FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14409

FusionGeneSummary for GAS7_CHMP4A

check button Fusion gene summary
Fusion gene informationFusion gene name: GAS7_CHMP4A
Fusion gene ID: 14409
HgeneTgene
Gene symbol

GAS7

CHMP4A

Gene ID

8522

128866

Gene namegrowth arrest specific 7charged multivesicular body protein 4B
Synonyms-C20orf178|CHMP4A|CTPP3|CTRCT31|SNF7|SNF7-2|Shax1|VPS32B|Vps32-2|dJ553F4.4
Cytomap

17p13.1

20q11.22

Type of geneprotein-codingprotein-coding
Descriptiongrowth arrest-specific protein 7charged multivesicular body protein 4bSNF7 homolog associated with Alix 1Snf7 homologue associated with Alix 1chromatin modifying protein 4Bchromatin-modifying protein 4bhSnf7-2hVps32-2vacuolar protein-sorting-associated protein 32-2
Modification date2018052320180522
UniProtAcc

O60861

Q9BY43

Ensembl transtripts involved in fusion geneENST00000437099, ENST00000323816, 
ENST00000432992, ENST00000540214, 
ENST00000585266, ENST00000580865, 
ENST00000583882, ENST00000542249, 
ENST00000396115, ENST00000579158, 
ENST00000578655, 
ENST00000347519, 
ENST00000530996, ENST00000542700, 
ENST00000609024, 
Fusion gene scores* DoF score10 X 7 X 6=4201 X 1 X 1=1
# samples 121
** MAII scorelog2(12/420*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: GAS7 [Title/Abstract] AND CHMP4A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCHMP4A

GO:0039702

viral budding via host ESCRT complex

24878737

TgeneCHMP4A

GO:0051260

protein homooligomerization

18209100


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDGBMTCGA-06-2562-01AGAS7chr17

9923094

-CHMP4Achr14

24681035

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000437099ENST00000347519GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000437099ENST00000530996GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000437099ENST00000542700GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000437099ENST00000609024GAS7chr17

9923094

-CHMP4Achr14

24681035

-
In-frameENST00000323816ENST00000347519GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000323816ENST00000530996GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000323816ENST00000542700GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000323816ENST00000609024GAS7chr17

9923094

-CHMP4Achr14

24681035

-
In-frameENST00000432992ENST00000347519GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000432992ENST00000530996GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000432992ENST00000542700GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000432992ENST00000609024GAS7chr17

9923094

-CHMP4Achr14

24681035

-
Frame-shitENST00000540214ENST00000347519GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000540214ENST00000530996GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000540214ENST00000542700GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000540214ENST00000609024GAS7chr17

9923094

-CHMP4Achr14

24681035

-
In-frameENST00000585266ENST00000347519GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000585266ENST00000530996GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000585266ENST00000542700GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000585266ENST00000609024GAS7chr17

9923094

-CHMP4Achr14

24681035

-
intron-3CDSENST00000580865ENST00000347519GAS7chr17

9923094

-CHMP4Achr14

24681035

-
intron-5UTRENST00000580865ENST00000530996GAS7chr17

9923094

-CHMP4Achr14

24681035

-
intron-5UTRENST00000580865ENST00000542700GAS7chr17

9923094

-CHMP4Achr14

24681035

-
intron-5UTRENST00000580865ENST00000609024GAS7chr17

9923094

-CHMP4Achr14

24681035

-
intron-3CDSENST00000583882ENST00000347519GAS7chr17

9923094

-CHMP4Achr14

24681035

-
intron-5UTRENST00000583882ENST00000530996GAS7chr17

9923094

-CHMP4Achr14

24681035

-
intron-5UTRENST00000583882ENST00000542700GAS7chr17

9923094

-CHMP4Achr14

24681035

-
intron-5UTRENST00000583882ENST00000609024GAS7chr17

9923094

-CHMP4Achr14

24681035

-
Frame-shitENST00000542249ENST00000347519GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000542249ENST00000530996GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000542249ENST00000542700GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000542249ENST00000609024GAS7chr17

9923094

-CHMP4Achr14

24681035

-
In-frameENST00000396115ENST00000347519GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000396115ENST00000530996GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000396115ENST00000542700GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000396115ENST00000609024GAS7chr17

9923094

-CHMP4Achr14

24681035

-
Frame-shitENST00000579158ENST00000347519GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000579158ENST00000530996GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000579158ENST00000542700GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5CDS-5UTRENST00000579158ENST00000609024GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5UTR-3CDSENST00000578655ENST00000347519GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5UTR-5UTRENST00000578655ENST00000530996GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5UTR-5UTRENST00000578655ENST00000542700GAS7chr17

