FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14494

FusionGeneSummary for GBF1_WBP1L

check button Fusion gene summary
Fusion gene informationFusion gene name: GBF1_WBP1L
Fusion gene ID: 14494
HgeneTgene
Gene symbol

GBF1

WBP1L

Gene ID

80142

54838

Gene nameprostaglandin E synthase 2WW domain binding protein 1 like
SynonymsC9orf15|GBF-1|GBF1|PGES2|mPGES-2C10orf26|OPA1L|OPAL1
Cytomap

9q34.11

10q24.32

Type of geneprotein-codingprotein-coding
Descriptionprostaglandin E synthase 2GATE-binding factor 1gamma-interferon-activated transcriptional element-binding factor 1mPGE synthase-2membrane-associated prostaglandin E synthase 2microsomal prostaglandin E synthase-2prostaglandin-H(2) E-isomeraseWW domain binding protein 1-likeoutcome predictor in acute leukemia 1
Modification date2018051920180519
UniProtAcc

Q92538

Q9NX94

Ensembl transtripts involved in fusion geneENST00000369983, ENST00000476019, 
ENST00000448841, ENST00000369889, 
Fusion gene scores* DoF score11 X 7 X 8=6166 X 6 X 4=144
# samples 128
** MAII scorelog2(12/616*10)=-2.35989594508638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/144*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: GBF1 [Title/Abstract] AND WBP1L [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-G9-6364-01AGBF1chr10

104103939

+WBP1Lchr10

104569650

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000369983ENST00000448841GBF1chr10

104103939

+WBP1Lchr10

104569650

+
In-frameENST00000369983ENST00000369889GBF1chr10

104103939

+WBP1Lchr10

104569650

+
intron-3CDSENST00000476019ENST00000448841GBF1chr10

104103939

+WBP1Lchr10

104569650

+
intron-3CDSENST00000476019ENST00000369889GBF1chr10

104103939

+WBP1Lchr10

104569650

+

Top

FusionProtFeatures for GBF1_WBP1L


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GBF1

Q92538

WBP1L

Q9NX94

Guanine-nucleotide exchange factor (GEF) for members ofthe Arf family of small GTPases involved in trafficking in theearly secretory pathway; its GEF activity initiates the coating ofnascent vesicles via the localized generation of activated ARFsthrough replacement of GDP with GTP. Recruitment to cis-Golgimembranes requires membrane association of Arf-GDP and can beregulated by ARF1, ARF3, ARF4 and ARF5. Involved in therecruitment of the COPI coat complex to the endoplasmic reticulumexit sites (ERES), and the endoplasmic reticulum-Golgiintermediate (ERGIC) and cis-Golgi compartments which implicatesARF1 activation. Involved in COPI vesicle-dependent retrogradetransport from the ERGIC and cis-Golgi compartments to theendoplasmic reticulum (ER) (PubMed:16926190, PubMed:17956946,PubMed:18003980, PubMed:12047556, PubMed:12808027,PubMed:19039328, PubMed:24213530). Involved in the trans-Golginetwork recruitment of GGA1, GGA2, GGA3, BIG1, BIG2, and the AP-1adaptor protein complex related to chlathrin-dependent transport;the function requires its GEF activity (probably at least in parton ARF4 and ARF5) (PubMed:23386609). Has GEF activity towards ARF1(PubMed:15616190). Has in vitro GEF activity towards ARF5 (Bysimilarity). Involved in the processing of PSAP (PubMed:17666033).Required for the assembly of the Golgi apparatus (PubMed:12808027,PubMed:18003980). The AMPK-phosphorylated form is involved inGolgi disassembly during mitotis and under stress conditions(PubMed:18063581, PubMed:23418352). May be involved in the COPIvesicle-dependent recruitment of PNPLA2 to lipid droplets;however, this function is under debate (PubMed:19461073,PubMed:22185782). In neutrophils, involved in G protein-coupledreceptor (GPCR)-mediated chemotaxis und superoxide production.Proposed to be recruited by phosphatidylinositol-phosphatesgenerated upon GPCR stimulation to the leading edge where itrecruits and activates ARF1, and is involved in recruitment ofGIT2 and the NADPH oxidase complex (PubMed:22573891).{ECO:0000250|UniProtKB:Q9R1D7, ECO:0000269|PubMed:12047556,ECO:0000269|PubMed:12808027, ECO:0000269|PubMed:15616190,ECO:0000269|PubMed:16926190, ECO:0000269|PubMed:17666033,ECO:0000269|PubMed:17956946, ECO:0000269|PubMed:18003980,ECO:0000269|PubMed:18063581, ECO:0000269|PubMed:19461073,ECO:0000269|PubMed:22185782, ECO:0000269|PubMed:22573891,ECO:0000269|PubMed:23386609, ECO:0000269|PubMed:23418352,ECO:0000269|PubMed:24213530, ECO:0000305|PubMed:19039328,ECO:0000305|PubMed:22573891}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneWBP1Lchr10:104103939chr10:104569650ENST00000369889+14101_18343343Compositional biasNote=Pro-rich
TgeneWBP1Lchr10:104103939chr10:104569650ENST00000369889+14335_34243343Compositional biasNote=Poly-Ser
TgeneWBP1Lchr10:104103939chr10:104569650ENST00000448841+14101_18364364Compositional biasNote=Pro-rich
TgeneWBP1Lchr10:104103939chr10:104569650ENST00000448841+14335_34264364Compositional biasNote=Poly-Ser
TgeneWBP1Lchr10:104103939chr10:104569650ENST00000369889+1442_6243343TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGBF1chr10:104103939chr10:104569650ENST00000369983+4401751_1854981860Compositional biasNote=Pro-rich
HgeneGBF1chr10:104103939chr10:104569650ENST00000369983+440692_882981860DomainSEC7
HgeneGBF1chr10:104103939chr10:104569650ENST00000369983+440886_1370981860RegionPhosphatidylinositol-phosphate binding%3B required for translocation to the leading edge and for ARF1 activation upon GPCR signaling
TgeneWBP1Lchr10:104103939chr10:104569650ENST00000448841+1442_6264364TransmembraneHelical


