTTGCTCCTAAATTTTAAACA

>In-frame_ALDH2_ENST00000416293_chr12_112237867_+_LRBA_ENST00000510413_chr4_151793907_-_8943nt
ATTGGCTGCCGCGCGGGGCGGGGAGCGGGGTCGGCTCAGTGGCCCTGAGACCCTAGCTCTGCTCTCGGTCCGCTCGCTGTCCGCTAGCCC
GCTGCGATGTTGCGCGCTGCCGCCCGCTTCGGGCCCCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCC
AACCAGCAGCCCGAGGTCTTCTGCAACCAGATTTTCATAAACAATGAATGGCACGATGCCGTCAGCAGGAAAACATTCCCCACCGTCAAT
CCGTCCACTGGAGAGGTCATCTGTCAGGTAGCTGAAGGGGACAAGGCCTTGGAGACCCTGGACAATGGCAAGCCCTATGTCATCTCCTAC
CTGGTGGATTTGGACATGGTCCTCAAATGTCTCCGGTATTATGCCGGCTGGGCTGATAAGTACCACGGGAAAACCATCCCCATTGACGGA
GACTTCTTCAGCTACACACGCCATGAACCTGTGGGGGTGTGCGGGCAGATCATTCCGTGGAATTTCCCGCTCCTGATGCAAGCATGGAAG
CTGGGCCCAGCCTTGGCAACTGGAAACGTGGTTGTGATGAAGGTAGCTGAGCAGACACCCCTCACCGCCCTCTATGTGGCCAACCTGATC
AAGGAGGCTGGCTTTCCCCCTGGTGTGGTCAACATTGTGCCTGGATTTGGCCCCACGGCTGGGGCCGCCATTGCCTCCCATGAGGATGTG
GACAAAGTGGCATTCACAGGCTCCACTGAGATTGGCCGCGTAATCCAGGTTGCTGCTGGGAGCAGCAACCTCAAGAGAGTGACCTTGGAG
CTGGGGGGGAAGAGCCCCAACATCATCATGTCAGATGCCGATATGGATTGGGCCGTGGAACAGGCCCACTTCGCCCTGTTCTTCAACCAG
GGCCAGTGCTGCTGTGCCGGCTCCCGGACCTTCGTGCAGGAGGACATCTATGATGAGTTTGTGGAGCGGAGCGTTGCCCGGGCCAAGTCT
CGGGTGGTCGGGAACCCCTTTGATAGCAAGACCGAGCAGGGGCCGCAGGTGGATGAAACTCAGTTTAAGAAGATCCTCGGCTACATCAAC
ACGGGGAAGCAAGAGGGGGCGAAGCTGCTGTGTGGTGGGGGCATTGCTGCTGACCGTGGTTACTTCATCCAGCCCACTGTGTTTGGAGAT
GTGCAGGATGGCATGACCATCGCCAAGGAGGAGATCTTCGGGCCAGTGATGCAGATCCTGAAGTTCAAGACCATAGAGGAGGTTGTTGGG
AGAGCCAACAATTCCACGTACGGGCTGGCCGCAGCTGTCTTCACAAAGGATTTGGACAAGGCCAATTACCTGTCCCAGGCCCTCCAGGCG
GGCACTGTGTGTGTTATCTACAAACTTCTGGCATCGAAAAGTGAAGGAATCAGGGTACAAGCTCTTAAGGCAATGGGTTATTTTTTAAAA
CATCTGGCCCCAAAGAGGAAAGCAGAAGTCATGCTTGGACATGGATTGTTTTCATTGCTAGCTGAAAGGCTCATGCTTCAGACAAATTTA
ATCACAATGACCACATATAATGTGCTGTTTGAGATTCTTATAGAACAGATTGGTACTCAGGTGATACATAAACAGCATCCAGATCCTGAT
TCTTCAGTGAAGATACAAAACCCTCAGATACTAAAAGTAATTGCGACCCTACTTCGAAATTCTCCCCAGTGCCCAGAGAGCATGGAGGTT
CGCAGAGCCTTTCTTTCTGACATGATTAAACTTTTTAATAACAGTAGAGAAAACAGGAGGAGCTTGCTACAATGCTCTGTGTGGCAAGAA
TGGATGCTTTCTCTCTGCTATTTTAATCCTAAGAATTCAGATGAGCAAAAGATAACAGAAATGGTATACGCCATATTCAGAATCCTGCTT
TACCATGCAGTCAAATATGAGTGGGGTGGCTGGCGTGTATGGGTAGACACTTTATCAATCACTCATTCAAAGGTCACTTTTGAAATACAC
AAAGAAAACCTTGCCAATATATTTAGGGAACAGCAAGGAAAAGTTGATGAAGAAATAGGGCTGTGTTCTTCAACTTCAGTTCAAGCAGCC
TCTGGCATTAGAAGGGATATTAATGTTTCAGTAGGATCCCAGCAACCAGATACGAAGGATTCTCCTGTCTGTCCTCATTTCACCACAAAT
GGTAATGAAAATTCAAGTATAGAGAAGACAAGTTCACTAGAATCTGCATCTAATATTGAACTGCAAACTACTAATACATCTTATGAAGAA
ATGAAAGCTGAGCAAGAAAATCAGGAGTTACCAGATGAAGGCACTTTGGAAGAAACACTGACAAATGAGACAAGGAATGCAGATGATTTA
GAAGTATCTTCTGACATAATAGAAGCTGTGGCTATTTCCTCTAATTCTTTTATAACAACTGGCAAAGATTCAATGACTGTCAGTGAAGTA
ACTGCTTCTATAAGTTCTCCTTCAGAAGAGGATGCCTCAGAGATGCCAGAATTCTTGGATAAATCTATAGTAGAGGAAGAGGAAGATGAT
GATTATGTGGAACTGAAAGTAGAAGGCAGTCCTACTGAGGAAGCTAATCTACCCACAGAGCTCCAAGATAACAGTTTGTCTCCAGCTGCA
TCTGAAGCCGGTGAAAAACTGGACATGTTTGGTAATGATGACAAATTAATATTTCAAGAAGGAAAACCTGTTACTGAAAAGCAAACTGAT
ACTGAAACTCAAGATTCTAAAGATTCTGGAATTCAGACTATGACAGCATCAGGGTCTTCAGCTATGTCACCAGAAACTACTGTTTCCCAA
ATAGCTGTAGAATCAGACCTTGGTCAGATGCTGGAGGAAGGGAAGAAAGCAACTAACCTCACTAGAGAAACCAAATTAATTAATGATTGT
CATGGTAGTGTCTCTGAGGCTTCTTCTGAGCAAAAGATTGCGAAGTTGGATGTTTCCAATGTTGCTACAGATACTGAGAGGCTGGAGTTG
AAGGCCAGTCCCAACGTGGAAGCACCTCAACCTCATCGACATGTGCTTGAGATATCAAGGCAACATGAGCAGCCAGGGCAAGGAATAGCA
CCAGATGCAGTTAATGGACAAAGGAGGGATTCCAGATCTACTGTGTTTCGTATTCCTGAGTTCAACTGGTCTCAGATGCATCAACGTTTG
CTCACTGATCTATTATTTTCAATAGAAACAGATATACAGATGTGGAGAAGCCATTCAACAAAGACAGTTATGGACTTCGTGAATAGCAGT
GATAATGTCATCTTTGTACACAACACAATTCATCTCATCTCTCAAGTGATGGACAATATGGTCATGGCTTGTGGGGGTATACTGCCATTG
CTTTCAGCTGCTACATCGGCTACACATGAACTGGAAAATATTGAACCTACTCAAGGCCTTTCAATAGAAGCCTCTGTGACATTTTTGCAG