9923094

-CHMP4Achr14

24681035

-
5UTR-5UTRENST00000578655ENST00000609024GAS7chr17

9923094

-CHMP4Achr14

24681035

-

Top

FusionProtFeatures for GAS7_CHMP4A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GAS7

O60861

CHMP4A

Q9BY43

May play a role in promoting maturation andmorphological differentiation of cerebellar neurons. Probable core component of the endosomal sortingrequired for transport complex III (ESCRT-III) which is involvedin multivesicular bodies (MVBs) formation and sorting of endosomalcargo proteins into MVBs. MVBs contain intraluminal vesicles(ILVs) that are generated by invagination and scission from thelimiting membrane of the endosome and mostly are delivered tolysosomes enabling degradation of membrane proteins, such asstimulated growth factor receptors, lysosomal enzymes and lipids.The MVB pathway appears to require the sequential function ofESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostlydissociate from the invaginating membrane before the ILV isreleased. The ESCRT machinery also functions in topologicallyequivalent membrane fission events, such as the terminal stages ofcytokinesis and the budding of enveloped viruses (HIV-1 and otherlentiviruses). ESCRT-III proteins are believed to mediate thenecessary vesicle extrusion and/or membrane fission activities,possibly in conjunction with the AAA ATPase VPS4. Whenoverexpressed, membrane-assembled circular arrays of CHMP4Afilaments can promote or stabilize negative curvature and outwardbudding. Via its interaction with PDCD6IP involved in HIV-1p6- and p9-dependent virus release. CHMP4A/B/C are required forthe exosomal release of SDCBP, CD63 and syndecan(PubMed:22660413). {ECO:0000269|PubMed:12860994,ECO:0000269|PubMed:14505569, ECO:0000269|PubMed:14519844,ECO:0000269|PubMed:14583093, ECO:0000269|PubMed:18209100,ECO:0000269|PubMed:22660413}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGAS7chr17:9923094chr14:24681035ENST00000432992-21467_70101477Compositional biasNote=Poly-Pro
HgeneGAS7chr17:9923094chr14:24681035ENST00000432992-2141_62101477DomainSH3
TgeneCHMP4Achr17:9923094chr14:24681035ENST00000347519-06155_18053266Coiled coilOntology_term=ECO:0000255
TgeneCHMP4Achr17:9923094chr14:24681035ENST00000609024-06155_18010223Coiled coilOntology_term=ECO:0000255
TgeneCHMP4Achr17:9923094chr14:24681035ENST00000609024-0620_10510223Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGAS7chr17:9923094chr14:24681035ENST00000323816-315309_41941417Coiled coilOntology_term=ECO:0000255
HgeneGAS7chr17:9923094chr14:24681035ENST00000396115-27309_41937182Coiled coilOntology_term=ECO:0000255
HgeneGAS7chr17:9923094chr14:24681035ENST00000432992-214309_419101477Coiled coilOntology_term=ECO:0000255
HgeneGAS7chr17:9923094chr14:24681035ENST00000437099-214309_41937413Coiled coilOntology_term=ECO:0000255
HgeneGAS7chr17:9923094chr14:24681035ENST00000580865-110309_419-52337Coiled coilOntology_term=ECO:0000255
HgeneGAS7chr17:9923094chr14:24681035ENST00000585266-214309_41941417Coiled coilOntology_term=ECO:0000255
HgeneGAS7chr17:9923094chr14:24681035ENST00000323816-31567_7041417Compositional biasNote=Poly-Pro
HgeneGAS7chr17:9923094chr14:24681035ENST00000396115-2767_7037182Compositional biasNote=Poly-Pro
HgeneGAS7chr17:9923094chr14:24681035ENST00000437099-21467_7037413Compositional biasNote=Poly-Pro
HgeneGAS7chr17:9923094chr14:24681035ENST00000580865-11067_70-52337Compositional biasNote=Poly-Pro
HgeneGAS7chr17:9923094chr14:24681035ENST00000585266-21467_7041417Compositional biasNote=Poly-Pro
HgeneGAS7chr17:9923094chr14:24681035ENST00000323816-315196_45641417DomainF-BAR
HgeneGAS7chr17:9923094chr14:24681035ENST00000323816-3151_6241417DomainSH3
HgeneGAS7chr17:9923094chr14:24681035ENST00000323816-31577_11041417DomainWW
HgeneGAS7chr17:9923094chr14:24681035ENST00000396115-27196_45637182DomainF-BAR
HgeneGAS7chr17:9923094chr14:24681035ENST00000396115-271_6237182DomainSH3
HgeneGAS7chr17:9923094chr14:24681035ENST00000396115-2777_11037182DomainWW
HgeneGAS7chr17:9923094chr14:24681035ENST00000432992-214196_456101477DomainF-BAR
HgeneGAS7chr17:9923094chr14:24681035ENST00000432992-21477_110101477DomainWW
HgeneGAS7chr17:9923094chr14:24681035ENST00000437099-214196_45637413DomainF-BAR
HgeneGAS7chr17:9923094chr14:24681035ENST00000437099-2141_6237413DomainSH3
HgeneGAS7chr17:9923094chr14:24681035ENST00000437099-21477_11037413DomainWW
HgeneGAS7chr17:9923094chr14:24681035ENST00000580865-110196_456-52337DomainF-BAR
HgeneGAS7chr17:9923094chr14:24681035ENST00000580865-1101_62-52337DomainSH3
HgeneGAS7chr17:9923094chr14:24681035ENST00000580865-11077_110-52337DomainWW
HgeneGAS7chr17:9923094chr14:24681035ENST00000585266-214196_45641417DomainF-BAR
HgeneGAS7chr17:9923094chr14:24681035ENST00000585266-2141_6241417DomainSH3
HgeneGAS7chr17:9923094chr14:24681035ENST00000585266-21477_11041417DomainWW
TgeneCHMP4Achr17:9923094chr14:24681035ENST00000347519-0620_10553266Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for GAS7_CHMP4A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GAS7_ENST00000437099_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_250aa
MVPPPPGEESQTVILPPGWQSYLSPQGRRYTVNTTTNGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKTGTKNKRAAL
QALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFG

>In-frame_GAS7_ENST00000323816_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_254aa
MKPGMVPPPPGEESQTVILPPGWQSYLSPQGRRYTVNTTTNGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKTGTKNK
RAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRP

>In-frame_GAS7_ENST00000432992_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_314aa
MSGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGWFPASYVQLLEKPGMVPPPPGEESQTVILPPGWQSYLSPQ
GRRYTVNTTTNGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKTGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQ
REAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLN

>In-frame_GAS7_ENST00000585266_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_254aa
MKPGMVPPPPGEESQTVILPPGWQSYLSPQGRRYTVNTTTNGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKTGTKNK
RAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRP

>In-frame_GAS7_ENST00000396115_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_250aa
MVPPPPGEESQTVILPPGWQSYLSPQGRRYTVNTTTNGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKTGTKNKRAAL
QALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GAS7_ENST00000437099_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_750nt
ATGGTCCCCCCTCCGCCGGGAGAAGAAAGCCAGACGGTCATCCTTCCACCTGGCTGGCAGAGCTACCTGTCGCCTCAGGGCCGGCGGTAC
TATGTCAACACGACCACCAATGGGAAGAAGGAGAAAGGGCCAACCCCTGAAGAAGCAATACAGAAACTGAAGGAGACAGAGAAGATACTG
ATCAAGAAACAGGAATTTTTGGAGCAGAAGATTCAACAGGAGCTACAAACAGCCAAGAAGTATGGGACCAAGAATAAGAGAGCTGCCCTA
CAGGCTTTGCGGAGGAAGAAAAGATTCGAACAGCAGCTGGCACAAACTGACGGGACATTATCCACCCTGGAGTTTCAGCGTGAGGCCATT
GAGAATGCCACTACCAATGCAGAAGTCCTTCGTACCATGGAGCTTGCTGCCCAAAGCATGAAGAAGGCCTACCAGGACATGGACATTGAC
AAGGTAGATGAACTGATGACTGACATCACGGAACAACAGGAGGTGGCCCAGCAGATCTCAGATGCCATTTCTCGGCCTATGGGCTTTGGA
GATGATGTGGATGAGGATGAACTGCTGGAGGAGCTAGAGGAGCTGGAGCAGGAGGAATTGGCCCAGGAGTTGTTAAATGTGGGCGACAAG
GAAGAAGAACCCTCAGTCAAATTGCCTAGTGTACCTTCTACTCATCTGCCGGCAGGGCCAGCTCCCAAAGTGGATGAAGATGAAGAAGCA