Top

FusionGeneSequence for GBF1_WBP1L


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GBF1_ENST00000369983_chr10_104103939_+_WBP1L_ENST00000448841_chr10_104569650_+_398aa
MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVN
KFLSYALIGFWLVWTIIIILSCCCVCHHRRAKHRLQAQQRQHEINLIAYREAHNYSALPFYFRFLPNYLLPPYEEVVNRPPTPPPPYSAF
QLQQQQLLPPQCGPAGGSPPGIDPTRGSQGAQSSPLSEPSRSSTRPPSIADPDPSDLPVDRAATKAPGMEPSGSVAGLGELDPGAFLDKD
AECREELLKDDSSEHGAPDSKEKTPGRHRRFTGDSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLCQSSEE

>In-frame_GBF1_ENST00000369983_chr10_104103939_+_WBP1L_ENST00000369889_chr10_104569650_+_398aa
MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVN
KFLSYALIGFWLVWTIIIILSCCCVCHHRRAKHRLQAQQRQHEINLIAYREAHNYSALPFYFRFLPNYLLPPYEEVVNRPPTPPPPYSAF
QLQQQQLLPPQCGPAGGSPPGIDPTRGSQGAQSSPLSEPSRSSTRPPSIADPDPSDLPVDRAATKAPGMEPSGSVAGLGELDPGAFLDKD
AECREELLKDDSSEHGAPDSKEKTPGRHRRFTGDSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLCQSSEE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GBF1_ENST00000369983_chr10_104103939_+_WBP1L_ENST00000448841_chr10_104569650_+_1194nt
ATGGTGGATAAGAATATTTACATCATTCAAGGGGAGATTAACATTGTGGTTGGGGCCATCAAACGAAATGCCCGATGGAGCACCCATACA
CCACTGGATGAAGAACGGGATCCTCTGCTGCATAGTTTCGGTCATCTAAAGGAGGTTTTAAACAGTATAACAGAACTCTCAGAAATTGAG
CCCAATGTATTCCTTCGACCTTTTCTGGAAGTGATTCGCTCTGAAGATACCACTGGCCCTATCACTGGACTGGCACTCACCTCTGTCAAC
AAGTTCCTGTCCTATGCACTCATAGGGTTCTGGCTGGTGTGGACCATCATCATCATCCTGAGCTGCTGCTGTGTTTGCCACCACCGCCGA
GCCAAGCACCGCCTTCAGGCCCAGCAGCGGCAACATGAAATCAACCTGATCGCTTACCGAGAAGCCCACAATTACTCAGCGCTGCCATTT
TATTTCAGGTTTTTGCCAAACTATTTACTACCTCCTTATGAGGAAGTGGTGAACCGACCTCCAACTCCTCCCCCACCATACAGTGCCTTC
CAGCTACAGCAGCAGCAGCTGCTGCCTCCACAGTGTGGCCCTGCAGGTGGCAGTCCCCCGGGCATCGATCCCACCAGGGGATCCCAGGGG
GCACAGAGCAGCCCCTTGTCTGAGCCCAGCAGAAGCAGCACAAGACCCCCAAGCATCGCTGACCCTGATCCCTCTGACCTACCAGTTGAC
CGAGCAGCCACCAAAGCCCCAGGGATGGAGCCCAGTGGCTCTGTGGCTGGCCTGGGGGAGCTGGACCCGGGGGCCTTCCTGGACAAAGAT
GCAGAATGTAGGGAGGAGCTGCTGAAAGATGACAGCTCTGAACACGGCGCACCCGACAGCAAAGAGAAGACGCCTGGGAGACATCGCCGC
TTCACAGGTGACTCGGGCATTGAAGTGTGTGTGTGCAACCGGGGCCACCATGACGATGACCTCAAAGAGTTCAACACACTCATCGATGAT
GCTCTGGATGGGCCCCTGGACTTCTGCGACAGCTGCCATGTGCGGCCCCCTGGTGATGAGGAGGAAGGCCTCTGTCAGTCCTCTGAGGAG
CAGGCTCGAGAGCCTGGGCACCCGCACCTGCCACGGCCGCCCGCATGCCTGCTGCTGAACACCATCAACGAGCAGGACTCTCCCAACTCC