AGGCTAATTAGCCTTGTGGATGTGCTTATATTTGCAAGTTCTCTTGGCTTTACTGAAATTGAAGCTGAAAAAAGTATGTCATCTGGAGGA
ATTTTGCGGCAGTGTCTCCGACTAGTTTGTGCAGTCGCAGTAAGGAATTGCTTGGAGTGTCAACAGCATTCACAACTGAAAACTAGGGGA
GATAAAGCCTTGAAACCAATGCATAGCCTTATTCCTTTAGGGAAATCTGCAGCGAAGAGCCCAGTGGACATTGTGACTGGCGGTATATCT
CCAGTAAGAGATCTTGACAGGCTTCTACAGGACATGGATATTAATCGGCTTAGGGCAGTTGTTTTCAGAGACATAGAGGATAGCAAACAA
GCTCAATTTTTAGCCTTGGCAGTAGTATACTTTATCTCTGTTCTTATGGTCTCCAAGTACAGAGACATTTTGGAACCCCAAAATGAAAGG
CATAGCCAGTCATGTACAGAAACTGGCAGTGAAAATGAGAATGTATCACTCTCTGAAATCACACCAGCAGCATTCAGCACTTTAACTACG
GCATCAGTGGAAGAATCTGAAAGCACATCATCTGCTCGAAGGAGGGACTCAGGCATTGGGGAAGAAACAGCCACTGGTTTAGGAAGCCAT
GTGGAAGTAACTCCTCACACAGCACCTCCTGGTGTCAGTGCAGGCCCAGATGCAATCAGCGAGGTGCTATCTACTCTTTCTTTAGAAGTC
AATAAGTCTCCGGAAACCAAAAATGATAGAGGAAATGACTTGGACACTAAGGCTACACCGTCAGTTTCAGTTTCAAAAAACGTCAATGTG
AAAGACATTCTCCGAAGCTTGGTTAACATACCAGCAGATGGAGTCACAGTGGATCCTGCCCTTCTGCCACCAGCCTGCCTTGGAGCCCTT
GGTGATCTATCTGTGGAACAACCCGTGCAGTTCAGATCTTTTGACAGAAGTGTCATTGTTGCAGCAAAAAAGTCAGCAGTCTCACCTTCC
ACCTTTAATACAAGCATACCTACCAATGCTGTCAGTGTGGTTTCCTCAGTAGATTCAGCCCAAGCCTCAGATATGGGAGGAGAATCACCA
GGCAGTAGATCATCTAATGCAAAATTGCCCTCAGTTCCAACAGTTGATTCAGTTTCACAAGATCCGGTTTCAAATATGAGTATTACAGAG
AGGCTTGAACACGCTTTGGAAAAGGCAGCTCCTCTCCTTCGTGAGATTTTTGTGGATTTTGCACCTTTTCTTTCTCGGACACTTTTGGGT
AGCCATGGACAAGAACTGCTTATAGAAGGAACAAGTCTGGTTTGCATGAAGTCGAGTAGTTCAGTTGTGGAATTGGTTATGCTACTGTGT
TCTCAGGAGTGGCAAAATTCTATTCAGAAGAATGCAGGCCTTGCTTTTATCGAACTTGTCAATGAAGGAAGGTTGCTTAGCCAGACAATG
AAGGATCATCTAGTAAGAGTAGCAAATGAAGCTGAATTTATCCTGAGCAGGCAGAGAGCAGAAGATATTCACAGACATGCGGAATTTGAG
TCACTGTGTGCCCAGTATTCTGCAGACAAACGAGAAGATGAGAAGATGTGTGATCATTTGATAAGAGCAGCAAAATATCGTGACCACGTG
ACAGCAACTCAACTAATCCAGAAAATTATCAACATTCTCACAGACAAGCATGGAGCCTGGGGAAATTCTGCAGTGAGTCGTCCTCTTGAG
TTCTGGCGCCTTGACTACTGGGAAGATGACTTGCGGCGCCGGCGACGATTTGTGCGTAACCCTCTAGGATCGACACATCCTGAAGCGACA
CTAAAAACAGCCGTGGAACATGCCACAGATGAAGATATCCTTGCTAAAGGAAAACAGTCCATCAGGAGTCAGGCTTTAGGAAATCAGAAC
TCAGAAAACGAGATCCTCCTGGAAGGCGATGATGATACTCTGTCATCCGTGGATGAGAAAGATTTAGAGAATCTTGCCGGTCCTGTTAGC
CTGAGCACACCAGCTCAGCTTGTGGCCCCCTCTGTTGTAGTAAAGGGCACTCTTTCTGTCACCTCCTCCGAACTCTATTTTGAGGTGGAT
GAAGAGGATCCTAACTTCAAAAAAATCGACCCCAAGATCTTGGCATATACAGAAGGGCTGCATGGAAAATGGCTGTTCACAGAGATACGA
TCAATCTTTTCTCGTCGTTATCTTTTGCAAAATACAGCCCTGGAGATCTTTATGGCAAACAGAGTTGCTGTGATGTTCAACTTCCCAGAC
CCTGCAACAGTAAAGAAAGTGGTTAACTATCTACCTCGTGTTGGCGTTGGAACAAGTTTTGGATTGCCTCAAACCAGACGTATTTCATTA
GCTAGTCCACGTCAGCTTTTTAAGGCTTCTAATATGACCCAGCGATGGCAACACAGAGAGATATCTAATTTTGAGTACTTGATGTTTCTC
AACACGATAGCAGGACGGAGTTATAATGACTTAAATCAGTATCCAGTGTTTCCTTGGGTCATCACTAATTATGAATCAGAAGAACTGGAT
CTTACCTTGCCCACCAACTTCAGAGATTTGTCCAAGCCAATAGGAGCTCTGAACCCAAAAAGAGCAGCATTCTTCGCTGAGCGTTATGAA
TCATGGGAAGATGATCAAGTTCCAAAGTTTCACTATGGTACTCATTACTCAACTGCAAGTTTTGTTCTTGCATGGCTGCTAAGAATAGAA
CCCTTTACAACTTATTTCCTAAATTTGCAAGGAGGCAAATTTGATCATGCAGATCGAACTTTTTCATCAATTTCCAGAGCTTGGCGAAAC
AGTCAGCGTGATACCTCTGATATTAAGGAGTTGATCCCTGAATTTTATTATCTCCCTGAGATGTTTGTCAACTTCAATAATTATAATCTT
GGAGTGATGGATGATGGGACAGTAGTGTCTGATGTCGAACTTCCTCCTTGGGCCAAAACCTCAGAAGAATTTGTTCACATAAACAGATTG
GCCCTGGAGAGTGAATTTGTTTCCTGCCAGCTTCACCAATGGATTGATCTCATTTTTGGCTATAAACAGCAAGGACCAGAAGCTGTCCGA
GCCCTCAATGTGTTCTATTACTTGACCTATGAAGGAGCTGTCAATCTGAATTCAATAACTGATCCTGTGTTGAGAGAGGCTGTTGAAGCT
CAAATCCGAAGTTTTGGACAGACTCCTTCTCAACTACTCATAGAGCCCCATCCTCCCAGAGGTTCTGCCATGCAAGTGAGTCCATTGATG
TTCACAGACAAAGCCCAGCAGGATGTTATCATGGTCCTCAAGTTTCCCTCCAACTCCCCTGTTACTCACGTGGCAGCCAACACCCAGCCT
GGTTTGGCAACTCCCGCTGTGATCACAGTCACTGCTAACAGGTTATTTGCGGTGAACAAATGGCACAACCTTCCTGCTCATCAAGGTGCT
GTACAAGACCAGCCATACCAGCTGCCAGTGGAAATCGATCCTCTCATAGCCAGCAATACAGGAATGCACAGGAGGCAAATCACTGACCTT
TTAGACCAAAGTATTCAAGTGCATTCCCAGTGCTTTGTCATCACTTCAGACAACCGCTATATTCTCGTCTGTGGCTTCTGGGATAAAAGT