>In-frame_GAS7_ENST00000323816_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_762nt
ATGAAGCCTGGAATGGTCCCCCCTCCGCCGGGAGAAGAAAGCCAGACGGTCATCCTTCCACCTGGCTGGCAGAGCTACCTGTCGCCTCAG
GGCCGGCGGTACTATGTCAACACGACCACCAATGGGAAGAAGGAGAAAGGGCCAACCCCTGAAGAAGCAATACAGAAACTGAAGGAGACA
GAGAAGATACTGATCAAGAAACAGGAATTTTTGGAGCAGAAGATTCAACAGGAGCTACAAACAGCCAAGAAGTATGGGACCAAGAATAAG
AGAGCTGCCCTACAGGCTTTGCGGAGGAAGAAAAGATTCGAACAGCAGCTGGCACAAACTGACGGGACATTATCCACCCTGGAGTTTCAG
CGTGAGGCCATTGAGAATGCCACTACCAATGCAGAAGTCCTTCGTACCATGGAGCTTGCTGCCCAAAGCATGAAGAAGGCCTACCAGGAC
ATGGACATTGACAAGGTAGATGAACTGATGACTGACATCACGGAACAACAGGAGGTGGCCCAGCAGATCTCAGATGCCATTTCTCGGCCT
ATGGGCTTTGGAGATGATGTGGATGAGGATGAACTGCTGGAGGAGCTAGAGGAGCTGGAGCAGGAGGAATTGGCCCAGGAGTTGTTAAAT
GTGGGCGACAAGGAAGAAGAACCCTCAGTCAAATTGCCTAGTGTACCTTCTACTCATCTGCCGGCAGGGCCAGCTCCCAAAGTGGATGAA

>In-frame_GAS7_ENST00000432992_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_942nt
ATGTCCGGCGCTCGCTGCCGGACCCTGTACCCCTTCTCCGGGGAGCGGCACGGCCAGGGGCTGCGCTTCGCCGCGGGCGAGCTGATCACG
CTGCTGCAGGTCCCGGACGGCGGCTGGTGGGAAGGCGAGAAGGAGGACGGGCTCCGTGGCTGGTTCCCGGCGAGCTACGTGCAGTTGCTG
GAGAAGCCTGGAATGGTCCCCCCTCCGCCGGGAGAAGAAAGCCAGACGGTCATCCTTCCACCTGGCTGGCAGAGCTACCTGTCGCCTCAG
GGCCGGCGGTACTATGTCAACACGACCACCAATGGGAAGAAGGAGAAAGGGCCAACCCCTGAAGAAGCAATACAGAAACTGAAGGAGACA
GAGAAGATACTGATCAAGAAACAGGAATTTTTGGAGCAGAAGATTCAACAGGAGCTACAAACAGCCAAGAAGTATGGGACCAAGAATAAG
AGAGCTGCCCTACAGGCTTTGCGGAGGAAGAAAAGATTCGAACAGCAGCTGGCACAAACTGACGGGACATTATCCACCCTGGAGTTTCAG
CGTGAGGCCATTGAGAATGCCACTACCAATGCAGAAGTCCTTCGTACCATGGAGCTTGCTGCCCAAAGCATGAAGAAGGCCTACCAGGAC
ATGGACATTGACAAGGTAGATGAACTGATGACTGACATCACGGAACAACAGGAGGTGGCCCAGCAGATCTCAGATGCCATTTCTCGGCCT
ATGGGCTTTGGAGATGATGTGGATGAGGATGAACTGCTGGAGGAGCTAGAGGAGCTGGAGCAGGAGGAATTGGCCCAGGAGTTGTTAAAT
GTGGGCGACAAGGAAGAAGAACCCTCAGTCAAATTGCCTAGTGTACCTTCTACTCATCTGCCGGCAGGGCCAGCTCCCAAAGTGGATGAA

>In-frame_GAS7_ENST00000585266_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_762nt
ATGAAGCCTGGAATGGTCCCCCCTCCGCCGGGAGAAGAAAGCCAGACGGTCATCCTTCCACCTGGCTGGCAGAGCTACCTGTCGCCTCAG
GGCCGGCGGTACTATGTCAACACGACCACCAATGGGAAGAAGGAGAAAGGGCCAACCCCTGAAGAAGCAATACAGAAACTGAAGGAGACA
GAGAAGATACTGATCAAGAAACAGGAATTTTTGGAGCAGAAGATTCAACAGGAGCTACAAACAGCCAAGAAGTATGGGACCAAGAATAAG
AGAGCTGCCCTACAGGCTTTGCGGAGGAAGAAAAGATTCGAACAGCAGCTGGCACAAACTGACGGGACATTATCCACCCTGGAGTTTCAG
CGTGAGGCCATTGAGAATGCCACTACCAATGCAGAAGTCCTTCGTACCATGGAGCTTGCTGCCCAAAGCATGAAGAAGGCCTACCAGGAC
ATGGACATTGACAAGGTAGATGAACTGATGACTGACATCACGGAACAACAGGAGGTGGCCCAGCAGATCTCAGATGCCATTTCTCGGCCT
ATGGGCTTTGGAGATGATGTGGATGAGGATGAACTGCTGGAGGAGCTAGAGGAGCTGGAGCAGGAGGAATTGGCCCAGGAGTTGTTAAAT
GTGGGCGACAAGGAAGAAGAACCCTCAGTCAAATTGCCTAGTGTACCTTCTACTCATCTGCCGGCAGGGCCAGCTCCCAAAGTGGATGAA