>In-frame_GBF1_ENST00000369983_chr10_104103939_+_WBP1L_ENST00000369889_chr10_104569650_+_1194nt
ATGGTGGATAAGAATATTTACATCATTCAAGGGGAGATTAACATTGTGGTTGGGGCCATCAAACGAAATGCCCGATGGAGCACCCATACA
CCACTGGATGAAGAACGGGATCCTCTGCTGCATAGTTTCGGTCATCTAAAGGAGGTTTTAAACAGTATAACAGAACTCTCAGAAATTGAG
CCCAATGTATTCCTTCGACCTTTTCTGGAAGTGATTCGCTCTGAAGATACCACTGGCCCTATCACTGGACTGGCACTCACCTCTGTCAAC
AAGTTCCTGTCCTATGCACTCATAGGGTTCTGGCTGGTGTGGACCATCATCATCATCCTGAGCTGCTGCTGTGTTTGCCACCACCGCCGA
GCCAAGCACCGCCTTCAGGCCCAGCAGCGGCAACATGAAATCAACCTGATCGCTTACCGAGAAGCCCACAATTACTCAGCGCTGCCATTT
TATTTCAGGTTTTTGCCAAACTATTTACTACCTCCTTATGAGGAAGTGGTGAACCGACCTCCAACTCCTCCCCCACCATACAGTGCCTTC
CAGCTACAGCAGCAGCAGCTGCTGCCTCCACAGTGTGGCCCTGCAGGTGGCAGTCCCCCGGGCATCGATCCCACCAGGGGATCCCAGGGG
GCACAGAGCAGCCCCTTGTCTGAGCCCAGCAGAAGCAGCACAAGACCCCCAAGCATCGCTGACCCTGATCCCTCTGACCTACCAGTTGAC
CGAGCAGCCACCAAAGCCCCAGGGATGGAGCCCAGTGGCTCTGTGGCTGGCCTGGGGGAGCTGGACCCGGGGGCCTTCCTGGACAAAGAT
GCAGAATGTAGGGAGGAGCTGCTGAAAGATGACAGCTCTGAACACGGCGCACCCGACAGCAAAGAGAAGACGCCTGGGAGACATCGCCGC
TTCACAGGTGACTCGGGCATTGAAGTGTGTGTGTGCAACCGGGGCCACCATGACGATGACCTCAAAGAGTTCAACACACTCATCGATGAT
GCTCTGGATGGGCCCCTGGACTTCTGCGACAGCTGCCATGTGCGGCCCCCTGGTGATGAGGAGGAAGGCCTCTGTCAGTCCTCTGAGGAG
CAGGCTCGAGAGCCTGGGCACCCGCACCTGCCACGGCCGCCCGCATGCCTGCTGCTGAACACCATCAACGAGCAGGACTCTCCCAACTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_GBF1_ENST00000369983_chr10_104103939_+_WBP1L_ENST00000448841_chr10_104569650_+_4363nt
AGTTACCACGTCAGTGAGCTGACAGGGAAGGTACCCGGCTCTACTGCCCGTCCCGGACGACTCATCCTGGCGGACTGTGCAGTCCCACCC
TGACTTCGGCCTCAATTTCCAGGAAACAGGCTCCTTCTCTTCTCCCATCTGCTACCAGAGCCGGGAGAGCTGCTCGGAGACGCCTCCGGG
GTGCGGGCTGGACATGAGCAGCGGCTGCCGGTCCTGGGACTAGGCCCCGCCATTTTGGATCCGCTGACAGGTTTGCCAAGATGGTGGATA
AGAATATTTACATCATTCAAGGGGAGATTAACATTGTGGTTGGGGCCATCAAACGAAATGCCCGATGGAGCACCCATACACCACTGGATG
AAGAACGGGATCCTCTGCTGCATAGTTTCGGTCATCTAAAGGAGGTTTTAAACAGTATAACAGAACTCTCAGAAATTGAGCCCAATGTAT
TCCTTCGACCTTTTCTGGAAGTGATTCGCTCTGAAGATACCACTGGCCCTATCACTGGACTGGCACTCACCTCTGTCAACAAGTTCCTGT