TTCAGAGTCTATTCTACAGACACAGGAAGATTGATCCAAGTGGTGTTTGGCCATTGGGATGTCGTCACTTGCCTTGCTCGTTCTGAGTCA
TATATTGGGGGAAATTGCTACATTCTCTCAGGGTCACGTGATGCAACTCTTTTGCTGTGGTATTGGAATGGAAAATGCAGTGGGATTGGA
GATAACCCAGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGC
CTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGC
CTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGA
AAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGA
GGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCT
TACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCGGTGGCATCATGAATACCAA
ACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAAGTACCTGGAGCATCATTCTCTTCTACCACATCTGA
ATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATTGCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGG
GGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTATATTTTTAGTCATAATGAGAAGTCTATTTTCACCAA
TTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATGAAGAACATTTCCCATGCATCTACAAGCTTGAGAAA
TAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATGCTGTAATTTGGGTCCTGTATTTTTCCAAACAACTG
TGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGTAAATGTAATTTAAAACATCTCAATTAAGTCTGTCT
ATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAGGCTATTTTATTGTGTGGTTAGCACAAGGAATCTAA
TTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGCACAACAAAACGAAATGATGGAAATGCTCTTGAGCT
CACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCGGTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACT
GTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCGGGTGCTGTATTCAGCAACACCTGTTTTACTATTTG
TTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACGAAACAATGTTATTTGGTGGTGTATAATTCTACTTT
TCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTATTGCATAAATAAATTCTTTGTATGTTGTGAACTTTG
ATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACACTCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAA

>In-frame_ALDH2_ENST00000261733_chr12_112237867_+_LRBA_ENST00000535741_chr4_151793907_-_9141nt
TCAGTGGCCCTGAGACCCTAGCTCTGCTCTCGGTCCGCTCGCTGTCCGCTAGCCCGCTGCGATGTTGCGCGCTGCCGCCCGCTTCGGGCC
CCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCCAACCAGCAGCCCGAGGTCTTCTGCAACCAGATTTT
CATAAACAATGAATGGCACGATGCCGTCAGCAGGAAAACATTCCCCACCGTCAATCCGTCCACTGGAGAGGTCATCTGTCAGGTAGCTGA
AGGGGACAAGGAAGATGTGGACAAGGCAGTGAAGGCCGCCCGGGCCGCCTTCCAGCTGGGCTCACCTTGGCGCCGCATGGACGCATCACA
CAGGGGCCGGCTGCTGAACCGCCTGGCCGATCTGATCGAGCGGGACCGGACCTACCTGGCGGCCTTGGAGACCCTGGACAATGGCAAGCC
CTATGTCATCTCCTACCTGGTGGATTTGGACATGGTCCTCAAATGTCTCCGGTATTATGCCGGCTGGGCTGATAAGTACCACGGGAAAAC
CATCCCCATTGACGGAGACTTCTTCAGCTACACACGCCATGAACCTGTGGGGGTGTGCGGGCAGATCATTCCGTGGAATTTCCCGCTCCT
GATGCAAGCATGGAAGCTGGGCCCAGCCTTGGCAACTGGAAACGTGGTTGTGATGAAGGTAGCTGAGCAGACACCCCTCACCGCCCTCTA
TGTGGCCAACCTGATCAAGGAGGCTGGCTTTCCCCCTGGTGTGGTCAACATTGTGCCTGGATTTGGCCCCACGGCTGGGGCCGCCATTGC
CTCCCATGAGGATGTGGACAAAGTGGCATTCACAGGCTCCACTGAGATTGGCCGCGTAATCCAGGTTGCTGCTGGGAGCAGCAACCTCAA
GAGAGTGACCTTGGAGCTGGGGGGGAAGAGCCCCAACATCATCATGTCAGATGCCGATATGGATTGGGCCGTGGAACAGGCCCACTTCGC
CCTGTTCTTCAACCAGGGCCAGTGCTGCTGTGCCGGCTCCCGGACCTTCGTGCAGGAGGACATCTATGATGAGTTTGTGGAGCGGAGCGT
TGCCCGGGCCAAGTCTCGGGTGGTCGGGAACCCCTTTGATAGCAAGACCGAGCAGGGGCCGCAGGTGGATGAAACTCAGTTTAAGAAGAT
CCTCGGCTACATCAACACGGGGAAGCAAGAGGGGGCGAAGCTGCTGTGTGGTGGGGGCATTGCTGCTGACCGTGGTTACTTCATCCAGCC
CACTGTGTTTGGAGATGTGCAGGATGGCATGACCATCGCCAAGGAGGAGATCTTCGGGCCAGTGATGCAGATCCTGAAGTTCAAGACCAT
AGAGGAGGTTGTTGGGAGAGCCAACAATTCCACGTACGGGCTGGCCGCAGCTGTCTTCACAAAGGATTTGGACAAGGCCAATTACCTGTC
CCAGGCCCTCCAGGCGGGCACTGTGTGTGTTATCTACAAACTTCTGGCATCGAAAAGTGAAGGAATCAGGGTACAAGCTCTTAAGGCAAT
GGGTTATTTTTTAAAACATCTGGCCCCAAAGAGGAAAGCAGAAGTCATGCTTGGACATGGATTGTTTTCATTGCTAGCTGAAAGGCTCAT