>In-frame_GAS7_ENST00000396115_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_750nt
ATGGTCCCCCCTCCGCCGGGAGAAGAAAGCCAGACGGTCATCCTTCCACCTGGCTGGCAGAGCTACCTGTCGCCTCAGGGCCGGCGGTAC
TATGTCAACACGACCACCAATGGGAAGAAGGAGAAAGGGCCAACCCCTGAAGAAGCAATACAGAAACTGAAGGAGACAGAGAAGATACTG
ATCAAGAAACAGGAATTTTTGGAGCAGAAGATTCAACAGGAGCTACAAACAGCCAAGAAGTATGGGACCAAGAATAAGAGAGCTGCCCTA
CAGGCTTTGCGGAGGAAGAAAAGATTCGAACAGCAGCTGGCACAAACTGACGGGACATTATCCACCCTGGAGTTTCAGCGTGAGGCCATT
GAGAATGCCACTACCAATGCAGAAGTCCTTCGTACCATGGAGCTTGCTGCCCAAAGCATGAAGAAGGCCTACCAGGACATGGACATTGAC
AAGGTAGATGAACTGATGACTGACATCACGGAACAACAGGAGGTGGCCCAGCAGATCTCAGATGCCATTTCTCGGCCTATGGGCTTTGGA
GATGATGTGGATGAGGATGAACTGCTGGAGGAGCTAGAGGAGCTGGAGCAGGAGGAATTGGCCCAGGAGTTGTTAAATGTGGGCGACAAG
GAAGAAGAACCCTCAGTCAAATTGCCTAGTGTACCTTCTACTCATCTGCCGGCAGGGCCAGCTCCCAAAGTGGATGAAGATGAAGAAGCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_GAS7_ENST00000437099_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_1189nt
ATTGCTTCTGGGTTTGGGGTGTGAGAGGATGCAGAGTGGGAGACCTTAAAACCGTCTGATCTGGCTGCTAAAGCGAGTGTCTGACGACCA
CCCATTAACACCAGCGAGTAGCGTTTGCTCACGGCTTTAGGATAAGAAGCCTGGAATGGTCCCCCCTCCGCCGGGAGAAGAAAGCCAGAC
GGTCATCCTTCCACCTGGCTGGCAGAGCTACCTGTCGCCTCAGGGCCGGCGGTACTATGTCAACACGACCACCAATGGGAAGAAGGAGAA
AGGGCCAACCCCTGAAGAAGCAATACAGAAACTGAAGGAGACAGAGAAGATACTGATCAAGAAACAGGAATTTTTGGAGCAGAAGATTCA
ACAGGAGCTACAAACAGCCAAGAAGTATGGGACCAAGAATAAGAGAGCTGCCCTACAGGCTTTGCGGAGGAAGAAAAGATTCGAACAGCA
GCTGGCACAAACTGACGGGACATTATCCACCCTGGAGTTTCAGCGTGAGGCCATTGAGAATGCCACTACCAATGCAGAAGTCCTTCGTAC
CATGGAGCTTGCTGCCCAAAGCATGAAGAAGGCCTACCAGGACATGGACATTGACAAGGTAGATGAACTGATGACTGACATCACGGAACA
ACAGGAGGTGGCCCAGCAGATCTCAGATGCCATTTCTCGGCCTATGGGCTTTGGAGATGATGTGGATGAGGATGAACTGCTGGAGGAGCT
AGAGGAGCTGGAGCAGGAGGAATTGGCCCAGGAGTTGTTAAATGTGGGCGACAAGGAAGAAGAACCCTCAGTCAAATTGCCTAGTGTACC
TTCTACTCATCTGCCGGCAGGGCCAGCTCCCAAAGTGGATGAAGATGAAGAAGCACTAAAGCAGTTGGCTGAGTGGGTATCCTGATAAAT
CTGGGCTTGTCTTCCTAATGCTACCTTTGTTGGTCCTTTCTTCCTTAAGTGCCAAGTGCTGAGCTAAAGGAGGATAACTTTTTGGGGAAG
TCATGCTGAGGGTGGTAGTGTGACCCTGCCTGAAAAAAGGGTCTCTTACCCTCCCAGCCCTGGCTCAACTCTGAAGAAGGATCTTGCTAC
AGAAGGAGCCCTTGGGCTCCCTTCTCTTTGATAGCAGTTATAATGCCCTTGTTCCCAATAAAACTGGGCAGATGGAATCCTAGTGTCTAT