CCTATGCACTCATAGGGTTCTGGCTGGTGTGGACCATCATCATCATCCTGAGCTGCTGCTGTGTTTGCCACCACCGCCGAGCCAAGCACC
GCCTTCAGGCCCAGCAGCGGCAACATGAAATCAACCTGATCGCTTACCGAGAAGCCCACAATTACTCAGCGCTGCCATTTTATTTCAGGT
TTTTGCCAAACTATTTACTACCTCCTTATGAGGAAGTGGTGAACCGACCTCCAACTCCTCCCCCACCATACAGTGCCTTCCAGCTACAGC
AGCAGCAGCTGCTGCCTCCACAGTGTGGCCCTGCAGGTGGCAGTCCCCCGGGCATCGATCCCACCAGGGGATCCCAGGGGGCACAGAGCA
GCCCCTTGTCTGAGCCCAGCAGAAGCAGCACAAGACCCCCAAGCATCGCTGACCCTGATCCCTCTGACCTACCAGTTGACCGAGCAGCCA
CCAAAGCCCCAGGGATGGAGCCCAGTGGCTCTGTGGCTGGCCTGGGGGAGCTGGACCCGGGGGCCTTCCTGGACAAAGATGCAGAATGTA
GGGAGGAGCTGCTGAAAGATGACAGCTCTGAACACGGCGCACCCGACAGCAAAGAGAAGACGCCTGGGAGACATCGCCGCTTCACAGGTG
ACTCGGGCATTGAAGTGTGTGTGTGCAACCGGGGCCACCATGACGATGACCTCAAAGAGTTCAACACACTCATCGATGATGCTCTGGATG
GGCCCCTGGACTTCTGCGACAGCTGCCATGTGCGGCCCCCTGGTGATGAGGAGGAAGGCCTCTGTCAGTCCTCTGAGGAGCAGGCTCGAG
AGCCTGGGCACCCGCACCTGCCACGGCCGCCCGCATGCCTGCTGCTGAACACCATCAACGAGCAGGACTCTCCCAACTCCCAGAGCAGCA
GCTCCCCCAGCTAGAGCAGGTCCTGCCAGCACCCAGCAACTTGGCAAAGCAACCAGGGTAGGGGAGAACCACGAGAGAAGCATTAAGTGA
CTTTCAAAGACTTTCAGAGTACAGCCACTTGGTTCCTTTTTGTTTGTTTTCCTTCTCCTCTCCTGCATTTTCCTCCATCTCCAGGTACAG
TTCGGGGTGTGGATGCCTCTTCCTCCACAAGGGCACAGTGTTGTGGAGGGCTAAGTTGGTTCTGTGACTCATTCCTCATACCCTAACTCC
ATCTCCTTTCTTTAAAGTCAAATCTCACCTACCTGTTTGGGTCAGAGAGATGTGTTTTAAAAGCCCCCAAGGAAGGAGGCTGGGACTGTG
CCCTGACATGATTCTTGGTGATGGAATAGGTTTGTGCTCTGATTCTAGTTTAAGAGAACGTTGCTGTATCTCAGTCCAGGAGAGGCAGCC
CATCTTGGCCCTGGATGAAGAAGGAAACCCACAGAGGCCCAGGGCTTGTCATTGGGCTGCCAGTGTCTGCCAAGCCAGCATTGAGCTAAT
CCTGTGGGAGGATGAGAGCTACTGGGCCGTTGTATGATAGGTTGGTAGGGGCTTGTTGATCTGTCAAATTCCAGGTGACAAGATCTATGC
ACCCCATGCGTCCTTGAGGGGCCTCTTCCCCGCAGGCTCTGGCTGGCCGCAGGCTGGTTCTGGTGTGAAAGGTTATACTGCCTTTTCTTT
GTTTGTTTGTTTTTTTCTCTAAAAACAAACAGCAAAAGACAGCTGAAAACAAGAACTTCACCGGTGGGCAGGCAAGAATTCTCTTCTGGA
AAATGACGTTTGTGGCTCTTTCCCAAGTTGGCCTTCAAAGAGCCTGCCTGCTGTTGAGCCAGAAGATGTCTCGTGTGAAGGCTGGGGTGG
CGGCTGTCTTGGAACCTCTGTGAGCAGGAGGCCCTAAGCCGCAGCAGTGGATAGAGGTGCAGCTCTCTGCCTCTCTGCCCTTTGGTCTGT