GCTTCAGACAAATTTAATCACAATGACCACATATAATGTGCTGTTTGAGATTCTTATAGAACAGATTGGTACTCAGGTGATACATAAACA
GCATCCAGATCCTGATTCTTCAGTGAAGATACAAAACCCTCAGATACTAAAAGTAATTGCGACCCTACTTCGAAATTCTCCCCAGTGCCC
AGAGAGCATGGAGGTTCGCAGAGCCTTTCTTTCTGACATGATTAAACTTTTTAATAACAGTAGAGAAAACAGGAGGAGCTTGCTACAATG
CTCTGTGTGGCAAGAATGGATGCTTTCTCTCTGCTATTTTAATCCTAAGAATTCAGATGAGCAAAAGATAACAGAAATGGTATACGCCAT
ATTCAGAATCCTGCTTTACCATGCAGTCAAATATGAGTGGGGTGGCTGGCGTGTATGGGTAGACACTTTATCAATCACTCATTCAAAGGT
CACTTTTGAAATACACAAAGAAAACCTTGCCAATATATTTAGGGAACAGCAAGGAAAAGTTGATGAAGAAATAGGGCTGTGTTCTTCAAC
TTCAGTTCAAGCAGCCTCTGGCATTAGAAGGGATATTAATGTTTCAGTAGGATCCCAGCAACCAGATACGAAGGATTCTCCTGTCTGTCC
TCATTTCACCACAAATGGTAATGAAAATTCAAGTATAGAGAAGACAAGTTCACTAGAATCTGCATCTAATATTGAACTGCAAACTACTAA
TACATCTTATGAAGAAATGAAAGCTGAGCAAGAAAATCAGGAGTTACCAGATGAAGGCACTTTGGAAGAAACACTGACAAATGAGACAAG
GAATGCAGATGATTTAGAAGTATCTTCTGACATAATAGAAGCTGTGGCTATTTCCTCTAATTCTTTTATAACAACTGGCAAAGATTCAAT
GACTGTCAGTGAAGTAACTGCTTCTATAAGTTCTCCTTCAGAAGAGGATGCCTCAGAGATGCCAGAATTCTTGGATAAATCTATAGTAGA
GGAAGAGGAAGATGATGATTATGTGGAACTGAAAGTAGAAGGCAGTCCTACTGAGGAAGCTAATCTACCCACAGAGCTCCAAGATAACAG
TTTGTCTCCAGCTGCATCTGAAGCCGGTGAAAAACTGGACATGTTTGGTAATGATGACAAATTAATATTTCAAGAAGGAAAACCTGTTAC
TGAAAAGCAAACTGATACTGAAACTCAAGATTCTAAAGATTCTGGAATTCAGACTATGACAGCATCAGGGTCTTCAGCTATGTCACCAGA
AACTACTGTTTCCCAAATAGCTGTAGAATCAGACCTTGGTCAGATGCTGGAGGAAGGGAAGAAAGCAACTAACCTCACTAGAGAAACCAA
ATTAATTAATGATTGTCATGGTAGTGTCTCTGAGGCTTCTTCTGAGCAAAAGATTGCGAAGTTGGATGTTTCCAATGTTGCTACAGATAC
TGAGAGGCTGGAGTTGAAGGCCAGTCCCAACGTGGAAGCACCTCAACCTCATCGACATGTGCTTGAGATATCAAGGCAACATGAGCAGCC
AGGGCAAGGAATAGCACCAGATGCAGTTAATGGACAAAGGAGGGATTCCAGATCTACTGTGTTTCGTATTCCTGAGTTCAACTGGTCTCA
GATGCATCAACGTTTGCTCACTGATCTATTATTTTCAATAGAAACAGATATACAGATGTGGAGAAGCCATTCAACAAAGACAGTTATGGA
CTTCGTGAATAGCAGTGATAATGTCATCTTTGTACACAACACAATTCATCTCATCTCTCAAGTGATGGACAATATGGTCATGGCTTGTGG
GGGTATACTGCCATTGCTTTCAGCTGCTACATCGGCTACACATGAACTGGAAAATATTGAACCTACTCAAGGCCTTTCAATAGAAGCCTC
TGTGACATTTTTGCAGAGGCTAATTAGCCTTGTGGATGTGCTTATATTTGCAAGTTCTCTTGGCTTTACTGAAATTGAAGCTGAAAAAAG
TATGTCATCTGGAGGAATTTTGCGGCAGTGTCTCCGACTAGTTTGTGCAGTCGCAGTAAGGAATTGCTTGGAGTGTCAACAGCATTCACA
ACTGAAAACTAGGGGAGATAAAGCCTTGAAACCAATGCATAGCCTTATTCCTTTAGGGAAATCTGCAGCGAAGAGCCCAGTGGACATTGT
GACTGGCGGTATATCTCCAGTAAGAGATCTTGACAGGCTTCTACAGGACATGGATATTAATCGGCTTAGGGCAGTTGTTTTCAGAGACAT
AGAGGATAGCAAACAAGCTCAATTTTTAGCCTTGGCAGTAGTATACTTTATCTCTGTTCTTATGGTCTCCAAGTACAGAGACATTTTGGA
ACCCCAAAATGAAAGGCATAGCCAGTCATGTACAGAAACTGGCAGTGAAAATGAGAATGTATCACTCTCTGAAATCACACCAGCAGCATT
CAGCACTTTAACTACGGCATCAGTGGAAGAATCTGAAAGCACATCATCTGCTCGAAGGAGGGACTCAGGCATTGGGGAAGAAACAGCCAC
TGGTTTAGGAAGCCATGTGGAAGTAACTCCTCACACAGCACCTCCTGGTGTCAGTGCAGGCCCAGATGCAATCAGCGAGGTGCTATCTAC
TCTTTCTTTAGAAGTCAATAAGTCTCCGGAAACCAAAAATGATAGAGGAAATGACTTGGACACTAAGGCTACACCGTCAGTTTCAGTTTC
AAAAAACGTCAATGTGAAAGACATTCTCCGAAGCTTGGTTAACATACCAGCAGATGGAGTCACAGTGGATCCTGCCCTTCTGCCACCAGC
CTGCCTTGGAGCCCTTGGTGATCTATCTGTGGAACAACCCGTGCAGTTCAGATCTTTTGACAGAAGTGTCATTGTTGCAGCAAAAAAGTC
AGCAGTCTCACCTTCCACCTTTAATACAAGCATACCTACCAATGCTGTCAGTGTGGTTTCCTCAGTAGATTCAGCCCAAGCCTCAGATAT
GGGAGGAGAATCACCAGGCAGTAGATCATCTAATGCAAAATTGCCCTCAGTTCCAACAGTTGATTCAGTTTCACAAGATCCGGTTTCAAA
TATGAGTATTACAGAGAGGCTTGAACACGCTTTGGAAAAGGCAGCTCCTCTCCTTCGTGAGATTTTTGTGGATTTTGCACCTTTTCTTTC
TCGGACACTTTTGGGTAGCCATGGACAAGAACTGCTTATAGAAGGAACAAGTCTGGTTTGCATGAAGTCGAGTAGTTCAGTTGTGGAATT
GGTTATGCTACTGTGTTCTCAGGAGTGGCAAAATTCTATTCAGAAGAATGCAGGCCTTGCTTTTATCGAACTTGTCAATGAAGGAAGGTT
GCTTAGCCAGACAATGAAGGATCATCTAGTAAGAGTAGCAAATGAAGCTGAATTTATCCTGAGCAGGCAGAGAGCAGAAGATATTCACAG
ACATGCGGAATTTGAGTCACTGTGTGCCCAGTATTCTGCAGACAAACGAGAAGATGAGAAGATGTGTGATCATTTGATAAGAGCAGCAAA
ATATCGTGACCACGTGACAGCAACTCAACTAATCCAGAAAATTATCAACATTCTCACAGACAAGCATGGAGCCTGGGGAAATTCTGCAGT