>In-frame_GAS7_ENST00000323816_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_1219nt
GATTTTCTTCCCTGGAGTGAGAAGCAGGCAGAGGATCACTCGGTGGCTGTGTATACCCTGCCTTTGGTGGTGGCACCCCAGTCAGAAACG
GGACCCTGAAGCTGGGATTTAGGATGCTGGCTGTGTCACCTCGGTCTCCCCAAGATTGAACGCAAGACGAGCCATGAAGCCTGGAATGGT
CCCCCCTCCGCCGGGAGAAGAAAGCCAGACGGTCATCCTTCCACCTGGCTGGCAGAGCTACCTGTCGCCTCAGGGCCGGCGGTACTATGT
CAACACGACCACCAATGGGAAGAAGGAGAAAGGGCCAACCCCTGAAGAAGCAATACAGAAACTGAAGGAGACAGAGAAGATACTGATCAA
GAAACAGGAATTTTTGGAGCAGAAGATTCAACAGGAGCTACAAACAGCCAAGAAGTATGGGACCAAGAATAAGAGAGCTGCCCTACAGGC
TTTGCGGAGGAAGAAAAGATTCGAACAGCAGCTGGCACAAACTGACGGGACATTATCCACCCTGGAGTTTCAGCGTGAGGCCATTGAGAA
TGCCACTACCAATGCAGAAGTCCTTCGTACCATGGAGCTTGCTGCCCAAAGCATGAAGAAGGCCTACCAGGACATGGACATTGACAAGGT
AGATGAACTGATGACTGACATCACGGAACAACAGGAGGTGGCCCAGCAGATCTCAGATGCCATTTCTCGGCCTATGGGCTTTGGAGATGA
TGTGGATGAGGATGAACTGCTGGAGGAGCTAGAGGAGCTGGAGCAGGAGGAATTGGCCCAGGAGTTGTTAAATGTGGGCGACAAGGAAGA
AGAACCCTCAGTCAAATTGCCTAGTGTACCTTCTACTCATCTGCCGGCAGGGCCAGCTCCCAAAGTGGATGAAGATGAAGAAGCACTAAA
GCAGTTGGCTGAGTGGGTATCCTGATAAATCTGGGCTTGTCTTCCTAATGCTACCTTTGTTGGTCCTTTCTTCCTTAAGTGCCAAGTGCT
GAGCTAAAGGAGGATAACTTTTTGGGGAAGTCATGCTGAGGGTGGTAGTGTGACCCTGCCTGAAAAAAGGGTCTCTTACCCTCCCAGCCC
TGGCTCAACTCTGAAGAAGGATCTTGCTACAGAAGGAGCCCTTGGGCTCCCTTCTCTTTGATAGCAGTTATAATGCCCTTGTTCCCAATA