GTTCACAGGTGACCCGTGTCAGCCTGCATCGCAAGCACACACCCTGCGGGCCTTCAAGTCTCACTGTTCCGTATGAGGAAACAGACAGCG
GACTGAGGAAGCGATGGCCCCAGAGAAAGGGCCCCTGTAGCCTGGCTCTCACACAGTATTTTATCTTTGATTCTGAATAAATATTTTTTG
TGGGGTTTTTTTTTTTTTTTTGGTGGCAGTTGTTTGTTTTAAACTGACCACTTGGAAGAAACACCTTGGTTATCTGTGGTTTTCATGCCT
TGTCCCTGCCTCTACCCCCACCCCTTTTGAGTCGGGTGACTCATTTTTCTGTGTAGAGACTCGGTGGCCCAGGCAGGAGGTGAAAGCAGC
CATCCGGAAGGCCCTGGGGACCCTTGTGCCTGTTGCTCGCCTTCAGGTCACCAGCTGAGCTGCGATAGGAAAATCTGAATGGAGGCAGCA
AACAGCCAAAACAAACATTCCCCACCCGGCCCTGTGCATATGAAGTCTTTCTTCCCCCAACTCTTGAACGATGATGATATTCAGACGAAG
CATTGATGTTATGGAAGAAAGAAAGAAACAAACAAAATATATATATATATGTCCAAAAACAGACAAATCCAAGGGTGTGAGGTAAACGAG
TGTCTGCATTTAGATTCCACAAAACCAAAATCCATGTTGAACAAAGTTAAGTCCGTACACAGTGACTTTTTGGGTGAGCCGTGTGTGTCT
GTCTGTTGTGTGTGTGCCTCAAGCCCTGTTTTCCTGTGAAGATACTTTGAGTGGCAGCCATTCTCTCCACGTGAACCACACGTCTGGAGC
ACAGACAGGCCTCTCAAGGTCATTGATCTTACGCATTTACTGTTTACCGAACAAATGTCTGACTGTGTACTCGGGTGTACTCCGCAGCAT
TGTCGACTGCAGTCCCCTGTGTTTGCCAGAGATACTGTGCTCGAAGTAGAGGTTTTACTCTACTCATCACTGCGATTTGCACATTGCTCC
GTGGACACTCGGAGGCCTGCGTTCTGTTCCCTATAAATGGAAGCGTGCTCTGAGCCTGTCTGCCTCCCTCGGCTGCTGCTGGTCCTCAGT
ACCAGCGCCCGGGGGTGTCCACAACCACTTGGGACAGAAGAAGGTGGAATTTCAGACAGAAGCTTGACTGGGTCTTCAATGACAGGCTTG
GACTAGCTGTGGCCCAGACATCGGCCCTGCCCAGAATTGCCAGGAGGAGGCTTTGCAGGCTCTAGAGGAGCCGCAGGGCCTGCCTGCCTC
TGGTGAGTCCAACAGGCACAAGCAAGCTGGCGTGTGGCCAGAGGTAGCCGGAGTGTGTCACAGCCCCTCAGATGCCTTTCCTTCCACCTT
TTTTTATTTTTTAAGAATCCCAAATAACTCACTGAAGTGTCTCAAAGGCGAACAAGTTTTACCAAAATGAATCCTTTTTCAGTTAACAGA
TCAAATGGATGAGTTCTGAGCCTCTCAAGTTCCTTTCCCCAGTTAGAGTGGGGAACTGGGCAAGTGTTAACTGTGGGACTCACTGCAGCG
TCCTATCCTAAAGGCACGAGAAGACGGAAATGCAACCTGCGGAGCTGGGCTTGGTTCCCAGGTCACAGTTTGGCCCCCGCTACAGGATGC
TGCCCTGCTCAGAGAGAGATTTAATAGGGAGCTGAAGGAATCGTTAGGGGGCCAGGGAGATGTGACTGAGGCTGGCTTTCCACGTGAATG
AGACGGGGTCGGTGGAGGGTTTGGTGCTACAGCCAGTCAGAAGATTTGCAAATGCGAACACATTCCTGTGTGAGGCACGTTACCCTTTGT
CAGTTATTGTGAATATGTGTATTTTAAGCAATAAGATTCAGCTGGTCAGACTTTTCTGGGCAGTCTCAGTGACGCATTTCCTGTGCTGTG