GAGTCGTCCTCTTGAGTTCTGGCGCCTTGACTACTGGGAAGATGACTTGCGGCGCCGGCGACGATTTGTGCGTAACCCTCTAGGATCGAC
ACATCCTGAAGCGACACTAAAAACAGCCGTGGAACATGCCACAGATGAAGATATCCTTGCTAAAGGAAAACAGTCCATCAGGAGTCAGGC
TTTAGGAAATCAGAACTCAGAAAACGAGATCCTCCTGGAAGGCGATGATGATACTCTGTCATCCGTGGATGAGAAAGATTTAGAGAATCT
TGCCGGTCCTGTTAGCCTGAGCACACCAGCTCAGCTTGTGGCCCCCTCTGTTGTAGTAAAGGGCACTCTTTCTGTCACCTCCTCCGAACT
CTATTTTGAGGTGGATGAAGAGGATCCTAACTTCAAAAAAATCGACCCCAAGATCTTGGCATATACAGAAGGGCTGCATGGAAAATGGCT
GTTCACAGAGATACGATCAATCTTTTCTCGTCGTTATCTTTTGCAAAATACAGCCCTGGAGATCTTTATGGCAAACAGAGTTGCTGTGAT
GTTCAACTTCCCAGACCCTGCAACAGTAAAGAAAGTGGTTAACTATCTACCTCGTGTTGGCGTTGGAACAAGTTTTGGATTGCCTCAAAC
CAGACGTATTTCATTAGCTAGTCCACGTCAGCTTTTTAAGGCTTCTAATATGACCCAGCGATGGCAACACAGAGAGATATCTAATTTTGA
GTACTTGATGTTTCTCAACACGATAGCAGGACGGAGTTATAATGACTTAAATCAGTATCCAGTGTTTCCTTGGGTCATCACTAATTATGA
ATCAGAAGAACTGGATCTTACCTTGCCCACCAACTTCAGAGATTTGTCCAAGCCAATAGGAGCTCTGAACCCAAAAAGAGCAGCATTCTT
CGCTGAGCGTTATGAATCATGGGAAGATGATCAAGTTCCAAAGTTTCACTATGGTACTCATTACTCAACTGCAAGTTTTGTTCTTGCATG
GCTGCTAAGAATAGAACCCTTTACAACTTATTTCCTAAATTTGCAAGGAGGCAAATTTGATCATGCAGATCGAACTTTTTCATCAATTTC
CAGAGCTTGGCGAAACAGTCAGCGTGATACCTCTGATATTAAGGAGTTGATCCCTGAATTTTATTATCTCCCTGAGATGTTTGTCAACTT
CAATAATTATAATCTTGGAGTGATGGATGATGGGACAGTAGTGTCTGATGTCGAACTTCCTCCTTGGGCCAAAACCTCAGAAGAATTTGT
TCACATAAACAGATTGGCCCTGGAGAGTGAATTTGTTTCCTGCCAGCTTCACCAATGGATTGATCTCATTTTTGGCTATAAACAGCAAGG
ACCAGAAGCTGTCCGAGCCCTCAATGTGTTCTATTACTTGACCTATGAAGGAGCTGTCAATCTGAATTCAATAACTGATCCTGTGTTGAG
AGAGGCTGTTGAAGCTCAAATCCGAAGTTTTGGACAGACTCCTTCTCAACTACTCATAGAGCCCCATCCTCCCAGAGGTTCTGCCATGCA
AGTGAGTCCATTGATGTTCACAGACAAAGCCCAGCAGGATGTTATCATGGTCCTCAAGTTTCCCTCCAACTCCCCTGTTACTCACGTGGC
AGCCAACACCCAGCCTGGTTTGGCAACTCCCGCTGTGATCACAGTCACTGCTAACAGGTTATTTGCGGTGAACAAATGGCACAACCTTCC
TGCTCATCAAGGTGCTGTACAAGACCAGCCATACCAGCTGCCAGTGGAAATCGATCCTCTCATAGCCAGCAATACAGGAATGCACAGGAG
GCAAATCACTGACCTTTTAGACCAAAGTATTCAAGTGCATTCCCAGTGCTTTGTCATCACTTCAGACAACCGCTATATTCTCGTCTGTGG
CTTCTGGGATAAAAGTTTCAGAGTCTATTCTACAGACACAGGAAGATTGATCCAAGTGGTGTTTGGCCATTGGGATGTCGTCACTTGCCT
TGCTCGTTCTGAGTCATATATTGGGGGAAATTGCTACATTCTCTCAGGGTCACGTGATGCAACTCTTTTGCTGTGGTATTGGAATGGAAA
ATGCAGTGGGATTGGAGATAACCCAGGCAGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGC
GGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTT
GGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTG
TACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCT
GCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAAT
CCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCG
GTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAAGTACCTGGAGCATCAT
TCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATTGCTATTTTTGTAGTCT
TTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTATATTTTTAGTCATAATG
AGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATGAAGAACATTTCCCATG
CATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATGCTGTAATTTGGGTCCT
GTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGTAAATGTAATTTAAAAC
ATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAGGCTATTTTATTGTGTG
GTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGCACAACAAAACGAAATG
ATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCGGTTTGCCTGTGCCTGG
ACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCGGGTGCTGTATTCAGCA
ACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACGAAACAATGTTATTTGG
TGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTATTGCATAAATAAATTCT
TTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACACTCAGCTCTTCTCTAAA
AGCAAGGATTTGGAATGAACAATTCAGTTTGACAGAAAAAGCTGAATAAAATGGCATCTGTAATTGAATTGTTGGAAATGCCTTTTTTGC

>In-frame_ALDH2_ENST00000261733_chr12_112237867_+_LRBA_ENST00000510413_chr4_151793907_-_9049nt