>In-frame_GAS7_ENST00000432992_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_1397nt
GTCCCCCGCCTGCCTGAGGACCCCCGCGCACCCCAGAGACGGCGCGCGCCCAGAGCGCGGGAGCCCGGAGCGCCGGGCGCCTGGGACCCC
GCGGAGCCGCTGCCCAGCCCGTGGGGCTCGGCGGGAATGCAGGCTGCGCTGTGAACCCGGGCGCCAAGGCCATGTCCGGCGCTCGCTGCC
GGACCCTGTACCCCTTCTCCGGGGAGCGGCACGGCCAGGGGCTGCGCTTCGCCGCGGGCGAGCTGATCACGCTGCTGCAGGTCCCGGACG
GCGGCTGGTGGGAAGGCGAGAAGGAGGACGGGCTCCGTGGCTGGTTCCCGGCGAGCTACGTGCAGTTGCTGGAGAAGCCTGGAATGGTCC
CCCCTCCGCCGGGAGAAGAAAGCCAGACGGTCATCCTTCCACCTGGCTGGCAGAGCTACCTGTCGCCTCAGGGCCGGCGGTACTATGTCA
ACACGACCACCAATGGGAAGAAGGAGAAAGGGCCAACCCCTGAAGAAGCAATACAGAAACTGAAGGAGACAGAGAAGATACTGATCAAGA
AACAGGAATTTTTGGAGCAGAAGATTCAACAGGAGCTACAAACAGCCAAGAAGTATGGGACCAAGAATAAGAGAGCTGCCCTACAGGCTT
TGCGGAGGAAGAAAAGATTCGAACAGCAGCTGGCACAAACTGACGGGACATTATCCACCCTGGAGTTTCAGCGTGAGGCCATTGAGAATG
CCACTACCAATGCAGAAGTCCTTCGTACCATGGAGCTTGCTGCCCAAAGCATGAAGAAGGCCTACCAGGACATGGACATTGACAAGGTAG
ATGAACTGATGACTGACATCACGGAACAACAGGAGGTGGCCCAGCAGATCTCAGATGCCATTTCTCGGCCTATGGGCTTTGGAGATGATG
TGGATGAGGATGAACTGCTGGAGGAGCTAGAGGAGCTGGAGCAGGAGGAATTGGCCCAGGAGTTGTTAAATGTGGGCGACAAGGAAGAAG
AACCCTCAGTCAAATTGCCTAGTGTACCTTCTACTCATCTGCCGGCAGGGCCAGCTCCCAAAGTGGATGAAGATGAAGAAGCACTAAAGC
AGTTGGCTGAGTGGGTATCCTGATAAATCTGGGCTTGTCTTCCTAATGCTACCTTTGTTGGTCCTTTCTTCCTTAAGTGCCAAGTGCTGA
GCTAAAGGAGGATAACTTTTTGGGGAAGTCATGCTGAGGGTGGTAGTGTGACCCTGCCTGAAAAAAGGGTCTCTTACCCTCCCAGCCCTG
GCTCAACTCTGAAGAAGGATCTTGCTACAGAAGGAGCCCTTGGGCTCCCTTCTCTTTGATAGCAGTTATAATGCCCTTGTTCCCAATAAA

>In-frame_GAS7_ENST00000585266_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_1367nt
AGAAACATTGCATCTGGAAAGTCCAGAACAAGTTGTTAATTTCCCAGCAAGCACTGGAGCGGATTTGGAAGGAACTATGCAATGTAGTGG
GTTCTTTGTGAAAGAACAGCAATGAGCAAAGCCACAGGAACCTCCGCTGGGGTGCCCAGAACACTGGCCCTGGGCTAGCGACTTGCCTCA
GCCCCATTTCCCGGAGAGGCTGCCATGAAGAGGAAGCCGGCGGAGTCTTGGTGCTGAGTCTGAGGGCTTCAGGCAGGACCCAAGACTCTC
CTCTGAGGTAGCAGCCCCCAGAGAAGGTTAGCTGTTCTCTGATGAAGCCTGGAATGGTCCCCCCTCCGCCGGGAGAAGAAAGCCAGACGG
TCATCCTTCCACCTGGCTGGCAGAGCTACCTGTCGCCTCAGGGCCGGCGGTACTATGTCAACACGACCACCAATGGGAAGAAGGAGAAAG
GGCCAACCCCTGAAGAAGCAATACAGAAACTGAAGGAGACAGAGAAGATACTGATCAAGAAACAGGAATTTTTGGAGCAGAAGATTCAAC
AGGAGCTACAAACAGCCAAGAAGTATGGGACCAAGAATAAGAGAGCTGCCCTACAGGCTTTGCGGAGGAAGAAAAGATTCGAACAGCAGC
TGGCACAAACTGACGGGACATTATCCACCCTGGAGTTTCAGCGTGAGGCCATTGAGAATGCCACTACCAATGCAGAAGTCCTTCGTACCA
TGGAGCTTGCTGCCCAAAGCATGAAGAAGGCCTACCAGGACATGGACATTGACAAGGTAGATGAACTGATGACTGACATCACGGAACAAC
AGGAGGTGGCCCAGCAGATCTCAGATGCCATTTCTCGGCCTATGGGCTTTGGAGATGATGTGGATGAGGATGAACTGCTGGAGGAGCTAG
AGGAGCTGGAGCAGGAGGAATTGGCCCAGGAGTTGTTAAATGTGGGCGACAAGGAAGAAGAACCCTCAGTCAAATTGCCTAGTGTACCTT
CTACTCATCTGCCGGCAGGGCCAGCTCCCAAAGTGGATGAAGATGAAGAAGCACTAAAGCAGTTGGCTGAGTGGGTATCCTGATAAATCT
GGGCTTGTCTTCCTAATGCTACCTTTGTTGGTCCTTTCTTCCTTAAGTGCCAAGTGCTGAGCTAAAGGAGGATAACTTTTTGGGGAAGTC
ATGCTGAGGGTGGTAGTGTGACCCTGCCTGAAAAAAGGGTCTCTTACCCTCCCAGCCCTGGCTCAACTCTGAAGAAGGATCTTGCTACAG
AAGGAGCCCTTGGGCTCCCTTCTCTTTGATAGCAGTTATAATGCCCTTGTTCCCAATAAAACTGGGCAGATGGAATCCTAGTGTCTATAC

>In-frame_GAS7_ENST00000396115_chr17_9923094_-_CHMP4A_ENST00000347519_chr14_24681035_-_1189nt
ATTGCTTCTGGGTTTGGGGTGTGAGAGGATGCAGAGTGGGAGACCTTAAAACCGTCTGATCTGGCTGCTAAAGCGAGTGTCTGACGACCA
CCCATTAACACCAGCGAGTAGCGTTTGCTCACGGCTTTAGGATAAGAAGCCTGGAATGGTCCCCCCTCCGCCGGGAGAAGAAAGCCAGAC
GGTCATCCTTCCACCTGGCTGGCAGAGCTACCTGTCGCCTCAGGGCCGGCGGTACTATGTCAACACGACCACCAATGGGAAGAAGGAGAA
AGGGCCAACCCCTGAAGAAGCAATACAGAAACTGAAGGAGACAGAGAAGATACTGATCAAGAAACAGGAATTTTTGGAGCAGAAGATTCA
ACAGGAGCTACAAACAGCCAAGAAGTATGGGACCAAGAATAAGAGAGCTGCCCTACAGGCTTTGCGGAGGAAGAAAAGATTCGAACAGCA
GCTGGCACAAACTGACGGGACATTATCCACCCTGGAGTTTCAGCGTGAGGCCATTGAGAATGCCACTACCAATGCAGAAGTCCTTCGTAC
CATGGAGCTTGCTGCCCAAAGCATGAAGAAGGCCTACCAGGACATGGACATTGACAAGGTAGATGAACTGATGACTGACATCACGGAACA
ACAGGAGGTGGCCCAGCAGATCTCAGATGCCATTTCTCGGCCTATGGGCTTTGGAGATGATGTGGATGAGGATGAACTGCTGGAGGAGCT
AGAGGAGCTGGAGCAGGAGGAATTGGCCCAGGAGTTGTTAAATGTGGGCGACAAGGAAGAAGAACCCTCAGTCAAATTGCCTAGTGTACC
TTCTACTCATCTGCCGGCAGGGCCAGCTCCCAAAGTGGATGAAGATGAAGAAGCACTAAAGCAGTTGGCTGAGTGGGTATCCTGATAAAT
CTGGGCTTGTCTTCCTAATGCTACCTTTGTTGGTCCTTTCTTCCTTAAGTGCCAAGTGCTGAGCTAAAGGAGGATAACTTTTTGGGGAAG
TCATGCTGAGGGTGGTAGTGTGACCCTGCCTGAAAAAAGGGTCTCTTACCCTCCCAGCCCTGGCTCAACTCTGAAGAAGGATCTTGCTAC
AGAAGGAGCCCTTGGGCTCCCTTCTCTTTGATAGCAGTTATAATGCCCTTGTTCCCAATAAAACTGGGCAGATGGAATCCTAGTGTCTAT


Top

FusionGenePPI for GAS7_CHMP4A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GAS7PACSIN1, GAS7, ATXN1L, CREB3L2, HNRNPU, KHDRBS1, SF1, SF3A1, SFPQ, RPLP0, ABI1, CYFIP1, CYFIP2, DIAPH1, FMNL1, WAS, WASF2, APBB1IP, NCKAP1, NCKAP1L, GAPDH, WDYHV1, NCKIPSDCHMP4ASYT17, STAMBP, PDCD6IP, F2R, CHMP3, VPS4A, CHMP4C, PPIA, CHMP4B, CHMP5, CHMP4A, CC2D1A, TTC19, CDK13, VPS4B, EGFR, ADSS, DCK, CHRAC1, EFHD2, HSPE1, IDH1, RANBP1, RBBP7, RCN1, TALDO1, EIF6, SMARCB1, GAK, TFG, CDCA3, ARL6IP6, VAX2, NFYA, COX15


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneCHMP4Achr17:9923094chr14:24681035ENST00000347519-061_11653266phosphoinosides
TgeneCHMP4Achr17:9923094chr14:24681035ENST00000609024-061_11610223phosphoinosides


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GAS7_CHMP4A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GAS7_CHMP4A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGAS7C0028754Obesity1CTD_human