>In-frame_GBF1_ENST00000369983_chr10_104103939_+_WBP1L_ENST00000369889_chr10_104569650_+_4387nt
AGTTACCACGTCAGTGAGCTGACAGGGAAGGTACCCGGCTCTACTGCCCGTCCCGGACGACTCATCCTGGCGGACTGTGCAGTCCCACCC
TGACTTCGGCCTCAATTTCCAGGAAACAGGCTCCTTCTCTTCTCCCATCTGCTACCAGAGCCGGGAGAGCTGCTCGGAGACGCCTCCGGG
GTGCGGGCTGGACATGAGCAGCGGCTGCCGGTCCTGGGACTAGGCCCCGCCATTTTGGATCCGCTGACAGGTTTGCCAAGATGGTGGATA
AGAATATTTACATCATTCAAGGGGAGATTAACATTGTGGTTGGGGCCATCAAACGAAATGCCCGATGGAGCACCCATACACCACTGGATG
AAGAACGGGATCCTCTGCTGCATAGTTTCGGTCATCTAAAGGAGGTTTTAAACAGTATAACAGAACTCTCAGAAATTGAGCCCAATGTAT
TCCTTCGACCTTTTCTGGAAGTGATTCGCTCTGAAGATACCACTGGCCCTATCACTGGACTGGCACTCACCTCTGTCAACAAGTTCCTGT
CCTATGCACTCATAGGGTTCTGGCTGGTGTGGACCATCATCATCATCCTGAGCTGCTGCTGTGTTTGCCACCACCGCCGAGCCAAGCACC
GCCTTCAGGCCCAGCAGCGGCAACATGAAATCAACCTGATCGCTTACCGAGAAGCCCACAATTACTCAGCGCTGCCATTTTATTTCAGGT
TTTTGCCAAACTATTTACTACCTCCTTATGAGGAAGTGGTGAACCGACCTCCAACTCCTCCCCCACCATACAGTGCCTTCCAGCTACAGC
AGCAGCAGCTGCTGCCTCCACAGTGTGGCCCTGCAGGTGGCAGTCCCCCGGGCATCGATCCCACCAGGGGATCCCAGGGGGCACAGAGCA
GCCCCTTGTCTGAGCCCAGCAGAAGCAGCACAAGACCCCCAAGCATCGCTGACCCTGATCCCTCTGACCTACCAGTTGACCGAGCAGCCA
CCAAAGCCCCAGGGATGGAGCCCAGTGGCTCTGTGGCTGGCCTGGGGGAGCTGGACCCGGGGGCCTTCCTGGACAAAGATGCAGAATGTA
GGGAGGAGCTGCTGAAAGATGACAGCTCTGAACACGGCGCACCCGACAGCAAAGAGAAGACGCCTGGGAGACATCGCCGCTTCACAGGTG
ACTCGGGCATTGAAGTGTGTGTGTGCAACCGGGGCCACCATGACGATGACCTCAAAGAGTTCAACACACTCATCGATGATGCTCTGGATG
GGCCCCTGGACTTCTGCGACAGCTGCCATGTGCGGCCCCCTGGTGATGAGGAGGAAGGCCTCTGTCAGTCCTCTGAGGAGCAGGCTCGAG
AGCCTGGGCACCCGCACCTGCCACGGCCGCCCGCATGCCTGCTGCTGAACACCATCAACGAGCAGGACTCTCCCAACTCCCAGAGCAGCA
GCTCCCCCAGCTAGAGCAGGTCCTGCCAGCACCCAGCAACTTGGCAAAGCAACCAGGGTAGGGGAGAACCACGAGAGAAGCATTAAGTGA
CTTTCAAAGACTTTCAGAGTACAGCCACTTGGTTCCTTTTTGTTTGTTTTCCTTCTCCTCTCCTGCATTTTCCTCCATCTCCAGGTACAG