TCAGTGGCCCTGAGACCCTAGCTCTGCTCTCGGTCCGCTCGCTGTCCGCTAGCCCGCTGCGATGTTGCGCGCTGCCGCCCGCTTCGGGCC
CCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCCAACCAGCAGCCCGAGGTCTTCTGCAACCAGATTTT
CATAAACAATGAATGGCACGATGCCGTCAGCAGGAAAACATTCCCCACCGTCAATCCGTCCACTGGAGAGGTCATCTGTCAGGTAGCTGA
AGGGGACAAGGAAGATGTGGACAAGGCAGTGAAGGCCGCCCGGGCCGCCTTCCAGCTGGGCTCACCTTGGCGCCGCATGGACGCATCACA
CAGGGGCCGGCTGCTGAACCGCCTGGCCGATCTGATCGAGCGGGACCGGACCTACCTGGCGGCCTTGGAGACCCTGGACAATGGCAAGCC
CTATGTCATCTCCTACCTGGTGGATTTGGACATGGTCCTCAAATGTCTCCGGTATTATGCCGGCTGGGCTGATAAGTACCACGGGAAAAC
CATCCCCATTGACGGAGACTTCTTCAGCTACACACGCCATGAACCTGTGGGGGTGTGCGGGCAGATCATTCCGTGGAATTTCCCGCTCCT
GATGCAAGCATGGAAGCTGGGCCCAGCCTTGGCAACTGGAAACGTGGTTGTGATGAAGGTAGCTGAGCAGACACCCCTCACCGCCCTCTA
TGTGGCCAACCTGATCAAGGAGGCTGGCTTTCCCCCTGGTGTGGTCAACATTGTGCCTGGATTTGGCCCCACGGCTGGGGCCGCCATTGC
CTCCCATGAGGATGTGGACAAAGTGGCATTCACAGGCTCCACTGAGATTGGCCGCGTAATCCAGGTTGCTGCTGGGAGCAGCAACCTCAA
GAGAGTGACCTTGGAGCTGGGGGGGAAGAGCCCCAACATCATCATGTCAGATGCCGATATGGATTGGGCCGTGGAACAGGCCCACTTCGC
CCTGTTCTTCAACCAGGGCCAGTGCTGCTGTGCCGGCTCCCGGACCTTCGTGCAGGAGGACATCTATGATGAGTTTGTGGAGCGGAGCGT
TGCCCGGGCCAAGTCTCGGGTGGTCGGGAACCCCTTTGATAGCAAGACCGAGCAGGGGCCGCAGGTGGATGAAACTCAGTTTAAGAAGAT
CCTCGGCTACATCAACACGGGGAAGCAAGAGGGGGCGAAGCTGCTGTGTGGTGGGGGCATTGCTGCTGACCGTGGTTACTTCATCCAGCC
CACTGTGTTTGGAGATGTGCAGGATGGCATGACCATCGCCAAGGAGGAGATCTTCGGGCCAGTGATGCAGATCCTGAAGTTCAAGACCAT
AGAGGAGGTTGTTGGGAGAGCCAACAATTCCACGTACGGGCTGGCCGCAGCTGTCTTCACAAAGGATTTGGACAAGGCCAATTACCTGTC
CCAGGCCCTCCAGGCGGGCACTGTGTGTGTTATCTACAAACTTCTGGCATCGAAAAGTGAAGGAATCAGGGTACAAGCTCTTAAGGCAAT
GGGTTATTTTTTAAAACATCTGGCCCCAAAGAGGAAAGCAGAAGTCATGCTTGGACATGGATTGTTTTCATTGCTAGCTGAAAGGCTCAT
GCTTCAGACAAATTTAATCACAATGACCACATATAATGTGCTGTTTGAGATTCTTATAGAACAGATTGGTACTCAGGTGATACATAAACA
GCATCCAGATCCTGATTCTTCAGTGAAGATACAAAACCCTCAGATACTAAAAGTAATTGCGACCCTACTTCGAAATTCTCCCCAGTGCCC
AGAGAGCATGGAGGTTCGCAGAGCCTTTCTTTCTGACATGATTAAACTTTTTAATAACAGTAGAGAAAACAGGAGGAGCTTGCTACAATG
CTCTGTGTGGCAAGAATGGATGCTTTCTCTCTGCTATTTTAATCCTAAGAATTCAGATGAGCAAAAGATAACAGAAATGGTATACGCCAT
ATTCAGAATCCTGCTTTACCATGCAGTCAAATATGAGTGGGGTGGCTGGCGTGTATGGGTAGACACTTTATCAATCACTCATTCAAAGGT
CACTTTTGAAATACACAAAGAAAACCTTGCCAATATATTTAGGGAACAGCAAGGAAAAGTTGATGAAGAAATAGGGCTGTGTTCTTCAAC
TTCAGTTCAAGCAGCCTCTGGCATTAGAAGGGATATTAATGTTTCAGTAGGATCCCAGCAACCAGATACGAAGGATTCTCCTGTCTGTCC
TCATTTCACCACAAATGGTAATGAAAATTCAAGTATAGAGAAGACAAGTTCACTAGAATCTGCATCTAATATTGAACTGCAAACTACTAA
TACATCTTATGAAGAAATGAAAGCTGAGCAAGAAAATCAGGAGTTACCAGATGAAGGCACTTTGGAAGAAACACTGACAAATGAGACAAG
GAATGCAGATGATTTAGAAGTATCTTCTGACATAATAGAAGCTGTGGCTATTTCCTCTAATTCTTTTATAACAACTGGCAAAGATTCAAT
GACTGTCAGTGAAGTAACTGCTTCTATAAGTTCTCCTTCAGAAGAGGATGCCTCAGAGATGCCAGAATTCTTGGATAAATCTATAGTAGA
GGAAGAGGAAGATGATGATTATGTGGAACTGAAAGTAGAAGGCAGTCCTACTGAGGAAGCTAATCTACCCACAGAGCTCCAAGATAACAG
TTTGTCTCCAGCTGCATCTGAAGCCGGTGAAAAACTGGACATGTTTGGTAATGATGACAAATTAATATTTCAAGAAGGAAAACCTGTTAC
TGAAAAGCAAACTGATACTGAAACTCAAGATTCTAAAGATTCTGGAATTCAGACTATGACAGCATCAGGGTCTTCAGCTATGTCACCAGA
AACTACTGTTTCCCAAATAGCTGTAGAATCAGACCTTGGTCAGATGCTGGAGGAAGGGAAGAAAGCAACTAACCTCACTAGAGAAACCAA
ATTAATTAATGATTGTCATGGTAGTGTCTCTGAGGCTTCTTCTGAGCAAAAGATTGCGAAGTTGGATGTTTCCAATGTTGCTACAGATAC
TGAGAGGCTGGAGTTGAAGGCCAGTCCCAACGTGGAAGCACCTCAACCTCATCGACATGTGCTTGAGATATCAAGGCAACATGAGCAGCC
AGGGCAAGGAATAGCACCAGATGCAGTTAATGGACAAAGGAGGGATTCCAGATCTACTGTGTTTCGTATTCCTGAGTTCAACTGGTCTCA
GATGCATCAACGTTTGCTCACTGATCTATTATTTTCAATAGAAACAGATATACAGATGTGGAGAAGCCATTCAACAAAGACAGTTATGGA
CTTCGTGAATAGCAGTGATAATGTCATCTTTGTACACAACACAATTCATCTCATCTCTCAAGTGATGGACAATATGGTCATGGCTTGTGG
GGGTATACTGCCATTGCTTTCAGCTGCTACATCGGCTACACATGAACTGGAAAATATTGAACCTACTCAAGGCCTTTCAATAGAAGCCTC
TGTGACATTTTTGCAGAGGCTAATTAGCCTTGTGGATGTGCTTATATTTGCAAGTTCTCTTGGCTTTACTGAAATTGAAGCTGAAAAAAG