TTCGGGGTGTGGATGCCTCTTCCTCCACAAGGGCACAGTGTTGTGGAGGGCTAAGTTGGTTCTGTGACTCATTCCTCATACCCTAACTCC
ATCTCCTTTCTTTAAAGTCAAATCTCACCTACCTGTTTGGGTCAGAGAGATGTGTTTTAAAAGCCCCCAAGGAAGGAGGCTGGGACTGTG
CCCTGACATGATTCTTGGTGATGGAATAGGTTTGTGCTCTGATTCTAGTTTAAGAGAACGTTGCTGTATCTCAGTCCAGGAGAGGCAGCC
CATCTTGGCCCTGGATGAAGAAGGAAACCCACAGAGGCCCAGGGCTTGTCATTGGGCTGCCAGTGTCTGCCAAGCCAGCATTGAGCTAAT
CCTGTGGGAGGATGAGAGCTACTGGGCCGTTGTATGATAGGTTGGTAGGGGCTTGTTGATCTGTCAAATTCCAGGTGACAAGATCTATGC
ACCCCATGCGTCCTTGAGGGGCCTCTTCCCCGCAGGCTCTGGCTGGCCGCAGGCTGGTTCTGGTGTGAAAGGTTATACTGCCTTTTCTTT
GTTTGTTTGTTTTTTTCTCTAAAAACAAACAGCAAAAGACAGCTGAAAACAAGAACTTCACCGGTGGGCAGGCAAGAATTCTCTTCTGGA
AAATGACGTTTGTGGCTCTTTCCCAAGTTGGCCTTCAAAGAGCCTGCCTGCTGTTGAGCCAGAAGATGTCTCGTGTGAAGGCTGGGGTGG
CGGCTGTCTTGGAACCTCTGTGAGCAGGAGGCCCTAAGCCGCAGCAGTGGATAGAGGTGCAGCTCTCTGCCTCTCTGCCCTTTGGTCTGT
GTTCACAGGTGACCCGTGTCAGCCTGCATCGCAAGCACACACCCTGCGGGCCTTCAAGTCTCACTGTTCCGTATGAGGAAACAGACAGCG
GACTGAGGAAGCGATGGCCCCAGAGAAAGGGCCCCTGTAGCCTGGCTCTCACACAGTATTTTATCTTTGATTCTGAATAAATATTTTTTG
TGGGGTTTTTTTTTTTTTTTTGGTGGCAGTTGTTTGTTTTAAACTGACCACTTGGAAGAAACACCTTGGTTATCTGTGGTTTTCATGCCT
TGTCCCTGCCTCTACCCCCACCCCTTTTGAGTCGGGTGACTCATTTTTCTGTGTAGAGACTCGGTGGCCCAGGCAGGAGGTGAAAGCAGC
CATCCGGAAGGCCCTGGGGACCCTTGTGCCTGTTGCTCGCCTTCAGGTCACCAGCTGAGCTGCGATAGGAAAATCTGAATGGAGGCAGCA
AACAGCCAAAACAAACATTCCCCACCCGGCCCTGTGCATATGAAGTCTTTCTTCCCCCAACTCTTGAACGATGATGATATTCAGACGAAG
CATTGATGTTATGGAAGAAAGAAAGAAACAAACAAAATATATATATATATGTCCAAAAACAGACAAATCCAAGGGTGTGAGGTAAACGAG
TGTCTGCATTTAGATTCCACAAAACCAAAATCCATGTTGAACAAAGTTAAGTCCGTACACAGTGACTTTTTGGGTGAGCCGTGTGTGTCT
GTCTGTTGTGTGTGTGCCTCAAGCCCTGTTTTCCTGTGAAGATACTTTGAGTGGCAGCCATTCTCTCCACGTGAACCACACGTCTGGAGC
ACAGACAGGCCTCTCAAGGTCATTGATCTTACGCATTTACTGTTTACCGAACAAATGTCTGACTGTGTACTCGGGTGTACTCCGCAGCAT