TATGTCATCTGGAGGAATTTTGCGGCAGTGTCTCCGACTAGTTTGTGCAGTCGCAGTAAGGAATTGCTTGGAGTGTCAACAGCATTCACA
ACTGAAAACTAGGGGAGATAAAGCCTTGAAACCAATGCATAGCCTTATTCCTTTAGGGAAATCTGCAGCGAAGAGCCCAGTGGACATTGT
GACTGGCGGTATATCTCCAGTAAGAGATCTTGACAGGCTTCTACAGGACATGGATATTAATCGGCTTAGGGCAGTTGTTTTCAGAGACAT
AGAGGATAGCAAACAAGCTCAATTTTTAGCCTTGGCAGTAGTATACTTTATCTCTGTTCTTATGGTCTCCAAGTACAGAGACATTTTGGA
ACCCCAAAATGAAAGGCATAGCCAGTCATGTACAGAAACTGGCAGTGAAAATGAGAATGTATCACTCTCTGAAATCACACCAGCAGCATT
CAGCACTTTAACTACGGCATCAGTGGAAGAATCTGAAAGCACATCATCTGCTCGAAGGAGGGACTCAGGCATTGGGGAAGAAACAGCCAC
TGGTTTAGGAAGCCATGTGGAAGTAACTCCTCACACAGCACCTCCTGGTGTCAGTGCAGGCCCAGATGCAATCAGCGAGGTGCTATCTAC
TCTTTCTTTAGAAGTCAATAAGTCTCCGGAAACCAAAAATGATAGAGGAAATGACTTGGACACTAAGGCTACACCGTCAGTTTCAGTTTC
AAAAAACGTCAATGTGAAAGACATTCTCCGAAGCTTGGTTAACATACCAGCAGATGGAGTCACAGTGGATCCTGCCCTTCTGCCACCAGC
CTGCCTTGGAGCCCTTGGTGATCTATCTGTGGAACAACCCGTGCAGTTCAGATCTTTTGACAGAAGTGTCATTGTTGCAGCAAAAAAGTC
AGCAGTCTCACCTTCCACCTTTAATACAAGCATACCTACCAATGCTGTCAGTGTGGTTTCCTCAGTAGATTCAGCCCAAGCCTCAGATAT
GGGAGGAGAATCACCAGGCAGTAGATCATCTAATGCAAAATTGCCCTCAGTTCCAACAGTTGATTCAGTTTCACAAGATCCGGTTTCAAA
TATGAGTATTACAGAGAGGCTTGAACACGCTTTGGAAAAGGCAGCTCCTCTCCTTCGTGAGATTTTTGTGGATTTTGCACCTTTTCTTTC
TCGGACACTTTTGGGTAGCCATGGACAAGAACTGCTTATAGAAGGAACAAGTCTGGTTTGCATGAAGTCGAGTAGTTCAGTTGTGGAATT
GGTTATGCTACTGTGTTCTCAGGAGTGGCAAAATTCTATTCAGAAGAATGCAGGCCTTGCTTTTATCGAACTTGTCAATGAAGGAAGGTT
GCTTAGCCAGACAATGAAGGATCATCTAGTAAGAGTAGCAAATGAAGCTGAATTTATCCTGAGCAGGCAGAGAGCAGAAGATATTCACAG
ACATGCGGAATTTGAGTCACTGTGTGCCCAGTATTCTGCAGACAAACGAGAAGATGAGAAGATGTGTGATCATTTGATAAGAGCAGCAAA
ATATCGTGACCACGTGACAGCAACTCAACTAATCCAGAAAATTATCAACATTCTCACAGACAAGCATGGAGCCTGGGGAAATTCTGCAGT
GAGTCGTCCTCTTGAGTTCTGGCGCCTTGACTACTGGGAAGATGACTTGCGGCGCCGGCGACGATTTGTGCGTAACCCTCTAGGATCGAC
ACATCCTGAAGCGACACTAAAAACAGCCGTGGAACATGCCACAGATGAAGATATCCTTGCTAAAGGAAAACAGTCCATCAGGAGTCAGGC
TTTAGGAAATCAGAACTCAGAAAACGAGATCCTCCTGGAAGGCGATGATGATACTCTGTCATCCGTGGATGAGAAAGATTTAGAGAATCT
TGCCGGTCCTGTTAGCCTGAGCACACCAGCTCAGCTTGTGGCCCCCTCTGTTGTAGTAAAGGGCACTCTTTCTGTCACCTCCTCCGAACT
CTATTTTGAGGTGGATGAAGAGGATCCTAACTTCAAAAAAATCGACCCCAAGATCTTGGCATATACAGAAGGGCTGCATGGAAAATGGCT
GTTCACAGAGATACGATCAATCTTTTCTCGTCGTTATCTTTTGCAAAATACAGCCCTGGAGATCTTTATGGCAAACAGAGTTGCTGTGAT
GTTCAACTTCCCAGACCCTGCAACAGTAAAGAAAGTGGTTAACTATCTACCTCGTGTTGGCGTTGGAACAAGTTTTGGATTGCCTCAAAC
CAGACGTATTTCATTAGCTAGTCCACGTCAGCTTTTTAAGGCTTCTAATATGACCCAGCGATGGCAACACAGAGAGATATCTAATTTTGA
GTACTTGATGTTTCTCAACACGATAGCAGGACGGAGTTATAATGACTTAAATCAGTATCCAGTGTTTCCTTGGGTCATCACTAATTATGA
ATCAGAAGAACTGGATCTTACCTTGCCCACCAACTTCAGAGATTTGTCCAAGCCAATAGGAGCTCTGAACCCAAAAAGAGCAGCATTCTT
CGCTGAGCGTTATGAATCATGGGAAGATGATCAAGTTCCAAAGTTTCACTATGGTACTCATTACTCAACTGCAAGTTTTGTTCTTGCATG
GCTGCTAAGAATAGAACCCTTTACAACTTATTTCCTAAATTTGCAAGGAGGCAAATTTGATCATGCAGATCGAACTTTTTCATCAATTTC
CAGAGCTTGGCGAAACAGTCAGCGTGATACCTCTGATATTAAGGAGTTGATCCCTGAATTTTATTATCTCCCTGAGATGTTTGTCAACTT
CAATAATTATAATCTTGGAGTGATGGATGATGGGACAGTAGTGTCTGATGTCGAACTTCCTCCTTGGGCCAAAACCTCAGAAGAATTTGT
TCACATAAACAGATTGGCCCTGGAGAGTGAATTTGTTTCCTGCCAGCTTCACCAATGGATTGATCTCATTTTTGGCTATAAACAGCAAGG
ACCAGAAGCTGTCCGAGCCCTCAATGTGTTCTATTACTTGACCTATGAAGGAGCTGTCAATCTGAATTCAATAACTGATCCTGTGTTGAG
AGAGGCTGTTGAAGCTCAAATCCGAAGTTTTGGACAGACTCCTTCTCAACTACTCATAGAGCCCCATCCTCCCAGAGGTTCTGCCATGCA
AGTGAGTCCATTGATGTTCACAGACAAAGCCCAGCAGGATGTTATCATGGTCCTCAAGTTTCCCTCCAACTCCCCTGTTACTCACGTGGC
AGCCAACACCCAGCCTGGTTTGGCAACTCCCGCTGTGATCACAGTCACTGCTAACAGGTTATTTGCGGTGAACAAATGGCACAACCTTCC
TGCTCATCAAGGTGCTGTACAAGACCAGCCATACCAGCTGCCAGTGGAAATCGATCCTCTCATAGCCAGCAATACAGGAATGCACAGGAG
GCAAATCACTGACCTTTTAGACCAAAGTATTCAAGTGCATTCCCAGTGCTTTGTCATCACTTCAGACAACCGCTATATTCTCGTCTGTGG
CTTCTGGGATAAAAGTTTCAGAGTCTATTCTACAGACACAGGAAGATTGATCCAAGTGGTGTTTGGCCATTGGGATGTCGTCACTTGCCT
TGCTCGTTCTGAGTCATATATTGGGGGAAATTGCTACATTCTCTCAGGGTCACGTGATGCAACTCTTTTGCTGTGGTATTGGAATGGAAA
ATGCAGTGGGATTGGAGATAACCCAGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGT
GTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGA
GGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTAC
ATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCT
CACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCG
GGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCGGTG
GCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAAGTACCTGGAGCATCATTCT
CTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATTGCTATTTTTGTAGTCTTTG
CTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTATATTTTTAGTCATAATGAGA
AGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATGAAGAACATTTCCCATGCAT
CTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATGCTGTAATTTGGGTCCTGTA
TTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGTAAATGTAATTTAAAACATC
TCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAGGCTATTTTATTGTGTGGTT
AGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGCACAACAAAACGAAATGATG
GAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCGGTTTGCCTGTGCCTGGACA
ATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCGGGTGCTGTATTCAGCAACA
CCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACGAAACAATGTTATTTGGTGG
TGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTATTGCATAAATAAATTCTTTG
TATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACACTCAGCTCTTCTCTAAAAGC


Top

FusionGenePPI for ALDH2_LRBA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ALDH2UNC119, SLC35F6, IGSF21, CRMP1, C14orf1, EIF6, HSPE1, HSPD1, UBA5, ICT1, CUL3, APP, ALDH1A1, RPL13A, SERPINB5, IGKC, ALDH1A2, ALDH6A1, FGB, SERPINA1, TF, FGG, IGHG1, IGHG3, IGHG4, APOA1, FGA, CALML5, BTRC, LDHA, LDHAL6A, LDHB, RPE, SOD2, ESD, PDCD6IP, PGM1, UQCRC2, NTRK1, HSPB2, IGHA1, RPL11, ARID1A, XRCC3, ATAD5, APC, PHB2, RAD23B, SIRT3LRBATUSC2, NOTCH1, FN1, BAG3, CAST, KIF15, DCAF11, INPPL1, MLF2, VCP, MOV10, RIC3, CT55, PARP16, RD3, TMEM52B, MED4, TMEM17, TMEM216, NCR3LG1, PVR, FAM196A, EPHA1, GYPB, DLK2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ALDH2_LRBA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneALDH2P05091DB00822DisulfiramAldehyde dehydrogenase, mitochondrialsmall moleculeapproved

Top

RelatedDiseases for ALDH2_LRBA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneALDH2C0001973Alcoholic Intoxication, Chronic7CTD_human;PSYGENET
HgeneALDH2C0001969Alcoholic Intoxication5PSYGENET
HgeneALDH2C0085762Alcohol abuse5PSYGENET
HgeneALDH2C0393756Hangover from alcohol4PSYGENET
HgeneALDH2C0236664Alcohol-Related Disorders3PSYGENET
HgeneALDH2C0004096Asthma2CTD_human
HgeneALDH2C0005586Bipolar Disorder2PSYGENET
HgeneALDH2C0279626Squamous cell carcinoma of esophagus2CTD_human
HgeneALDH2C0009404Colorectal Neoplasms1CTD_human
HgeneALDH2C0014859Esophageal Neoplasms1CTD_human
HgeneALDH2C0016382Flushing1CTD_human
HgeneALDH2C0021364Male infertility1CTD_human
HgeneALDH2C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneALDH2C0028796Dermatitis, Occupational1CTD_human
HgeneALDH2C0032927Precancerous Conditions1CTD_human
HgeneALDH2C0042373Vascular Diseases1CTD_human
HgeneALDH2C0242973Ventricular Dysfunction1CTD_human
HgeneALDH2C0342257Complications of Diabetes Mellitus1CTD_human
HgeneALDH2C0349464Wernicke-Korsakoff Syndrome1PSYGENET
HgeneALDH2C0520459Necrotizing Enterocolitis1CTD_human
HgeneALDH2C2674838ALCOHOL SENSITIVITY, ACUTE1CTD_human
TgeneLRBAC3553512IMMUNODEFICIENCY, COMMON VARIABLE, 8, WITH AUTOIMMUNITY1ORPHANET;UNIPROT