TGTCGACTGCAGTCCCCTGTGTTTGCCAGAGATACTGTGCTCGAAGTAGAGGTTTTACTCTACTCATCACTGCGATTTGCACATTGCTCC
GTGGACACTCGGAGGCCTGCGTTCTGTTCCCTATAAATGGAAGCGTGCTCTGAGCCTGTCTGCCTCCCTCGGCTGCTGCTGGTCCTCAGT
ACCAGCGCCCGGGGGTGTCCACAACCACTTGGGACAGAAGAAGGTGGAATTTCAGACAGAAGCTTGACTGGGTCTTCAATGACAGGCTTG
GACTAGCTGTGGCCCAGACATCGGCCCTGCCCAGAATTGCCAGGAGGAGGCTTTGCAGGCTCTAGAGGAGCCGCAGGGCCTGCCTGCCTC
TGGTGAGTCCAACAGGCACAAGCAAGCTGGCGTGTGGCCAGAGGTAGCCGGAGTGTGTCACAGCCCCTCAGATGCCTTTCCTTCCACCTT
TTTTTATTTTTTAAGAATCCCAAATAACTCACTGAAGTGTCTCAAAGGCGAACAAGTTTTACCAAAATGAATCCTTTTTCAGTTAACAGA
TCAAATGGATGAGTTCTGAGCCTCTCAAGTTCCTTTCCCCAGTTAGAGTGGGGAACTGGGCAAGTGTTAACTGTGGGACTCACTGCAGCG
TCCTATCCTAAAGGCACGAGAAGACGGAAATGCAACCTGCGGAGCTGGGCTTGGTTCCCAGGTCACAGTTTGGCCCCCGCTACAGGATGC
TGCCCTGCTCAGAGAGAGATTTAATAGGGAGCTGAAGGAATCGTTAGGGGGCCAGGGAGATGTGACTGAGGCTGGCTTTCCACGTGAATG
AGACGGGGTCGGTGGAGGGTTTGGTGCTACAGCCAGTCAGAAGATTTGCAAATGCGAACACATTCCTGTGTGAGGCACGTTACCCTTTGT
CAGTTATTGTGAATATGTGTATTTTAAGCAATAAGATTCAGCTGGTCAGACTTTTCTGGGCAGTCTCAGTGACGCATTTCCTGTGCTGTG


Top

FusionGenePPI for GBF1_WBP1L


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GBF1YWHAG, COPG1, KBTBD7, VCP, HDAC6, EGFR, PNPLA2, YWHAB, BIRC6, EPS15L1, NUP85, PLEC, CCAR2, NCAPH, RABL6, IRS4, IVNS1ABP, FBXW11, BTRC, SPACA1, PNKD, LYPD3, KIF4A, PUS7, RBM26, VARS, NTRK1, SRPK2, FBXO7, ZSCAN26, FOXB1, FOXG1, FOXI2, FOXL1, CDC73, TMEM206, CHRM3, GML, MILR1, DLK2, NPY2R, EPHA1, UBCWBP1LLIG4, SGTA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneGBF1chr10:104103939chr10:104569650ENST00000369983+4401_380981860RAB1B


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GBF1_WBP1L


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GBF1_WBP1L


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource