FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 144

FusionGeneSummary for ABCC1_PRKCB

check button Fusion gene summary
Fusion gene informationFusion gene name: ABCC1_PRKCB
Fusion gene ID: 144
HgeneTgene
Gene symbol

ABCC1

PRKCB

Gene ID

4363

5579

Gene nameATP binding cassette subfamily C member 1protein kinase C beta
SynonymsABC29|ABCC|GS-X|MRP|MRP1PKC-beta|PKCB|PRKCB1|PRKCB2
Cytomap

16p13.11

16p12.2-p12.1

Type of geneprotein-codingprotein-coding
Descriptionmultidrug resistance-associated protein 1ATP-binding cassette transporter variant ABCC1delta-ex13ATP-binding cassette transporter variant ABCC1delta-ex13&14ATP-binding cassette transporter variant ABCC1delta-ex25ATP-binding cassette transporter varianprotein kinase C beta typePKC-Bprotein kinase C, beta 1 polypeptide
Modification date2018052320180523
UniProtAcc

P33527

P05771

Ensembl transtripts involved in fusion geneENST00000399410, ENST00000349029, 
ENST00000351154, ENST00000399408, 
ENST00000345148, ENST00000346370, 
ENST00000576557, 
ENST00000321728, 
ENST00000303531, ENST00000482000, 
ENST00000498058, 
Fusion gene scores* DoF score6 X 6 X 4=14413 X 9 X 10=1170
# samples 614
** MAII scorelog2(6/144*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(14/1170*10)=-3.0630097975258
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ABCC1 [Title/Abstract] AND PRKCB [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePRKCB

GO:0035408

histone H3-T6 phosphorylation

20228790


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-KK-A8I7-01AABCC1chr16

16184445

+PRKCBchr16

23999829

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000399410ENST00000321728ABCC1chr16

16184445

+PRKCBchr16

23999829

+
In-frameENST00000399410ENST00000303531ABCC1chr16

16184445

+PRKCBchr16

23999829

+
5CDS-intronENST00000399410ENST00000482000ABCC1chr16

16184445

+PRKCBchr16

23999829

+
5CDS-intronENST00000399410ENST00000498058ABCC1chr16

16184445

+PRKCBchr16

23999829

+
In-frameENST00000349029ENST00000321728ABCC1chr16

16184445

+PRKCBchr16

23999829

+
In-frameENST00000349029ENST00000303531ABCC1chr16

16184445

+PRKCBchr16

23999829

+
5CDS-intronENST00000349029ENST00000482000ABCC1chr16

16184445

+PRKCBchr16

23999829

+
5CDS-intronENST00000349029ENST00000498058ABCC1chr16

16184445

+PRKCBchr16

23999829

+
In-frameENST00000351154ENST00000321728ABCC1chr16

16184445

+PRKCBchr16

23999829

+
In-frameENST00000351154ENST00000303531ABCC1chr16

16184445

+PRKCBchr16

23999829

+
5CDS-intronENST00000351154ENST00000482000ABCC1chr16

16184445

+PRKCBchr16

23999829

+
5CDS-intronENST00000351154ENST00000498058ABCC1chr16

16184445

+PRKCBchr16

23999829

+
In-frameENST00000399408ENST00000321728ABCC1chr16

16184445

+PRKCBchr16

23999829

+
In-frameENST00000399408ENST00000303531ABCC1chr16

16184445

+PRKCBchr16

23999829

+
5CDS-intronENST00000399408ENST00000482000ABCC1chr16

16184445

+PRKCBchr16

23999829

+
5CDS-intronENST00000399408ENST00000498058ABCC1chr16

16184445

+PRKCBchr16

23999829

+
In-frameENST00000345148ENST00000321728ABCC1chr16

16184445

+PRKCBchr16

23999829

+
In-frameENST00000345148ENST00000303531ABCC1chr16

16184445

+PRKCBchr16

23999829

+
5CDS-intronENST00000345148ENST00000482000ABCC1chr16

16184445

+PRKCBchr16

23999829

+
5CDS-intronENST00000345148ENST00000498058ABCC1chr16

16184445

+PRKCBchr16

23999829

+
In-frameENST00000346370ENST00000321728ABCC1chr16

16184445

+PRKCBchr16

23999829

+
In-frameENST00000346370ENST00000303531ABCC1chr16

16184445

+PRKCBchr16

23999829

+
5CDS-intronENST00000346370ENST00000482000ABCC1chr16

16184445

+PRKCBchr16

23999829

+
5CDS-intronENST00000346370ENST00000498058ABCC1chr16

16184445

+PRKCBchr16

23999829

+
intron-3CDSENST00000576557ENST00000321728ABCC1chr16

16184445

+PRKCBchr16

23999829

+
intron-3CDSENST00000576557ENST00000303531ABCC1chr16

16184445

+PRKCBchr16

23999829

+
intron-intronENST00000576557ENST00000482000ABCC1chr16

16184445

+PRKCBchr16

23999829

+
intron-intronENST00000576557ENST00000498058ABCC1chr16

16184445

+PRKCBchr16

23999829

+

Top

FusionProtFeatures for ABCC1_PRKCB


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ABCC1

P33527

PRKCB

P05771


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930325_6088811467DomainABC transmembrane type-1 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930644_8688811467DomainABC transporter 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830325_6088251476DomainABC transmembrane type-1 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729325_6087661417DomainABC transmembrane type-1 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830325_6088221473DomainABC transmembrane type-1 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932325_6088811542DomainABC transmembrane type-1 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932644_8688811542DomainABC transporter 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931325_6088811532DomainABC transmembrane type-1 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931644_8688811532DomainABC transporter 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930678_6858811467Nucleotide bindingNote=ATP 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830678_6858251476Nucleotide bindingNote=ATP 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729678_6857661417Nucleotide bindingNote=ATP 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830678_6858221473Nucleotide bindingNote=ATP 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932678_6858811542Nucleotide bindingNote=ATP 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931678_6858811532Nucleotide bindingNote=ATP 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930122_1338811467Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930155_1728811467Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930194_3168811467Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+19301_338811467Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930338_3638811467Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930385_4408811467Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930462_4648811467Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930486_5478811467Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+193055_748811467Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930569_5908811467Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+193096_1008811467Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830122_1338251476Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830155_1728251476Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830194_3168251476Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+18301_338251476Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830338_3638251476Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830385_4408251476Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830462_4648251476Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830486_5478251476Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+183055_748251476Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830569_5908251476Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+183096_1008251476Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729122_1337661417Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729155_1727661417Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729194_3167661417Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+17291_337661417Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729338_3637661417Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729385_4407661417Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729462_4647661417Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729486_5477661417Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+172955_747661417Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729569_5907661417Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+172996_1007661417Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830122_1338221473Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830155_1728221473Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830194_3168221473Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+18301_338221473Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830338_3638221473Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830385_4408221473Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830462_4648221473Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830486_5478221473Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+183055_748221473Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830569_5908221473Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+183096_1008221473Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932122_1338811542Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932155_1728811542Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932194_3168811542Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+19321_338811542Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932338_3638811542Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932385_4408811542Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932462_4648811542Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932486_5478811542Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+193255_748811542Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932569_5908811542Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+193296_1008811542Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931122_1338811532Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931155_1728811532Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931194_3168811532Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+19311_338811532Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931338_3638811532Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931385_4408811532Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931462_4648811532Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931486_5478811532Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+193155_748811532Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931569_5908811532Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+193196_1008811532Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930101_1218811467TransmembraneNote=Helical%3B Name%3D3
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930134_1548811467TransmembraneNote=Helical%3B Name%3D4
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930173_1938811467TransmembraneNote=Helical%3B Name%3D5
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930317_3378811467TransmembraneNote=Helical%3B Name%3D6
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+193034_548811467TransmembraneNote=Helical%3B Name%3D1
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930364_3848811467TransmembraneNote=Helical%3B Name%3D7
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930441_4618811467TransmembraneNote=Helical%3B Name%3D8
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930465_4858811467TransmembraneNote=Helical%3B Name%3D9
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930548_5688811467TransmembraneNote=Helical%3B Name%3D10
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930591_6118811467TransmembraneNote=Helical%3B Name%3D11
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+193075_958811467TransmembraneNote=Helical%3B Name%3D2
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830101_1218251476TransmembraneNote=Helical%3B Name%3D3
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830134_1548251476TransmembraneNote=Helical%3B Name%3D4
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830173_1938251476TransmembraneNote=Helical%3B Name%3D5
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830317_3378251476TransmembraneNote=Helical%3B Name%3D6
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+183034_548251476TransmembraneNote=Helical%3B Name%3D1
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830364_3848251476TransmembraneNote=Helical%3B Name%3D7
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830441_4618251476TransmembraneNote=Helical%3B Name%3D8
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830465_4858251476TransmembraneNote=Helical%3B Name%3D9
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830548_5688251476TransmembraneNote=Helical%3B Name%3D10
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830591_6118251476TransmembraneNote=Helical%3B Name%3D11
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+183075_958251476TransmembraneNote=Helical%3B Name%3D2
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729101_1217661417TransmembraneNote=Helical%3B Name%3D3
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729134_1547661417TransmembraneNote=Helical%3B Name%3D4
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729173_1937661417TransmembraneNote=Helical%3B Name%3D5
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729317_3377661417TransmembraneNote=Helical%3B Name%3D6
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+172934_547661417TransmembraneNote=Helical%3B Name%3D1
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729364_3847661417TransmembraneNote=Helical%3B Name%3D7
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729441_4617661417TransmembraneNote=Helical%3B Name%3D8
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729465_4857661417TransmembraneNote=Helical%3B Name%3D9
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729548_5687661417TransmembraneNote=Helical%3B Name%3D10
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729591_6117661417TransmembraneNote=Helical%3B Name%3D11
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+172975_957661417TransmembraneNote=Helical%3B Name%3D2
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830101_1218221473TransmembraneNote=Helical%3B Name%3D3
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830134_1548221473TransmembraneNote=Helical%3B Name%3D4
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830173_1938221473TransmembraneNote=Helical%3B Name%3D5
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830317_3378221473TransmembraneNote=Helical%3B Name%3D6
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+183034_548221473TransmembraneNote=Helical%3B Name%3D1
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830364_3848221473TransmembraneNote=Helical%3B Name%3D7
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830441_4618221473TransmembraneNote=Helical%3B Name%3D8
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830465_4858221473TransmembraneNote=Helical%3B Name%3D9
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830548_5688221473TransmembraneNote=Helical%3B Name%3D10
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830591_6118221473TransmembraneNote=Helical%3B Name%3D11
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+183075_958221473TransmembraneNote=Helical%3B Name%3D2
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932101_1218811542TransmembraneNote=Helical%3B Name%3D3
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932134_1548811542TransmembraneNote=Helical%3B Name%3D4
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932173_1938811542TransmembraneNote=Helical%3B Name%3D5
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932317_3378811542TransmembraneNote=Helical%3B Name%3D6
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+193234_548811542TransmembraneNote=Helical%3B Name%3D1
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932364_3848811542TransmembraneNote=Helical%3B Name%3D7
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932441_4618811542TransmembraneNote=Helical%3B Name%3D8
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932465_4858811542TransmembraneNote=Helical%3B Name%3D9
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932548_5688811542TransmembraneNote=Helical%3B Name%3D10
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932591_6118811542TransmembraneNote=Helical%3B Name%3D11
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+193275_958811542TransmembraneNote=Helical%3B Name%3D2
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931101_1218811532TransmembraneNote=Helical%3B Name%3D3
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931134_1548811532TransmembraneNote=Helical%3B Name%3D4
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931173_1938811532TransmembraneNote=Helical%3B Name%3D5
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931317_3378811532TransmembraneNote=Helical%3B Name%3D6
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+193134_548811532TransmembraneNote=Helical%3B Name%3D1
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931364_3848811532TransmembraneNote=Helical%3B Name%3D7
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931441_4618811532TransmembraneNote=Helical%3B Name%3D8
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931465_4858811532TransmembraneNote=Helical%3B Name%3D9
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931548_5688811532TransmembraneNote=Helical%3B Name%3D10
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931591_6118811532TransmembraneNote=Helical%3B Name%3D11
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+193175_958811532TransmembraneNote=Helical%3B Name%3D2
TgenePRKCBchr16:16184445chr16:23999829ENST00000303531+117173_26068674DomainC2
TgenePRKCBchr16:16184445chr16:23999829ENST00000303531+117342_60068674DomainProtein kinase
TgenePRKCBchr16:16184445chr16:23999829ENST00000303531+117601_67168674DomainNote=AGC-kinase C-terminal
TgenePRKCBchr16:16184445chr16:23999829ENST00000321728+117173_26068672DomainC2
TgenePRKCBchr16:16184445chr16:23999829ENST00000321728+117342_60068672DomainProtein kinase
TgenePRKCBchr16:16184445chr16:23999829ENST00000321728+117601_67168672DomainNote=AGC-kinase C-terminal
TgenePRKCBchr16:16184445chr16:23999829ENST00000498058+02173_260-3258DomainC2
TgenePRKCBchr16:16184445chr16:23999829ENST00000498058+02342_600-3258DomainProtein kinase
TgenePRKCBchr16:16184445chr16:23999829ENST00000498058+02601_671-3258DomainNote=AGC-kinase C-terminal
TgenePRKCBchr16:16184445chr16:23999829ENST00000303531+117348_35668674Nucleotide bindingATP
TgenePRKCBchr16:16184445chr16:23999829ENST00000321728+117348_35668672Nucleotide bindingATP
TgenePRKCBchr16:16184445chr16:23999829ENST00000498058+02348_356-3258Nucleotide bindingATP
TgenePRKCBchr16:16184445chr16:23999829ENST00000303531+117101_15168674Zinc fingerPhorbol-ester/DAG-type 2
TgenePRKCBchr16:16184445chr16:23999829ENST00000321728+117101_15168672Zinc fingerPhorbol-ester/DAG-type 2
TgenePRKCBchr16:16184445chr16:23999829ENST00000498058+02101_151-3258Zinc fingerPhorbol-ester/DAG-type 2
TgenePRKCBchr16:16184445chr16:23999829ENST00000498058+0236_86-3258Zinc fingerPhorbol-ester/DAG-type 1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+19301293_15278811467DomainABC transporter 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930975_12568811467DomainABC transmembrane type-1 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+18301293_15278251476DomainABC transporter 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830644_8688251476DomainABC transporter 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830975_12568251476DomainABC transmembrane type-1 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+17291293_15277661417DomainABC transporter 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729644_8687661417DomainABC transporter 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729975_12567661417DomainABC transmembrane type-1 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+18301293_15278221473DomainABC transporter 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830644_8688221473DomainABC transporter 1
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830975_12568221473DomainABC transmembrane type-1 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+19321293_15278811542DomainABC transporter 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932975_12568811542DomainABC transmembrane type-1 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+19311293_15278811532DomainABC transporter 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931975_12568811532DomainABC transmembrane type-1 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+19301327_13348811467Nucleotide bindingATP 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+18301327_13348251476Nucleotide bindingATP 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+17291327_13347661417Nucleotide bindingATP 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+18301327_13348221473Nucleotide bindingATP 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+19321327_13348811542Nucleotide bindingATP 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+19311327_13348811532Nucleotide bindingATP 2
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+19301047_10898811467Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+19301111_11118811467Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+19301133_12038811467Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+19301225_12268811467Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+19301248_15318811467Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930612_9678811467Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930989_10258811467Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+18301047_10898251476Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+18301111_11118251476Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+18301133_12038251476Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+18301225_12268251476Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+18301248_15318251476Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830612_9678251476Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830989_10258251476Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+17291047_10897661417Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+17291111_11117661417Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+17291133_12037661417Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+17291225_12267661417Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+17291248_15317661417Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729612_9677661417Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729989_10257661417Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+18301047_10898221473Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+18301111_11118221473Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+18301133_12038221473Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+18301225_12268221473Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+18301248_15318221473Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830612_9678221473Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830989_10258221473Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+19321047_10898811542Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+19321111_11118811542Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+19321133_12038811542Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+19321225_12268811542Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+19321248_15318811542Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932612_9678811542Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932989_10258811542Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+19311047_10898811532Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+19311111_11118811532Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+19311133_12038811532Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+19311225_12268811532Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+19311248_15318811532Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931612_9678811532Topological domainNote=Cytoplasmic
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931989_10258811532Topological domainNote=Extracellular
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+19301026_10468811467TransmembraneNote=Helical%3B Name%3D13
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+19301090_11108811467TransmembraneNote=Helical%3B Name%3D14
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+19301112_11328811467TransmembraneNote=Helical%3B Name%3D15
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+19301204_12248811467TransmembraneNote=Helical%3B Name%3D16
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+19301227_12478811467TransmembraneNote=Helical%3B Name%3D17
HgeneABCC1chr16:16184445chr16:23999829ENST00000345148+1930968_9888811467TransmembraneNote=Helical%3B Name%3D12
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+18301026_10468251476TransmembraneNote=Helical%3B Name%3D13
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+18301090_11108251476TransmembraneNote=Helical%3B Name%3D14
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+18301112_11328251476TransmembraneNote=Helical%3B Name%3D15
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+18301204_12248251476TransmembraneNote=Helical%3B Name%3D16
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+18301227_12478251476TransmembraneNote=Helical%3B Name%3D17
HgeneABCC1chr16:16184445chr16:23999829ENST00000346370+1830968_9888251476TransmembraneNote=Helical%3B Name%3D12
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+17291026_10467661417TransmembraneNote=Helical%3B Name%3D13
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+17291090_11107661417TransmembraneNote=Helical%3B Name%3D14
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+17291112_11327661417TransmembraneNote=Helical%3B Name%3D15
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+17291204_12247661417TransmembraneNote=Helical%3B Name%3D16
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+17291227_12477661417TransmembraneNote=Helical%3B Name%3D17
HgeneABCC1chr16:16184445chr16:23999829ENST00000349029+1729968_9887661417TransmembraneNote=Helical%3B Name%3D12
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+18301026_10468221473TransmembraneNote=Helical%3B Name%3D13
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+18301090_11108221473TransmembraneNote=Helical%3B Name%3D14
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+18301112_11328221473TransmembraneNote=Helical%3B Name%3D15
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+18301204_12248221473TransmembraneNote=Helical%3B Name%3D16
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+18301227_12478221473TransmembraneNote=Helical%3B Name%3D17
HgeneABCC1chr16:16184445chr16:23999829ENST00000351154+1830968_9888221473TransmembraneNote=Helical%3B Name%3D12
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+19321026_10468811542TransmembraneNote=Helical%3B Name%3D13
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+19321090_11108811542TransmembraneNote=Helical%3B Name%3D14
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+19321112_11328811542TransmembraneNote=Helical%3B Name%3D15
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+19321204_12248811542TransmembraneNote=Helical%3B Name%3D16
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+19321227_12478811542TransmembraneNote=Helical%3B Name%3D17
HgeneABCC1chr16:16184445chr16:23999829ENST00000399408+1932968_9888811542TransmembraneNote=Helical%3B Name%3D12
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+19311026_10468811532TransmembraneNote=Helical%3B Name%3D13
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+19311090_11108811532TransmembraneNote=Helical%3B Name%3D14
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+19311112_11328811532TransmembraneNote=Helical%3B Name%3D15
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+19311204_12248811532TransmembraneNote=Helical%3B Name%3D16
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+19311227_12478811532TransmembraneNote=Helical%3B Name%3D17
HgeneABCC1chr16:16184445chr16:23999829ENST00000399410+1931968_9888811532TransmembraneNote=Helical%3B Name%3D12
TgenePRKCBchr16:16184445chr16:23999829ENST00000303531+11736_8668674Zinc fingerPhorbol-ester/DAG-type 1
TgenePRKCBchr16:16184445chr16:23999829ENST00000321728+11736_8668672Zinc fingerPhorbol-ester/DAG-type 1


Top

FusionGeneSequence for ABCC1_PRKCB


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ABCC1_ENST00000399410_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_1485aa
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLF
YSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRK
QPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQ
VILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENV
IGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENVCCFVVHKRCHEFVTFSCP
GADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLV
RDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQ
KASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVM
LSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYA
AEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAG
QAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDT

>In-frame_ABCC1_ENST00000399410_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_1487aa
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLF
YSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRK
QPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQ
VILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENV
IGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENVCCFVVHKRCHEFVTFSCP
GADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLV
RDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQ
KASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVM
LSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYA
AEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAG
QAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACGRNAE

>In-frame_ABCC1_ENST00000349029_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_1370aa
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLF
YSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRK
QPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQ
VILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKTRILVTHSMSYLPQV
DVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSP
TFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIP
DPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPP
EGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDD
DVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNV
MLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPK
SMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNL

>In-frame_ABCC1_ENST00000349029_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_1372aa
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLF
YSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRK
QPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQ
VILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKTRILVTHSMSYLPQV
DVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSP
TFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIP
DPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPP
EGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDD
DVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNV
MLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPK
SMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNID

>In-frame_ABCC1_ENST00000351154_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_1426aa
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLF
YSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRK
QPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQ
VILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGVNLSGGQKQRVSLA
RAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTY
ASTEQEQDAEENVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMN
VPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDK
DRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVS
KFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRL
YFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPD
YIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKE

>In-frame_ABCC1_ENST00000351154_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_1428aa
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLF
YSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRK
QPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQ
VILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGVNLSGGQKQRVSLA
RAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTY
ASTEQEQDAEENVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMN
VPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDK
DRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVS
KFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRL
YFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPD
YIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKE

>In-frame_ABCC1_ENST00000399408_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_1485aa
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLF
YSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRK
QPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQ
VILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENV
IGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENVCCFVVHKRCHEFVTFSCP
GADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLV
RDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQ
KASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVM
LSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYA
AEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAG
QAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDT

>In-frame_ABCC1_ENST00000399408_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_1487aa
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLF
YSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRK
QPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQ
VILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENV
IGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENVCCFVVHKRCHEFVTFSCP
GADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLV
RDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQ
KASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVM
LSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYA
AEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAG
QAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACGRNAE

>In-frame_ABCC1_ENST00000345148_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_1485aa
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLF
YSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRK
QPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQ
VILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENV
IGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENVCCFVVHKRCHEFVTFSCP
GADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLV
RDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQ
KASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVM
LSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYA
AEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAG
QAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDT

>In-frame_ABCC1_ENST00000345148_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_1487aa
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLF
YSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRK
QPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQ
VILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENV
IGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENVCCFVVHKRCHEFVTFSCP
GADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLV
RDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQ
KASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVM
LSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYA
AEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAG
QAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACGRNAE

>In-frame_ABCC1_ENST00000346370_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_1429aa
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLF
YSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRK
QPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQ
VILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFL
RTYASTEQEQDAEENVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRC
VMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKE
SDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTN
TVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTM
DRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCG
TPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERD

>In-frame_ABCC1_ENST00000346370_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_1431aa
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLF
YSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRK
QPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQ
VILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFL
RTYASTEQEQDAEENVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRC
VMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKE
SDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTN
TVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTM
DRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCG
TPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ABCC1_ENST00000399410_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_4455nt
ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACC
AAGTGCTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACAT
GACCGAGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTC
TACTCTTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCT
ACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTA
GCCATCCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCC
CTCTTACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAG
TCCAGCGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGAC
CTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAG
CAGCCGGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTG
ATCGTCAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTC
TTCAAGGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGAC
TGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTC
AGTGGCATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAA
GTCATCCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAAT
GCTGTGATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAAT
GGGATCAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAG
AAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACC
ATTGACGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCC
ATGGTCATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATC
GAGCGACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACA
CTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCC
CTCTTGGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGAT
TCTCTCCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTG
GAAATCCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGG
GCCGTGTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTG
ATTGGCCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTC
ATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCC
AGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCT
GGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCAC
TGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTT
CCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTA
AGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAG
AGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGAC
AGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAG
AAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCC
AATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAA
TTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATG
CTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACT
ATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTAC
TTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCT
GCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAG
GGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTAC
ATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGG
CAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAA
GCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCAT
GCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTAGAGACAAGAGAGACACC
TCCAACTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAATTT

>In-frame_ABCC1_ENST00000399410_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_4461nt
ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACC
AAGTGCTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACAT
GACCGAGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTC
TACTCTTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCT
ACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTA
GCCATCCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCC
CTCTTACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAG
TCCAGCGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGAC
CTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAG
CAGCCGGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTG
ATCGTCAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTC
TTCAAGGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGAC
TGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTC
AGTGGCATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAA
GTCATCCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAAT
GCTGTGATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAAT
GGGATCAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAG
AAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACC
ATTGACGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCC
ATGGTCATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATC
GAGCGACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACA
CTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCC
CTCTTGGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGAT
TCTCTCCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTG
GAAATCCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGG
GCCGTGTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTG
ATTGGCCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTC
ATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCC
AGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCT
GGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCAC
TGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTT
CCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTA
AGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAG
AGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGAC
AGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAG
AAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCC
AATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAA
TTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATG
CTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACT
ATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTAC
TTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCT
GCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAG
GGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTAC
ATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGG
CAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAA
GCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCAT
GCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTTGTGGGCGAAATGCTGAA
AACTTCGACCGATTTTTCACCCGCCATCCACCAGTCCTAACACCTCCCGACCAGGAAGTCATCAGGAATATTGACCAATCAGAATTCGAA

>In-frame_ABCC1_ENST00000349029_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_4110nt
ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACC
AAGTGCTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACAT
GACCGAGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTC
TACTCTTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCT
ACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTA
GCCATCCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCC
CTCTTACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAG
TCCAGCGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGAC
CTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAG
CAGCCGGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTG
ATCGTCAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTC
TTCAAGGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGAC
TGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTC
AGTGGCATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAA
GTCATCCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAAT
GCTGTGATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAAT
GGGATCAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAG
AAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACC
ATTGACGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCC
ATGGTCATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATC
GAGCGACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACA
CTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCC
CTCTTGGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTG
GACGTCATCATCGTCATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTC
CTGCGTACCTATGCCAGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTC
ACATTCTCCTGCCCTGGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCC
ACGTTTTGTGACCACTGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGC
TGCGTGATGAATGTTCCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTC
CTCATTGTCCTCGTAAGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCC
GATCCCAAAAGTGAGAGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAA
GAATCGGACAAAGACAGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGG
ATTTCTGAACTTCAGAAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCA
GAAGGAAGTGAGGCCAATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACC
AACACTGTCTCCAAATTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGC
TTTGGCAAGGTCATGCTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGAT
GACGTGGAGTGCACTATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACC
ATGGACCGCCTGTACTTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCAT
GCTGTATTTTACGCTGCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTG
ATGCTCGATTCTGAGGGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGT
GGCACTCCAGACTACATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTAT
GAAATGTTGGCTGGGCAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAG
TCTATGTCCAAGGAAGCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGT
GATATCAAAGAGCATGCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTAGA
GACAAGAGAGACACCTCCAACTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTG

>In-frame_ABCC1_ENST00000349029_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_4116nt
ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACC
AAGTGCTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACAT
GACCGAGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTC
TACTCTTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCT
ACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTA
GCCATCCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCC
CTCTTACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAG
TCCAGCGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGAC
CTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAG
CAGCCGGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTG
ATCGTCAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTC
TTCAAGGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGAC
TGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTC
AGTGGCATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAA
GTCATCCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAAT
GCTGTGATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAAT
GGGATCAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAG
AAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACC
ATTGACGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCC
ATGGTCATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATC
GAGCGACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACA
CTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCC
CTCTTGGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTG
GACGTCATCATCGTCATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTC
CTGCGTACCTATGCCAGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTC
ACATTCTCCTGCCCTGGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCC
ACGTTTTGTGACCACTGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGC
TGCGTGATGAATGTTCCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTC
CTCATTGTCCTCGTAAGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCC
GATCCCAAAAGTGAGAGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAA
GAATCGGACAAAGACAGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGG
ATTTCTGAACTTCAGAAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCA
GAAGGAAGTGAGGCCAATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACC
AACACTGTCTCCAAATTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGC
TTTGGCAAGGTCATGCTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGAT
GACGTGGAGTGCACTATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACC
ATGGACCGCCTGTACTTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCAT
GCTGTATTTTACGCTGCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTG
ATGCTCGATTCTGAGGGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGT
GGCACTCCAGACTACATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTAT
GAAATGTTGGCTGGGCAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAG
TCTATGTCCAAGGAAGCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGT
GATATCAAAGAGCATGCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTTGT
GGGCGAAATGCTGAAAACTTCGACCGATTTTTCACCCGCCATCCACCAGTCCTAACACCTCCCGACCAGGAAGTCATCAGGAATATTGAC

>In-frame_ABCC1_ENST00000351154_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_4278nt
ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACC
AAGTGCTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACAT
GACCGAGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTC
TACTCTTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCT
ACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTA
GCCATCCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCC
CTCTTACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAG
TCCAGCGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGAC
CTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAG
CAGCCGGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTG
ATCGTCAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTC
TTCAAGGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGAC
TGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTC
AGTGGCATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAA
GTCATCCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAAT
GCTGTGATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAAT
GGGATCAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAG
AAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACC
ATTGACGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCC
ATGGTCATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATC
GAGCGACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACA
CTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCC
CTCTTGGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCC
CGGGCCGTGTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAAT
GTGATTGGCCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATC
GTCATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTAT
GCCAGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGC
CCTGGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGAC
CACTGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAAT
GTTCCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTC
GTAAGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGT
GAGAGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAA
GACAGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTT
CAGAAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAG
GCCAATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCC
AAATTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTC
ATGCTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGC
ACTATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTG
TACTTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTAC
GCTGCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCT
GAGGGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGAC
TACATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCT
GGGCAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAG
GAAGCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAG
CATGCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTAGAGACAAGAGAGAC
ACCTCCAACTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAA

>In-frame_ABCC1_ENST00000351154_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_4284nt
ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACC
AAGTGCTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACAT
GACCGAGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTC
TACTCTTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCT
ACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTA
GCCATCCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCC
CTCTTACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAG
TCCAGCGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGAC
CTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAG
CAGCCGGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTG
ATCGTCAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTC
TTCAAGGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGAC
TGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTC
AGTGGCATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAA
GTCATCCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAAT
GCTGTGATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAAT
GGGATCAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAG
AAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACC
ATTGACGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCC
ATGGTCATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATC
GAGCGACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACA
CTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCC
CTCTTGGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCC
CGGGCCGTGTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAAT
GTGATTGGCCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATC
GTCATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTAT
GCCAGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGC
CCTGGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGAC
CACTGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAAT
GTTCCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTC
GTAAGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGT
GAGAGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAA
GACAGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTT
CAGAAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAG
GCCAATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCC
AAATTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTC
ATGCTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGC
ACTATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTG
TACTTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTAC
GCTGCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCT
GAGGGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGAC
TACATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCT
GGGCAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAG
GAAGCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAG
CATGCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTTGTGGGCGAAATGCT
GAAAACTTCGACCGATTTTTCACCCGCCATCCACCAGTCCTAACACCTCCCGACCAGGAAGTCATCAGGAATATTGACCAATCAGAATTC

>In-frame_ABCC1_ENST00000399408_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_4455nt
ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACC
AAGTGCTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACAT
GACCGAGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTC
TACTCTTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCT
ACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTA
GCCATCCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCC
CTCTTACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAG
TCCAGCGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGAC
CTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAG
CAGCCGGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTG
ATCGTCAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTC
TTCAAGGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGAC
TGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTC
AGTGGCATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAA
GTCATCCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAAT
GCTGTGATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAAT
GGGATCAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAG
AAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACC
ATTGACGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCC
ATGGTCATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATC
GAGCGACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACA
CTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCC
CTCTTGGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGAT
TCTCTCCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTG
GAAATCCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGG
GCCGTGTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTG
ATTGGCCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTC
ATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCC
AGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCT
GGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCAC
TGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTT
CCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTA
AGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAG
AGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGAC
AGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAG
AAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCC
AATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAA
TTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATG
CTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACT
ATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTAC
TTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCT
GCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAG
GGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTAC
ATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGG
CAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAA
GCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCAT
GCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTAGAGACAAGAGAGACACC
TCCAACTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAATTT

>In-frame_ABCC1_ENST00000399408_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_4461nt
ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACC
AAGTGCTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACAT
GACCGAGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTC
TACTCTTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCT
ACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTA
GCCATCCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCC
CTCTTACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAG
TCCAGCGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGAC
CTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAG
CAGCCGGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTG
ATCGTCAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTC
TTCAAGGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGAC
TGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTC
AGTGGCATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAA
GTCATCCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAAT
GCTGTGATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAAT
GGGATCAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAG
AAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACC
ATTGACGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCC
ATGGTCATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATC
GAGCGACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACA
CTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCC
CTCTTGGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGAT
TCTCTCCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTG
GAAATCCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGG
GCCGTGTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTG
ATTGGCCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTC
ATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCC
AGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCT
GGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCAC
TGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTT
CCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTA
AGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAG
AGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGAC
AGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAG
AAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCC
AATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAA
TTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATG
CTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACT
ATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTAC
TTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCT
GCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAG
GGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTAC
ATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGG
CAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAA
GCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCAT
GCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTTGTGGGCGAAATGCTGAA
AACTTCGACCGATTTTTCACCCGCCATCCACCAGTCCTAACACCTCCCGACCAGGAAGTCATCAGGAATATTGACCAATCAGAATTCGAA

>In-frame_ABCC1_ENST00000345148_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_4455nt
ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACC
AAGTGCTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACAT
GACCGAGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTC
TACTCTTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCT
ACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTA
GCCATCCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCC
CTCTTACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAG
TCCAGCGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGAC
CTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAG
CAGCCGGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTG
ATCGTCAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTC
TTCAAGGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGAC
TGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTC
AGTGGCATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAA
GTCATCCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAAT
GCTGTGATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAAT
GGGATCAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAG
AAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACC
ATTGACGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCC
ATGGTCATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATC
GAGCGACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACA
CTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCC
CTCTTGGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGAT
TCTCTCCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTG
GAAATCCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGG
GCCGTGTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTG
ATTGGCCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTC
ATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCC
AGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCT
GGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCAC
TGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTT
CCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTA
AGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAG
AGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGAC
AGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAG
AAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCC
AATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAA
TTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATG
CTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACT
ATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTAC
TTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCT
GCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAG
GGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTAC
ATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGG
CAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAA
GCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCAT
GCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTAGAGACAAGAGAGACACC
TCCAACTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAATTT

>In-frame_ABCC1_ENST00000345148_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_4461nt
ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACC
AAGTGCTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACAT
GACCGAGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTC
TACTCTTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCT
ACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTA
GCCATCCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCC
CTCTTACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAG
TCCAGCGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGAC
CTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAG
CAGCCGGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTG
ATCGTCAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTC
TTCAAGGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGAC
TGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTC
AGTGGCATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAA
GTCATCCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAAT
GCTGTGATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAAT
GGGATCAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAG
AAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACC
ATTGACGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCC
ATGGTCATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATC
GAGCGACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACA
CTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCC
CTCTTGGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGAT
TCTCTCCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTG
GAAATCCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGG
GCCGTGTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTG
ATTGGCCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTC
ATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCC
AGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCT
GGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCAC
TGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTT
CCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTA
AGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAG
AGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGAC
AGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAG
AAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCC
AATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAA
TTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATG
CTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACT
ATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTAC
TTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCT
GCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAG
GGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTAC
ATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGG
CAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAA
GCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCAT
GCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTTGTGGGCGAAATGCTGAA
AACTTCGACCGATTTTTCACCCGCCATCCACCAGTCCTAACACCTCCCGACCAGGAAGTCATCAGGAATATTGACCAATCAGAATTCGAA

>In-frame_ABCC1_ENST00000346370_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_4287nt
ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACC
AAGTGCTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACAT
GACCGAGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTC
TACTCTTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCT
ACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTA
GCCATCCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCC
CTCTTACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAG
TCCAGCGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGAC
CTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAG
CAGCCGGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTG
ATCGTCAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTC
TTCAAGGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGAC
TGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTC
AGTGGCATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAA
GTCATCCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAAT
GCTGTGATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAAT
GGGATCAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAG
AAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACC
ATTGACGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCC
ATGGTCATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATC
GAGCGACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACA
CTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCC
CTCTTGGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGAT
TCTCTCCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTG
GAAATCCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGAC
GTCATCATCGTCATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTG
CGTACCTATGCCAGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACA
TTCTCCTGCCCTGGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACG
TTTTGTGACCACTGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGC
GTGATGAATGTTCCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTC
ATTGTCCTCGTAAGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGAT
CCCAAAAGTGAGAGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAA
TCGGACAAAGACAGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATT
TCTGAACTTCAGAAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAA
GGAAGTGAGGCCAATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAAC
ACTGTCTCCAAATTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTT
GGCAAGGTCATGCTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGAC
GTGGAGTGCACTATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATG
GACCGCCTGTACTTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCT
GTATTTTACGCTGCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATG
CTCGATTCTGAGGGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGC
ACTCCAGACTACATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAA
ATGTTGGCTGGGCAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCT
ATGTCCAAGGAAGCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGAT
ATCAAAGAGCATGCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTAGAGAC
AAGAGAGACACCTCCAACTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGAC

>In-frame_ABCC1_ENST00000346370_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_4293nt
ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACC
AAGTGCTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACAT
GACCGAGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTC
TACTCTTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCT
ACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTA
GCCATCCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCC
CTCTTACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAG
TCCAGCGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGAC
CTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAG
CAGCCGGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTG
ATCGTCAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTC
TTCAAGGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGAC
TGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTC
AGTGGCATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAA
GTCATCCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAAT
GCTGTGATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAAT
GGGATCAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAG
AAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACC
ATTGACGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCC
ATGGTCATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATC
GAGCGACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACA
CTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCC
CTCTTGGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGAT
TCTCTCCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTG
GAAATCCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGAC
GTCATCATCGTCATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTG
CGTACCTATGCCAGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACA
TTCTCCTGCCCTGGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACG
TTTTGTGACCACTGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGC
GTGATGAATGTTCCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTC
ATTGTCCTCGTAAGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGAT
CCCAAAAGTGAGAGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAA
TCGGACAAAGACAGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATT
TCTGAACTTCAGAAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAA
GGAAGTGAGGCCAATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAAC
ACTGTCTCCAAATTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTT
GGCAAGGTCATGCTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGAC
GTGGAGTGCACTATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATG
GACCGCCTGTACTTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCT
GTATTTTACGCTGCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATG
CTCGATTCTGAGGGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGC
ACTCCAGACTACATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAA
ATGTTGGCTGGGCAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCT
ATGTCCAAGGAAGCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGAT
ATCAAAGAGCATGCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTTGTGGG
CGAAATGCTGAAAACTTCGACCGATTTTTCACCCGCCATCCACCAGTCCTAACACCTCCCGACCAGGAAGTCATCAGGAATATTGACCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ABCC1_ENST00000399410_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_5128nt
CCAGGCGGCGTTGCGGCCCCGGCCCCGGCTCCCTGCGCCGCCGCCGCCGCCGCCGCCAGCGCTAGCGCCAGCAGCCGGGCCCGATCACCC
GCCGCCCGGTGCCCGCCGCCGCCCGCGCCAGCAACCGGGCCCGATCACCCGCCGCCCGGTGCCCGCCGCCGCCCGCGCCACCGGCATGGC
GCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACCAAGTG
CTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACATGACCG
AGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTC
TTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCTACCTT
TTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCAT
CCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCCCTCTT
ACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAGTCCAG
CGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGACCTCTG
GTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCC
GGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTGATCGT
CAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTCTTCAA
GGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGACTGGCA
GGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTCAGTGG
CATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTCGGGGA
GATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAAGTCAT
CCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAATGCTGT
GATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAATGGGAT
CAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAGAAGTC
TGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACCATTGA
CGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCCATGGT
CATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATCGAGCG
ACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACACTGAA
TGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTT
GGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGATTCTCT
CCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTGGAAAT
CCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGGGCCGT
GTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTGATTGG
CCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTCATGAG
TGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCCAGCAC
AGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCTGGCGC
TGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCACTGTGG
GTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTTCCCAG
CCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTAAGAGA
TGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAGAGCAA
ACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGACAGAAG
ACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAGAAAGC
CAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCCAATGA
AGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAATTTGA
CAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATGCTTTC
AGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACTATGGT
GGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTACTTTGT
GATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCTGCAGA
AATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAGGGACA
CATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTACATCGC
CCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGGCAGGC
ACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAAGCTGT
GGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCATGCATT
TTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTAGAGACAAGAGAGACACCTCCAA
CTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAATTTGCTGG
CTTCTCTTATACTAACCCAGAGTTTGTCATTAATGTGTAGGTGAATGCAAACTCCATCGTTGAGCCTGGGGTGTAAGACTTCAAGCCAAG
CGTATGTATCAATTCTAGTCTTCCAGGATTCACGGTGCACATGCTGGCATTCAACATGTGGAAAGCTTGTCTTAGAGGGCTTTTCTTTGT
ATGTGTAGCTTGCTAGTTTGTTTTCTACATTTGAAAATGTTTAGTTTAGAATAAGCGCATTATCCAATTATAGAGGTACAATTTTCCAAA
CTTCCAGAAACTCATCAAATGAACAGACAATGTCAAAACTACTGTGTCTGATACCAAAATGCTTCAGTATTTGTAATTTTTCAAGTCAGA
AGCTGATGTTCCTGGTAAAAGTTTTTACAGTTATTCTATAATATCTTCTTTGAATGCTAAGCATGAGCGATATTTTTAAAAATTGTGAGT

>In-frame_ABCC1_ENST00000399410_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_10431nt
CCAGGCGGCGTTGCGGCCCCGGCCCCGGCTCCCTGCGCCGCCGCCGCCGCCGCCGCCAGCGCTAGCGCCAGCAGCCGGGCCCGATCACCC
GCCGCCCGGTGCCCGCCGCCGCCCGCGCCAGCAACCGGGCCCGATCACCCGCCGCCCGGTGCCCGCCGCCGCCCGCGCCACCGGCATGGC
GCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACCAAGTG
CTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACATGACCG
AGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTC
TTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCTACCTT
TTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCAT
CCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCCCTCTT
ACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAGTCCAG
CGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGACCTCTG
GTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCC
GGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTGATCGT
CAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTCTTCAA
GGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGACTGGCA
GGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTCAGTGG
CATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTCGGGGA
GATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAAGTCAT
CCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAATGCTGT
GATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAATGGGAT
CAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAGAAGTC
TGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACCATTGA
CGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCCATGGT
CATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATCGAGCG
ACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACACTGAA
TGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTT
GGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGATTCTCT
CCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTGGAAAT
CCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGGGCCGT
GTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTGATTGG
CCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTCATGAG
TGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCCAGCAC
AGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCTGGCGC
TGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCACTGTGG
GTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTTCCCAG
CCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTAAGAGA
TGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAGAGCAA
ACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGACAGAAG
ACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAGAAAGC
CAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCCAATGA
AGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAATTTGA
CAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATGCTTTC
AGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACTATGGT
GGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTACTTTGT
GATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCTGCAGA
AATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAGGGACA
CATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTACATCGC
CCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGGCAGGC
ACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAAGCTGT
GGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCATGCATT
TTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTTGTGGGCGAAATGCTGAAAACTT
CGACCGATTTTTCACCCGCCATCCACCAGTCCTAACACCTCCCGACCAGGAAGTCATCAGGAATATTGACCAATCAGAATTCGAAGGATT
TTCCTTTGTTAACTCTGAATTTTTAAAACCCGAAGTCAAGAGCTAAGTAGATGTGTAGATCTCCGTCCTTCATTTCTGTCATTCAAGCTC
AACGGCTATTGTGGTGACATTTTTATGTTTTTCATTGCCAAGTTGCATCCATGTTTGATTTTCTGATGAGACTAGAGTGACAGTGTTTCA
GAACCCAAATGTCCTCAGGTAGTTTGGAGCATCTCTATGAGATGGGATTATGCAGATGGCCTATGGAAAATGCAGCTGCATAATTAACAC
ATTATCAAAGTCCTCTTACAATTTATTTTCCGCAGCATGTCAGCTAAGTAGACCCAATGGGGAGAGAAAATGCCTGCTTTCTTTCCCTCT
TTTTCTGCACTGCCATATTCACCCCCAACCATCCAATCTGTGGATAATTGGATGTTAGCGGTACTCTTCCACTTCCGGGCCTGGAGCTTG
GCTTGTATCCAAGTGTATGGTTGCTTTGCCTAAGAGGAATCCCTCTATTTCACCTGTTCTGGAGGCACCAGACCTTGAAAAGAACATGCT
CAAAATAAAATGTTATCTGTTATTTTTGTAAACTCAAAGTTAAGATGATCAAAGTTCTAAAATTCCAAGAATGTGCTTTTAGACGGTCTC
AATCTAAAAGCACTTCAAGGGGTCAAAGGGCAACCAGCTTGGGTGCTACCTCAGTGTTGTAGTTTCTGATACTTTATGTCTTTGCTCACC
CTCATCCCCAAACTACTTGAAAAGGGCATTTGGCACCACTCTCTGAAACAACACAGTCACTCTAGCAAGGCCCCCAAAGGGCCCTGGTTT
TACATTACATTTCAAACTTTATTTGCTTTGGGGTTTTGTTTCTGTTGTTGTTCAAATGCAAAAAAAAGAAAAAAAAAGAAAAAAAAAGGT
GACTCACATTGTTACACATGCTTTAAAATATGTATTCAAATGTTATTAACCACAATGACGACCTGCTTTGATTTAACCAAGAAGACGGCT
GCGGAGCCTAGCAGACTCAGGCCTGTGGGAATGGGATTTGTTACAAATCTAGGTTTGTTACTGGCTTCAGAAAGCTAATTAAGTGCTCTG
AAAAAGACACCGTTTCTTGAAACAAAGATGGTTGTATTCCTCACTTTGATGTTGTTTTGCAAGATGTTTGTGGAAATGTTCATTTGTATC
TGGATCTCTGTTATGTGCCATTTTTCTTCTAGCATCGAGATACAATAAAAAAAAAAAAAAAGAAAAGAAGAAGAAATACTATTTCAAGGA
AAACTGCTCTTTTTGAGAAACGTGGACCTAAACTACAAAGTGGGAACTGAGGAGGGAACTCAGGAGAAAGGAACTAACTGCGGAGCTTTA
ATCTTGGCCCCAGTGTTCAGCCACTCGGAGGGGCGGGGGCTGTGGCCCATTCAGGGGCTGCTGGTGGGCTGTAGTGGGGTGGGATGACCT
GGCCAGAGCCAACGAGGATACTGGAGCCCAAAGTCAAGTTTAGAGACCAGCTGGGAACGTGAATGGGGCTCTTGATTTTCTTATCAAAAT
CACCACTCCTCCCAGCTTGGACTAAATATTCTTTCTAGCAAGCAGCTTTGTGAGCTCCCTGAAGCCCAAGGAAACCCTTCGGTGGGAGAA
ATTTCATTTCTGTCTGAGAGGATTAAGGCAGCAGGTGACTCCCCCTCCTCGCCTGCCGTGTCCTGCTATTCTCAGGCAGCTCTAAGGAGA
ATTCTTATCACAGTTCAAGTGATTTCCAGAAGTTCCAGGGCTTCTGAGAGACCATCAAGGGAACTTTAACAACTTGACAAATGTCCTTGA
AGTAAGATGCCTCATCTTTAGGGAAAAATGGGGTTTGGATTTCTGCTTAGGCAAAGTCTCCTGCAGTTCATCCTTCTCTGTCCTCTTCTT
GCTTCAGGCTTGGGGACCGTCCCTGCTGTCCCCACTGTGGTGGCAATCAGGACCTAAGGTGAAGCAAACTTGAAGTTCTATCTGACAAGT
TTAGGCAGTAAGAGAAGGAGGGAAATCGGAGCAAAGCTCCCTCACTTTATTGTTGAGAAACTGGCATCTGGAAAGAGGAAGGAATTTGCC
CAAAGTCAGTCAGCTGGGATAAAAACCTGGGTGTCCTGTCCAGAAAGTGCAGGGTGCTTTCTGCTCTGTAGCAAGGCAGCAGACATCTCT
GAGCCAGGCCCACCAACAGGCCCTTATCTGGTGGTTGGATCATGATCCCATTTTGCTTGGACATGCTCTCAGGAAGATAAAAACCATGGA
GAAACACTAGGCCATTGACAAATGATCTGAGACAACTTTAGAAAACAATGTAGGATGAATGGAAAGAGAAAGAAAGGAAAGAAAGAAGAA
AAAGAAAGAAGGAAAGAAAGAAAGAGAAAGGAAGGAAGGAAAGAAGGAAGGAAAAGAAGGAAGGAAGGAAGGAATATAGTGTTATAAATA
CTGCACTCAACATTTTCCAAATTCTTGCCATTATTTTTCAAAAGTTTAATAGTTTGCAGAAATAGATACTCAAGCCAAAGTCTGTTTTAG
AGAAACTTTCCATGGAAAGTCAGAATTTCTACCACTTCCTTTTCTATCCACATTTCCAGTGCAGAAGAAACTGAGAAACAGAGCTTTTTG
AAGAGAGGACAGGGCCATAGCAACAAGGACCTTCTTGGGGGATTAATGGGAGGTCAGTAGAATTAATAACCCTCCTTGGATGAGTGCTAC
TGTTTTCACATGGCTTCAGATGCTATCAACCTCAAAGAAATGATCTCAACAGAGAAGCTTATTCTCTCCCAACTTCTACGGTAAAATCCA
GGAGTATTTTCTCTGGGGATCTGCCCACAGGACAAAGTCCATAAAAGCAAGTCCTGTCTGGACCATGTGGTTATCTGAAGCATTAGCCAT
CACCAGCACAACAAACGGGGCAGGGCTTTCCAAGGTGGGGCTGGTCAGAAGGGAATCTTTGATAAGAGGCCCACAGGCAGGGAAAGCGAA
ATAGGGTTGATGAGACCAGGGGAGACCTAAAAAAAAGGCAGCTTTGTGTCTTCTAGCTCCAAATATACCTGCCTTTTAGCTCACACACTG
TCCTGGAGTTCTCAGACCTTTAGGGGCCCTAACACAGTTCAGTTCATACAGGGGTTCAAAAGGGACAGTGGCCCATTTGGGAGACCTTTA
GGATCAATGGGAATCAATTCCATTGTTTTGCCTCAGAGTAAAGTTTCTGGCTCGGGGACAATTATAAGTTGCAAAAAGGATAGAGGCATA
TCCCAAGTCTTCCTTCATTCCACAAATAATTACAAACAACCTACTGTGTGCCAGGCACTATTCTTAGCACTGGAAATACACTAGTGAAGA
AGCAGATGAGGACCCTGTTTATTGTTTCTCTCCAAGAAATTCTCCAAGAATATTGTTTCTTGGAGAGAAATAATAAATAAACAAGACAAT
TTCTGAAAGCAATAAGTGCAATCAAGATAATTAAAGGATGCTAAAGTGTGACTTGTGGGGATTGGGAGAGAGATGCACAGACAATATTAA
AGAGGAGGCATTCGAGCTTTGTTGTGAACACCGGAAGTAACATGCCGAGCGCCTGGGGGATGGAAACTCCTATAGCACCCCACAGGCTAA
CAGCAAGCAGGACAAGACAAAAAGGGCAGGTGGGACATGGTAGAGATGGACCCTACCCAGGAAACAGCTCCATCAGCATCTTAGCCTGCC
CCACTCTAGCCACACATACCCACGTGTGCTCCTGAGTTCAGTGTGCCCACCTCACTCCCACACCCTCACATAGACTTGGCAAGAGTAAGG
AGGGAACTCCATAGAGACATTTTACCTATCTCAGGGGAGCAGCCACAAAGAAGCAAGTCTTGTAAAAGGTCTTTTGCAAAGGAGAGTGAA
CCCAGCAATGAGAGATCCTTAACAGCTAGTGCCCATTAGGGGGCTAAACCTAAAGCCTGGGTGGTGATGGCTCAAACGCTAATGAGTCAG
TGAATCCTTACCGACCCCCTGGCCTTTATAATCTGAGGCAACTTTGGCTGCAGCCCGGGAATGTGCAGGGCACTAGGGAATACAAGGCCT
TCTTCCCTGGTTGTCTTGTAATAAAACAGCCATGGGGTTGTCCCTCCAGTCCGAGAGACTGTGATGAGGCCTACATAGCAGCGATGTGGT
CAGGTAAAAATCAGGAACCCACTGAAATCTTGGGCAAGCCACCCTGCCTGCTTGTGCCTCGGTTCTCTCATATGTCATATATAGGAGGTG
AGGACTCCAGCTCCACCTGCCCCAGGTGGGTGTGGTGATGATGAGGAAAGACAAGAGGCTTGCAAGGACCCTGAAGAGGTCGGAGCATCA
TACAGATTCCTTTATTAGCCCACATTCTGATGTTCCCTGGTGAGACTTGCCCCAAGCAATTGCTAGTAAATGGGGGTTAATTTCTTCTCC
ACCTCCCTACTGAACAAAAAAAGAAATGCCAGACTTACTAGGAGAATCGAGTTGCTTTGAGTTTCTTTTGTTTTGTTTTGTTTTGTTTTG
TTTTAAGGCTCCCCTTACACACCCTCCTTTAAGCTTTGGGTTTTCTCTCTTATAGTTTGTTGACACATGCTAAAAATGTCTTTGGAGAGA
ACTTCTGCCTGATAAACACCCAATTCTAGACTGTGGGTGGATTTTCGAGCTGACGGTGGTCAATTCCTTTCATTAAGCAGTGATCTGATT
TCTCCACATGGCCATTCTGCCTTCTTGGGGGCAGAGTAGATGGGCAGCAGTTCACCTTTTCAGAGAAAGAGGTCTTCTAGCCACCTGGGC
TGCTACTGAATGGTTTTCTCCAGGACGCTCTACCTAATGATTATTTCTATAACATTAAGCATGGTAATAAGTAGCTTCCAATTCAATTCA
TCCTAAAGCCAAAGAAAATACAGCAACACACACACACACACACACACACACACACACACACACACACACACACCACTTTATGGCAATTCT
TAACTGACATTCAATGACTTACTTCTTTTCTTAGAAAATTTCCACCACATTTCTATCCCCAAGCCAACATACAATGTGAAATGAAAGCCA
GTGCGTGGAGTGCAGCTGCTAAAAATTTTCAGCACAGGGCTCTTTCTGACTCTGCTCATGAGATGGTATCAGCCACCCAATGACTGGCGT
ATCTTGGTCCTGTGTCTTTCTTCTTACGCTGTGTTAATGTGTTTACTTTCCATTTGGCAGAGAGACAAGAGAGACACCTCCAACTTCGAC
AAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAATTTGCTGGCTTCTCT
TATACTAACCCAGAGTTTGTCATTAATGTGTAGGTGAATGCAAACTCCATCGTTGAGCCTGGGGTGTAAGACTTCAAGCCAAGCGTATGT
ATCAATTCTAGTCTTCCAGGATTCACGGTGCACATGCTGGCATTCAACATGTGGAAAGCTTGTCTTAGAGGGCTTTTCTTTGTATGTGTA
GCTTGCTAGTTTGTTTTCTACATTTGAAAATGTTTAGTTTAGAATAAGCGCATTATCCAATTATAGAGGTACAATTTTCCAAACTTCCAG
AAACTCATCAAATGAACAGACAATGTCAAAACTACTGTGTCTGATACCAAAATGCTTCAGTATTTGTAATTTTTCAAGTCAGAAGCTGAT
GTTCCTGGTAAAAGTTTTTACAGTTATTCTATAATATCTTCTTTGAATGCTAAGCATGAGCGATATTTTTAAAAATTGTGAGTAAGCTTT

>In-frame_ABCC1_ENST00000349029_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_4783nt
CCAGGCGGCGTTGCGGCCCCGGCCCCGGCTCCCTGCGCCGCCGCCGCCGCCGCCGCCAGCGCTAGCGCCAGCAGCCGGGCCCGATCACCC
GCCGCCCGGTGCCCGCCGCCGCCCGCGCCAGCAACCGGGCCCGATCACCCGCCGCCCGGTGCCCGCCGCCGCCCGCGCCACCGGCATGGC
GCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACCAAGTG
CTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACATGACCG
AGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTC
TTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCTACCTT
TTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCAT
CCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCCCTCTT
ACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAGTCCAG
CGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGACCTCTG
GTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCC
GGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTGATCGT
CAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTCTTCAA
GGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGACTGGCA
GGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTCAGTGG
CATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTCGGGGA
GATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAAGTCAT
CCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAATGCTGT
GATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAATGGGAT
CAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAGAAGTC
TGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACCATTGA
CGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCCATGGT
CATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATCGAGCG
ACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACACTGAA
TGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTT
GGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGT
CATCATCGTCATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCG
TACCTATGCCAGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATT
CTCCTGCCCTGGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTT
TTGTGACCACTGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGT
GATGAATGTTCCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCAT
TGTCCTCGTAAGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCC
CAAAAGTGAGAGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATC
GGACAAAGACAGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTC
TGAACTTCAGAAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGG
AAGTGAGGCCAATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACAC
TGTCTCCAAATTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGG
CAAGGTCATGCTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGT
GGAGTGCACTATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGA
CCGCCTGTACTTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGT
ATTTTACGCTGCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCT
CGATTCTGAGGGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCAC
TCCAGACTACATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAAT
GTTGGCTGGGCAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTAT
GTCCAAGGAAGCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATAT
CAAAGAGCATGCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTAGAGACAA
GAGAGACACCTCCAACTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCA
AAATGAATTTGCTGGCTTCTCTTATACTAACCCAGAGTTTGTCATTAATGTGTAGGTGAATGCAAACTCCATCGTTGAGCCTGGGGTGTA
AGACTTCAAGCCAAGCGTATGTATCAATTCTAGTCTTCCAGGATTCACGGTGCACATGCTGGCATTCAACATGTGGAAAGCTTGTCTTAG
AGGGCTTTTCTTTGTATGTGTAGCTTGCTAGTTTGTTTTCTACATTTGAAAATGTTTAGTTTAGAATAAGCGCATTATCCAATTATAGAG
GTACAATTTTCCAAACTTCCAGAAACTCATCAAATGAACAGACAATGTCAAAACTACTGTGTCTGATACCAAAATGCTTCAGTATTTGTA
ATTTTTCAAGTCAGAAGCTGATGTTCCTGGTAAAAGTTTTTACAGTTATTCTATAATATCTTCTTTGAATGCTAAGCATGAGCGATATTT
TTAAAAATTGTGAGTAAGCTTTGCAGTTACTGTGAACTATTGTCTCTTGGAGGAAGTTTTTTGTTTAAGAATTGATATGATTAAACTGAA

>In-frame_ABCC1_ENST00000349029_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_10086nt
CCAGGCGGCGTTGCGGCCCCGGCCCCGGCTCCCTGCGCCGCCGCCGCCGCCGCCGCCAGCGCTAGCGCCAGCAGCCGGGCCCGATCACCC
GCCGCCCGGTGCCCGCCGCCGCCCGCGCCAGCAACCGGGCCCGATCACCCGCCGCCCGGTGCCCGCCGCCGCCCGCGCCACCGGCATGGC
GCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACCAAGTG
CTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACATGACCG
AGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTC
TTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCTACCTT
TTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCAT
CCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCCCTCTT
ACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAGTCCAG
CGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGACCTCTG
GTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCC
GGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTGATCGT
CAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTCTTCAA
GGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGACTGGCA
GGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTCAGTGG
CATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTCGGGGA
GATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAAGTCAT
CCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAATGCTGT
GATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAATGGGAT
CAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAGAAGTC
TGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACCATTGA
CGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCCATGGT
CATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATCGAGCG
ACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACACTGAA
TGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTT
GGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGT
CATCATCGTCATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCG
TACCTATGCCAGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATT
CTCCTGCCCTGGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTT
TTGTGACCACTGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGT
GATGAATGTTCCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCAT
TGTCCTCGTAAGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCC
CAAAAGTGAGAGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATC
GGACAAAGACAGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTC
TGAACTTCAGAAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGG
AAGTGAGGCCAATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACAC
TGTCTCCAAATTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGG
CAAGGTCATGCTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGT
GGAGTGCACTATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGA
CCGCCTGTACTTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGT
ATTTTACGCTGCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCT
CGATTCTGAGGGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCAC
TCCAGACTACATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAAT
GTTGGCTGGGCAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTAT
GTCCAAGGAAGCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATAT
CAAAGAGCATGCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTTGTGGGCG
AAATGCTGAAAACTTCGACCGATTTTTCACCCGCCATCCACCAGTCCTAACACCTCCCGACCAGGAAGTCATCAGGAATATTGACCAATC
AGAATTCGAAGGATTTTCCTTTGTTAACTCTGAATTTTTAAAACCCGAAGTCAAGAGCTAAGTAGATGTGTAGATCTCCGTCCTTCATTT
CTGTCATTCAAGCTCAACGGCTATTGTGGTGACATTTTTATGTTTTTCATTGCCAAGTTGCATCCATGTTTGATTTTCTGATGAGACTAG
AGTGACAGTGTTTCAGAACCCAAATGTCCTCAGGTAGTTTGGAGCATCTCTATGAGATGGGATTATGCAGATGGCCTATGGAAAATGCAG
CTGCATAATTAACACATTATCAAAGTCCTCTTACAATTTATTTTCCGCAGCATGTCAGCTAAGTAGACCCAATGGGGAGAGAAAATGCCT
GCTTTCTTTCCCTCTTTTTCTGCACTGCCATATTCACCCCCAACCATCCAATCTGTGGATAATTGGATGTTAGCGGTACTCTTCCACTTC
CGGGCCTGGAGCTTGGCTTGTATCCAAGTGTATGGTTGCTTTGCCTAAGAGGAATCCCTCTATTTCACCTGTTCTGGAGGCACCAGACCT
TGAAAAGAACATGCTCAAAATAAAATGTTATCTGTTATTTTTGTAAACTCAAAGTTAAGATGATCAAAGTTCTAAAATTCCAAGAATGTG
CTTTTAGACGGTCTCAATCTAAAAGCACTTCAAGGGGTCAAAGGGCAACCAGCTTGGGTGCTACCTCAGTGTTGTAGTTTCTGATACTTT
ATGTCTTTGCTCACCCTCATCCCCAAACTACTTGAAAAGGGCATTTGGCACCACTCTCTGAAACAACACAGTCACTCTAGCAAGGCCCCC
AAAGGGCCCTGGTTTTACATTACATTTCAAACTTTATTTGCTTTGGGGTTTTGTTTCTGTTGTTGTTCAAATGCAAAAAAAAGAAAAAAA
AAGAAAAAAAAAGGTGACTCACATTGTTACACATGCTTTAAAATATGTATTCAAATGTTATTAACCACAATGACGACCTGCTTTGATTTA
ACCAAGAAGACGGCTGCGGAGCCTAGCAGACTCAGGCCTGTGGGAATGGGATTTGTTACAAATCTAGGTTTGTTACTGGCTTCAGAAAGC
TAATTAAGTGCTCTGAAAAAGACACCGTTTCTTGAAACAAAGATGGTTGTATTCCTCACTTTGATGTTGTTTTGCAAGATGTTTGTGGAA
ATGTTCATTTGTATCTGGATCTCTGTTATGTGCCATTTTTCTTCTAGCATCGAGATACAATAAAAAAAAAAAAAAAGAAAAGAAGAAGAA
ATACTATTTCAAGGAAAACTGCTCTTTTTGAGAAACGTGGACCTAAACTACAAAGTGGGAACTGAGGAGGGAACTCAGGAGAAAGGAACT
AACTGCGGAGCTTTAATCTTGGCCCCAGTGTTCAGCCACTCGGAGGGGCGGGGGCTGTGGCCCATTCAGGGGCTGCTGGTGGGCTGTAGT
GGGGTGGGATGACCTGGCCAGAGCCAACGAGGATACTGGAGCCCAAAGTCAAGTTTAGAGACCAGCTGGGAACGTGAATGGGGCTCTTGA
TTTTCTTATCAAAATCACCACTCCTCCCAGCTTGGACTAAATATTCTTTCTAGCAAGCAGCTTTGTGAGCTCCCTGAAGCCCAAGGAAAC
CCTTCGGTGGGAGAAATTTCATTTCTGTCTGAGAGGATTAAGGCAGCAGGTGACTCCCCCTCCTCGCCTGCCGTGTCCTGCTATTCTCAG
GCAGCTCTAAGGAGAATTCTTATCACAGTTCAAGTGATTTCCAGAAGTTCCAGGGCTTCTGAGAGACCATCAAGGGAACTTTAACAACTT
GACAAATGTCCTTGAAGTAAGATGCCTCATCTTTAGGGAAAAATGGGGTTTGGATTTCTGCTTAGGCAAAGTCTCCTGCAGTTCATCCTT
CTCTGTCCTCTTCTTGCTTCAGGCTTGGGGACCGTCCCTGCTGTCCCCACTGTGGTGGCAATCAGGACCTAAGGTGAAGCAAACTTGAAG
TTCTATCTGACAAGTTTAGGCAGTAAGAGAAGGAGGGAAATCGGAGCAAAGCTCCCTCACTTTATTGTTGAGAAACTGGCATCTGGAAAG
AGGAAGGAATTTGCCCAAAGTCAGTCAGCTGGGATAAAAACCTGGGTGTCCTGTCCAGAAAGTGCAGGGTGCTTTCTGCTCTGTAGCAAG
GCAGCAGACATCTCTGAGCCAGGCCCACCAACAGGCCCTTATCTGGTGGTTGGATCATGATCCCATTTTGCTTGGACATGCTCTCAGGAA
GATAAAAACCATGGAGAAACACTAGGCCATTGACAAATGATCTGAGACAACTTTAGAAAACAATGTAGGATGAATGGAAAGAGAAAGAAA
GGAAAGAAAGAAGAAAAAGAAAGAAGGAAAGAAAGAAAGAGAAAGGAAGGAAGGAAAGAAGGAAGGAAAAGAAGGAAGGAAGGAAGGAAT
ATAGTGTTATAAATACTGCACTCAACATTTTCCAAATTCTTGCCATTATTTTTCAAAAGTTTAATAGTTTGCAGAAATAGATACTCAAGC
CAAAGTCTGTTTTAGAGAAACTTTCCATGGAAAGTCAGAATTTCTACCACTTCCTTTTCTATCCACATTTCCAGTGCAGAAGAAACTGAG
AAACAGAGCTTTTTGAAGAGAGGACAGGGCCATAGCAACAAGGACCTTCTTGGGGGATTAATGGGAGGTCAGTAGAATTAATAACCCTCC
TTGGATGAGTGCTACTGTTTTCACATGGCTTCAGATGCTATCAACCTCAAAGAAATGATCTCAACAGAGAAGCTTATTCTCTCCCAACTT
CTACGGTAAAATCCAGGAGTATTTTCTCTGGGGATCTGCCCACAGGACAAAGTCCATAAAAGCAAGTCCTGTCTGGACCATGTGGTTATC
TGAAGCATTAGCCATCACCAGCACAACAAACGGGGCAGGGCTTTCCAAGGTGGGGCTGGTCAGAAGGGAATCTTTGATAAGAGGCCCACA
GGCAGGGAAAGCGAAATAGGGTTGATGAGACCAGGGGAGACCTAAAAAAAAGGCAGCTTTGTGTCTTCTAGCTCCAAATATACCTGCCTT
TTAGCTCACACACTGTCCTGGAGTTCTCAGACCTTTAGGGGCCCTAACACAGTTCAGTTCATACAGGGGTTCAAAAGGGACAGTGGCCCA
TTTGGGAGACCTTTAGGATCAATGGGAATCAATTCCATTGTTTTGCCTCAGAGTAAAGTTTCTGGCTCGGGGACAATTATAAGTTGCAAA
AAGGATAGAGGCATATCCCAAGTCTTCCTTCATTCCACAAATAATTACAAACAACCTACTGTGTGCCAGGCACTATTCTTAGCACTGGAA
ATACACTAGTGAAGAAGCAGATGAGGACCCTGTTTATTGTTTCTCTCCAAGAAATTCTCCAAGAATATTGTTTCTTGGAGAGAAATAATA
AATAAACAAGACAATTTCTGAAAGCAATAAGTGCAATCAAGATAATTAAAGGATGCTAAAGTGTGACTTGTGGGGATTGGGAGAGAGATG
CACAGACAATATTAAAGAGGAGGCATTCGAGCTTTGTTGTGAACACCGGAAGTAACATGCCGAGCGCCTGGGGGATGGAAACTCCTATAG
CACCCCACAGGCTAACAGCAAGCAGGACAAGACAAAAAGGGCAGGTGGGACATGGTAGAGATGGACCCTACCCAGGAAACAGCTCCATCA
GCATCTTAGCCTGCCCCACTCTAGCCACACATACCCACGTGTGCTCCTGAGTTCAGTGTGCCCACCTCACTCCCACACCCTCACATAGAC
TTGGCAAGAGTAAGGAGGGAACTCCATAGAGACATTTTACCTATCTCAGGGGAGCAGCCACAAAGAAGCAAGTCTTGTAAAAGGTCTTTT
GCAAAGGAGAGTGAACCCAGCAATGAGAGATCCTTAACAGCTAGTGCCCATTAGGGGGCTAAACCTAAAGCCTGGGTGGTGATGGCTCAA
ACGCTAATGAGTCAGTGAATCCTTACCGACCCCCTGGCCTTTATAATCTGAGGCAACTTTGGCTGCAGCCCGGGAATGTGCAGGGCACTA
GGGAATACAAGGCCTTCTTCCCTGGTTGTCTTGTAATAAAACAGCCATGGGGTTGTCCCTCCAGTCCGAGAGACTGTGATGAGGCCTACA
TAGCAGCGATGTGGTCAGGTAAAAATCAGGAACCCACTGAAATCTTGGGCAAGCCACCCTGCCTGCTTGTGCCTCGGTTCTCTCATATGT
CATATATAGGAGGTGAGGACTCCAGCTCCACCTGCCCCAGGTGGGTGTGGTGATGATGAGGAAAGACAAGAGGCTTGCAAGGACCCTGAA
GAGGTCGGAGCATCATACAGATTCCTTTATTAGCCCACATTCTGATGTTCCCTGGTGAGACTTGCCCCAAGCAATTGCTAGTAAATGGGG
GTTAATTTCTTCTCCACCTCCCTACTGAACAAAAAAAGAAATGCCAGACTTACTAGGAGAATCGAGTTGCTTTGAGTTTCTTTTGTTTTG
TTTTGTTTTGTTTTGTTTTAAGGCTCCCCTTACACACCCTCCTTTAAGCTTTGGGTTTTCTCTCTTATAGTTTGTTGACACATGCTAAAA
ATGTCTTTGGAGAGAACTTCTGCCTGATAAACACCCAATTCTAGACTGTGGGTGGATTTTCGAGCTGACGGTGGTCAATTCCTTTCATTA
AGCAGTGATCTGATTTCTCCACATGGCCATTCTGCCTTCTTGGGGGCAGAGTAGATGGGCAGCAGTTCACCTTTTCAGAGAAAGAGGTCT
TCTAGCCACCTGGGCTGCTACTGAATGGTTTTCTCCAGGACGCTCTACCTAATGATTATTTCTATAACATTAAGCATGGTAATAAGTAGC
TTCCAATTCAATTCATCCTAAAGCCAAAGAAAATACAGCAACACACACACACACACACACACACACACACACACACACACACACACACCA
CTTTATGGCAATTCTTAACTGACATTCAATGACTTACTTCTTTTCTTAGAAAATTTCCACCACATTTCTATCCCCAAGCCAACATACAAT
GTGAAATGAAAGCCAGTGCGTGGAGTGCAGCTGCTAAAAATTTTCAGCACAGGGCTCTTTCTGACTCTGCTCATGAGATGGTATCAGCCA
CCCAATGACTGGCGTATCTTGGTCCTGTGTCTTTCTTCTTACGCTGTGTTAATGTGTTTACTTTCCATTTGGCAGAGAGACAAGAGAGAC
ACCTCCAACTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAA
TTTGCTGGCTTCTCTTATACTAACCCAGAGTTTGTCATTAATGTGTAGGTGAATGCAAACTCCATCGTTGAGCCTGGGGTGTAAGACTTC
AAGCCAAGCGTATGTATCAATTCTAGTCTTCCAGGATTCACGGTGCACATGCTGGCATTCAACATGTGGAAAGCTTGTCTTAGAGGGCTT
TTCTTTGTATGTGTAGCTTGCTAGTTTGTTTTCTACATTTGAAAATGTTTAGTTTAGAATAAGCGCATTATCCAATTATAGAGGTACAAT
TTTCCAAACTTCCAGAAACTCATCAAATGAACAGACAATGTCAAAACTACTGTGTCTGATACCAAAATGCTTCAGTATTTGTAATTTTTC
AAGTCAGAAGCTGATGTTCCTGGTAAAAGTTTTTACAGTTATTCTATAATATCTTCTTTGAATGCTAAGCATGAGCGATATTTTTAAAAA
TTGTGAGTAAGCTTTGCAGTTACTGTGAACTATTGTCTCTTGGAGGAAGTTTTTTGTTTAAGAATTGATATGATTAAACTGAATTAATAT

>In-frame_ABCC1_ENST00000351154_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_4951nt
CCAGGCGGCGTTGCGGCCCCGGCCCCGGCTCCCTGCGCCGCCGCCGCCGCCGCCGCCAGCGCTAGCGCCAGCAGCCGGGCCCGATCACCC
GCCGCCCGGTGCCCGCCGCCGCCCGCGCCAGCAACCGGGCCCGATCACCCGCCGCCCGGTGCCCGCCGCCGCCCGCGCCACCGGCATGGC
GCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACCAAGTG
CTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACATGACCG
AGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTC
TTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCTACCTT
TTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCAT
CCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCCCTCTT
ACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAGTCCAG
CGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGACCTCTG
GTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCC
GGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTGATCGT
CAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTCTTCAA
GGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGACTGGCA
GGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTCAGTGG
CATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTCGGGGA
GATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAAGTCAT
CCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAATGCTGT
GATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAATGGGAT
CAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAGAAGTC
TGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACCATTGA
CGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCCATGGT
CATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATCGAGCG
ACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACACTGAA
TGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTT
GGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGGGC
CGTGTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTGAT
TGGCCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTCAT
GAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCCAG
CACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCTGG
CGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCACTG
TGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTTCC
CAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTAAG
AGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAGAG
CAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGACAG
AAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAGAA
AGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCCAA
TGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAATT
TGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATGCT
TTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACTAT
GGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTACTT
TGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCTGC
AGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAGGG
ACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTACAT
CGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGGCA
GGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAAGC
TGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCATGC
ATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTAGAGACAAGAGAGACACCTC
CAACTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAATTTGC
TGGCTTCTCTTATACTAACCCAGAGTTTGTCATTAATGTGTAGGTGAATGCAAACTCCATCGTTGAGCCTGGGGTGTAAGACTTCAAGCC
AAGCGTATGTATCAATTCTAGTCTTCCAGGATTCACGGTGCACATGCTGGCATTCAACATGTGGAAAGCTTGTCTTAGAGGGCTTTTCTT
TGTATGTGTAGCTTGCTAGTTTGTTTTCTACATTTGAAAATGTTTAGTTTAGAATAAGCGCATTATCCAATTATAGAGGTACAATTTTCC
AAACTTCCAGAAACTCATCAAATGAACAGACAATGTCAAAACTACTGTGTCTGATACCAAAATGCTTCAGTATTTGTAATTTTTCAAGTC
AGAAGCTGATGTTCCTGGTAAAAGTTTTTACAGTTATTCTATAATATCTTCTTTGAATGCTAAGCATGAGCGATATTTTTAAAAATTGTG
AGTAAGCTTTGCAGTTACTGTGAACTATTGTCTCTTGGAGGAAGTTTTTTGTTTAAGAATTGATATGATTAAACTGAATTAATATATGCA

>In-frame_ABCC1_ENST00000351154_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_10254nt
CCAGGCGGCGTTGCGGCCCCGGCCCCGGCTCCCTGCGCCGCCGCCGCCGCCGCCGCCAGCGCTAGCGCCAGCAGCCGGGCCCGATCACCC
GCCGCCCGGTGCCCGCCGCCGCCCGCGCCAGCAACCGGGCCCGATCACCCGCCGCCCGGTGCCCGCCGCCGCCCGCGCCACCGGCATGGC
GCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACCAAGTG
CTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACATGACCG
AGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTC
TTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCTACCTT
TTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCAT
CCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCCCTCTT
ACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAGTCCAG
CGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGACCTCTG
GTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCC
GGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTGATCGT
CAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTCTTCAA
GGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGACTGGCA
GGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTCAGTGG
CATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTCGGGGA
GATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAAGTCAT
CCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAATGCTGT
GATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAATGGGAT
CAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAGAAGTC
TGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACCATTGA
CGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCCATGGT
CATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATCGAGCG
ACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACACTGAA
TGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTT
GGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGGGC
CGTGTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTGAT
TGGCCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTCAT
GAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCCAG
CACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCTGG
CGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCACTG
TGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTTCC
CAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTAAG
AGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAGAG
CAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGACAG
AAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAGAA
AGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCCAA
TGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAATT
TGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATGCT
TTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACTAT
GGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTACTT
TGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCTGC
AGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAGGG
ACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTACAT
CGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGGCA
GGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAAGC
TGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCATGC
ATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTTGTGGGCGAAATGCTGAAAA
CTTCGACCGATTTTTCACCCGCCATCCACCAGTCCTAACACCTCCCGACCAGGAAGTCATCAGGAATATTGACCAATCAGAATTCGAAGG
ATTTTCCTTTGTTAACTCTGAATTTTTAAAACCCGAAGTCAAGAGCTAAGTAGATGTGTAGATCTCCGTCCTTCATTTCTGTCATTCAAG
CTCAACGGCTATTGTGGTGACATTTTTATGTTTTTCATTGCCAAGTTGCATCCATGTTTGATTTTCTGATGAGACTAGAGTGACAGTGTT
TCAGAACCCAAATGTCCTCAGGTAGTTTGGAGCATCTCTATGAGATGGGATTATGCAGATGGCCTATGGAAAATGCAGCTGCATAATTAA
CACATTATCAAAGTCCTCTTACAATTTATTTTCCGCAGCATGTCAGCTAAGTAGACCCAATGGGGAGAGAAAATGCCTGCTTTCTTTCCC
TCTTTTTCTGCACTGCCATATTCACCCCCAACCATCCAATCTGTGGATAATTGGATGTTAGCGGTACTCTTCCACTTCCGGGCCTGGAGC
TTGGCTTGTATCCAAGTGTATGGTTGCTTTGCCTAAGAGGAATCCCTCTATTTCACCTGTTCTGGAGGCACCAGACCTTGAAAAGAACAT
GCTCAAAATAAAATGTTATCTGTTATTTTTGTAAACTCAAAGTTAAGATGATCAAAGTTCTAAAATTCCAAGAATGTGCTTTTAGACGGT
CTCAATCTAAAAGCACTTCAAGGGGTCAAAGGGCAACCAGCTTGGGTGCTACCTCAGTGTTGTAGTTTCTGATACTTTATGTCTTTGCTC
ACCCTCATCCCCAAACTACTTGAAAAGGGCATTTGGCACCACTCTCTGAAACAACACAGTCACTCTAGCAAGGCCCCCAAAGGGCCCTGG
TTTTACATTACATTTCAAACTTTATTTGCTTTGGGGTTTTGTTTCTGTTGTTGTTCAAATGCAAAAAAAAGAAAAAAAAAGAAAAAAAAA
GGTGACTCACATTGTTACACATGCTTTAAAATATGTATTCAAATGTTATTAACCACAATGACGACCTGCTTTGATTTAACCAAGAAGACG
GCTGCGGAGCCTAGCAGACTCAGGCCTGTGGGAATGGGATTTGTTACAAATCTAGGTTTGTTACTGGCTTCAGAAAGCTAATTAAGTGCT
CTGAAAAAGACACCGTTTCTTGAAACAAAGATGGTTGTATTCCTCACTTTGATGTTGTTTTGCAAGATGTTTGTGGAAATGTTCATTTGT
ATCTGGATCTCTGTTATGTGCCATTTTTCTTCTAGCATCGAGATACAATAAAAAAAAAAAAAAAGAAAAGAAGAAGAAATACTATTTCAA
GGAAAACTGCTCTTTTTGAGAAACGTGGACCTAAACTACAAAGTGGGAACTGAGGAGGGAACTCAGGAGAAAGGAACTAACTGCGGAGCT
TTAATCTTGGCCCCAGTGTTCAGCCACTCGGAGGGGCGGGGGCTGTGGCCCATTCAGGGGCTGCTGGTGGGCTGTAGTGGGGTGGGATGA
CCTGGCCAGAGCCAACGAGGATACTGGAGCCCAAAGTCAAGTTTAGAGACCAGCTGGGAACGTGAATGGGGCTCTTGATTTTCTTATCAA
AATCACCACTCCTCCCAGCTTGGACTAAATATTCTTTCTAGCAAGCAGCTTTGTGAGCTCCCTGAAGCCCAAGGAAACCCTTCGGTGGGA
GAAATTTCATTTCTGTCTGAGAGGATTAAGGCAGCAGGTGACTCCCCCTCCTCGCCTGCCGTGTCCTGCTATTCTCAGGCAGCTCTAAGG
AGAATTCTTATCACAGTTCAAGTGATTTCCAGAAGTTCCAGGGCTTCTGAGAGACCATCAAGGGAACTTTAACAACTTGACAAATGTCCT
TGAAGTAAGATGCCTCATCTTTAGGGAAAAATGGGGTTTGGATTTCTGCTTAGGCAAAGTCTCCTGCAGTTCATCCTTCTCTGTCCTCTT
CTTGCTTCAGGCTTGGGGACCGTCCCTGCTGTCCCCACTGTGGTGGCAATCAGGACCTAAGGTGAAGCAAACTTGAAGTTCTATCTGACA
AGTTTAGGCAGTAAGAGAAGGAGGGAAATCGGAGCAAAGCTCCCTCACTTTATTGTTGAGAAACTGGCATCTGGAAAGAGGAAGGAATTT
GCCCAAAGTCAGTCAGCTGGGATAAAAACCTGGGTGTCCTGTCCAGAAAGTGCAGGGTGCTTTCTGCTCTGTAGCAAGGCAGCAGACATC
TCTGAGCCAGGCCCACCAACAGGCCCTTATCTGGTGGTTGGATCATGATCCCATTTTGCTTGGACATGCTCTCAGGAAGATAAAAACCAT
GGAGAAACACTAGGCCATTGACAAATGATCTGAGACAACTTTAGAAAACAATGTAGGATGAATGGAAAGAGAAAGAAAGGAAAGAAAGAA
GAAAAAGAAAGAAGGAAAGAAAGAAAGAGAAAGGAAGGAAGGAAAGAAGGAAGGAAAAGAAGGAAGGAAGGAAGGAATATAGTGTTATAA
ATACTGCACTCAACATTTTCCAAATTCTTGCCATTATTTTTCAAAAGTTTAATAGTTTGCAGAAATAGATACTCAAGCCAAAGTCTGTTT
TAGAGAAACTTTCCATGGAAAGTCAGAATTTCTACCACTTCCTTTTCTATCCACATTTCCAGTGCAGAAGAAACTGAGAAACAGAGCTTT
TTGAAGAGAGGACAGGGCCATAGCAACAAGGACCTTCTTGGGGGATTAATGGGAGGTCAGTAGAATTAATAACCCTCCTTGGATGAGTGC
TACTGTTTTCACATGGCTTCAGATGCTATCAACCTCAAAGAAATGATCTCAACAGAGAAGCTTATTCTCTCCCAACTTCTACGGTAAAAT
CCAGGAGTATTTTCTCTGGGGATCTGCCCACAGGACAAAGTCCATAAAAGCAAGTCCTGTCTGGACCATGTGGTTATCTGAAGCATTAGC
CATCACCAGCACAACAAACGGGGCAGGGCTTTCCAAGGTGGGGCTGGTCAGAAGGGAATCTTTGATAAGAGGCCCACAGGCAGGGAAAGC
GAAATAGGGTTGATGAGACCAGGGGAGACCTAAAAAAAAGGCAGCTTTGTGTCTTCTAGCTCCAAATATACCTGCCTTTTAGCTCACACA
CTGTCCTGGAGTTCTCAGACCTTTAGGGGCCCTAACACAGTTCAGTTCATACAGGGGTTCAAAAGGGACAGTGGCCCATTTGGGAGACCT
TTAGGATCAATGGGAATCAATTCCATTGTTTTGCCTCAGAGTAAAGTTTCTGGCTCGGGGACAATTATAAGTTGCAAAAAGGATAGAGGC
ATATCCCAAGTCTTCCTTCATTCCACAAATAATTACAAACAACCTACTGTGTGCCAGGCACTATTCTTAGCACTGGAAATACACTAGTGA
AGAAGCAGATGAGGACCCTGTTTATTGTTTCTCTCCAAGAAATTCTCCAAGAATATTGTTTCTTGGAGAGAAATAATAAATAAACAAGAC
AATTTCTGAAAGCAATAAGTGCAATCAAGATAATTAAAGGATGCTAAAGTGTGACTTGTGGGGATTGGGAGAGAGATGCACAGACAATAT
TAAAGAGGAGGCATTCGAGCTTTGTTGTGAACACCGGAAGTAACATGCCGAGCGCCTGGGGGATGGAAACTCCTATAGCACCCCACAGGC
TAACAGCAAGCAGGACAAGACAAAAAGGGCAGGTGGGACATGGTAGAGATGGACCCTACCCAGGAAACAGCTCCATCAGCATCTTAGCCT
GCCCCACTCTAGCCACACATACCCACGTGTGCTCCTGAGTTCAGTGTGCCCACCTCACTCCCACACCCTCACATAGACTTGGCAAGAGTA
AGGAGGGAACTCCATAGAGACATTTTACCTATCTCAGGGGAGCAGCCACAAAGAAGCAAGTCTTGTAAAAGGTCTTTTGCAAAGGAGAGT
GAACCCAGCAATGAGAGATCCTTAACAGCTAGTGCCCATTAGGGGGCTAAACCTAAAGCCTGGGTGGTGATGGCTCAAACGCTAATGAGT
CAGTGAATCCTTACCGACCCCCTGGCCTTTATAATCTGAGGCAACTTTGGCTGCAGCCCGGGAATGTGCAGGGCACTAGGGAATACAAGG
CCTTCTTCCCTGGTTGTCTTGTAATAAAACAGCCATGGGGTTGTCCCTCCAGTCCGAGAGACTGTGATGAGGCCTACATAGCAGCGATGT
GGTCAGGTAAAAATCAGGAACCCACTGAAATCTTGGGCAAGCCACCCTGCCTGCTTGTGCCTCGGTTCTCTCATATGTCATATATAGGAG
GTGAGGACTCCAGCTCCACCTGCCCCAGGTGGGTGTGGTGATGATGAGGAAAGACAAGAGGCTTGCAAGGACCCTGAAGAGGTCGGAGCA
TCATACAGATTCCTTTATTAGCCCACATTCTGATGTTCCCTGGTGAGACTTGCCCCAAGCAATTGCTAGTAAATGGGGGTTAATTTCTTC
TCCACCTCCCTACTGAACAAAAAAAGAAATGCCAGACTTACTAGGAGAATCGAGTTGCTTTGAGTTTCTTTTGTTTTGTTTTGTTTTGTT
TTGTTTTAAGGCTCCCCTTACACACCCTCCTTTAAGCTTTGGGTTTTCTCTCTTATAGTTTGTTGACACATGCTAAAAATGTCTTTGGAG
AGAACTTCTGCCTGATAAACACCCAATTCTAGACTGTGGGTGGATTTTCGAGCTGACGGTGGTCAATTCCTTTCATTAAGCAGTGATCTG
ATTTCTCCACATGGCCATTCTGCCTTCTTGGGGGCAGAGTAGATGGGCAGCAGTTCACCTTTTCAGAGAAAGAGGTCTTCTAGCCACCTG
GGCTGCTACTGAATGGTTTTCTCCAGGACGCTCTACCTAATGATTATTTCTATAACATTAAGCATGGTAATAAGTAGCTTCCAATTCAAT
TCATCCTAAAGCCAAAGAAAATACAGCAACACACACACACACACACACACACACACACACACACACACACACACACCACTTTATGGCAAT
TCTTAACTGACATTCAATGACTTACTTCTTTTCTTAGAAAATTTCCACCACATTTCTATCCCCAAGCCAACATACAATGTGAAATGAAAG
CCAGTGCGTGGAGTGCAGCTGCTAAAAATTTTCAGCACAGGGCTCTTTCTGACTCTGCTCATGAGATGGTATCAGCCACCCAATGACTGG
CGTATCTTGGTCCTGTGTCTTTCTTCTTACGCTGTGTTAATGTGTTTACTTTCCATTTGGCAGAGAGACAAGAGAGACACCTCCAACTTC
GACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAATTTGCTGGCTTC
TCTTATACTAACCCAGAGTTTGTCATTAATGTGTAGGTGAATGCAAACTCCATCGTTGAGCCTGGGGTGTAAGACTTCAAGCCAAGCGTA
TGTATCAATTCTAGTCTTCCAGGATTCACGGTGCACATGCTGGCATTCAACATGTGGAAAGCTTGTCTTAGAGGGCTTTTCTTTGTATGT
GTAGCTTGCTAGTTTGTTTTCTACATTTGAAAATGTTTAGTTTAGAATAAGCGCATTATCCAATTATAGAGGTACAATTTTCCAAACTTC
CAGAAACTCATCAAATGAACAGACAATGTCAAAACTACTGTGTCTGATACCAAAATGCTTCAGTATTTGTAATTTTTCAAGTCAGAAGCT
GATGTTCCTGGTAAAAGTTTTTACAGTTATTCTATAATATCTTCTTTGAATGCTAAGCATGAGCGATATTTTTAAAAATTGTGAGTAAGC

>In-frame_ABCC1_ENST00000399408_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_5128nt
CCAGGCGGCGTTGCGGCCCCGGCCCCGGCTCCCTGCGCCGCCGCCGCCGCCGCCGCCAGCGCTAGCGCCAGCAGCCGGGCCCGATCACCC
GCCGCCCGGTGCCCGCCGCCGCCCGCGCCAGCAACCGGGCCCGATCACCCGCCGCCCGGTGCCCGCCGCCGCCCGCGCCACCGGCATGGC
GCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACCAAGTG
CTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACATGACCG
AGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTC
TTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCTACCTT
TTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCAT
CCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCCCTCTT
ACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAGTCCAG
CGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGACCTCTG
GTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCC
GGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTGATCGT
CAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTCTTCAA
GGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGACTGGCA
GGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTCAGTGG
CATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTCGGGGA
GATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAAGTCAT
CCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAATGCTGT
GATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAATGGGAT
CAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAGAAGTC
TGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACCATTGA
CGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCCATGGT
CATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATCGAGCG
ACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACACTGAA
TGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTT
GGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGATTCTCT
CCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTGGAAAT
CCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGGGCCGT
GTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTGATTGG
CCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTCATGAG
TGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCCAGCAC
AGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCTGGCGC
TGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCACTGTGG
GTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTTCCCAG
CCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTAAGAGA
TGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAGAGCAA
ACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGACAGAAG
ACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAGAAAGC
CAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCCAATGA
AGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAATTTGA
CAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATGCTTTC
AGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACTATGGT
GGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTACTTTGT
GATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCTGCAGA
AATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAGGGACA
CATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTACATCGC
CCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGGCAGGC
ACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAAGCTGT
GGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCATGCATT
TTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTAGAGACAAGAGAGACACCTCCAA
CTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAATTTGCTGG
CTTCTCTTATACTAACCCAGAGTTTGTCATTAATGTGTAGGTGAATGCAAACTCCATCGTTGAGCCTGGGGTGTAAGACTTCAAGCCAAG
CGTATGTATCAATTCTAGTCTTCCAGGATTCACGGTGCACATGCTGGCATTCAACATGTGGAAAGCTTGTCTTAGAGGGCTTTTCTTTGT
ATGTGTAGCTTGCTAGTTTGTTTTCTACATTTGAAAATGTTTAGTTTAGAATAAGCGCATTATCCAATTATAGAGGTACAATTTTCCAAA
CTTCCAGAAACTCATCAAATGAACAGACAATGTCAAAACTACTGTGTCTGATACCAAAATGCTTCAGTATTTGTAATTTTTCAAGTCAGA
AGCTGATGTTCCTGGTAAAAGTTTTTACAGTTATTCTATAATATCTTCTTTGAATGCTAAGCATGAGCGATATTTTTAAAAATTGTGAGT

>In-frame_ABCC1_ENST00000399408_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_10431nt
CCAGGCGGCGTTGCGGCCCCGGCCCCGGCTCCCTGCGCCGCCGCCGCCGCCGCCGCCAGCGCTAGCGCCAGCAGCCGGGCCCGATCACCC
GCCGCCCGGTGCCCGCCGCCGCCCGCGCCAGCAACCGGGCCCGATCACCCGCCGCCCGGTGCCCGCCGCCGCCCGCGCCACCGGCATGGC
GCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACCAAGTG
CTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACATGACCG
AGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTC
TTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCTACCTT
TTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCAT
CCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCCCTCTT
ACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAGTCCAG
CGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGACCTCTG
GTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCC
GGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTGATCGT
CAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTCTTCAA
GGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGACTGGCA
GGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTCAGTGG
CATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTCGGGGA
GATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAAGTCAT
CCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAATGCTGT
GATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAATGGGAT
CAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAGAAGTC
TGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACCATTGA
CGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCCATGGT
CATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATCGAGCG
ACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACACTGAA
TGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTT
GGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGATTCTCT
CCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTGGAAAT
CCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGGGCCGT
GTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTGATTGG
CCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTCATGAG
TGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCCAGCAC
AGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCTGGCGC
TGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCACTGTGG
GTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTTCCCAG
CCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTAAGAGA
TGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAGAGCAA
ACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGACAGAAG
ACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAGAAAGC
CAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCCAATGA
AGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAATTTGA
CAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATGCTTTC
AGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACTATGGT
GGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTACTTTGT
GATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCTGCAGA
AATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAGGGACA
CATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTACATCGC
CCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGGCAGGC
ACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAAGCTGT
GGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCATGCATT
TTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTTGTGGGCGAAATGCTGAAAACTT
CGACCGATTTTTCACCCGCCATCCACCAGTCCTAACACCTCCCGACCAGGAAGTCATCAGGAATATTGACCAATCAGAATTCGAAGGATT
TTCCTTTGTTAACTCTGAATTTTTAAAACCCGAAGTCAAGAGCTAAGTAGATGTGTAGATCTCCGTCCTTCATTTCTGTCATTCAAGCTC
AACGGCTATTGTGGTGACATTTTTATGTTTTTCATTGCCAAGTTGCATCCATGTTTGATTTTCTGATGAGACTAGAGTGACAGTGTTTCA
GAACCCAAATGTCCTCAGGTAGTTTGGAGCATCTCTATGAGATGGGATTATGCAGATGGCCTATGGAAAATGCAGCTGCATAATTAACAC
ATTATCAAAGTCCTCTTACAATTTATTTTCCGCAGCATGTCAGCTAAGTAGACCCAATGGGGAGAGAAAATGCCTGCTTTCTTTCCCTCT
TTTTCTGCACTGCCATATTCACCCCCAACCATCCAATCTGTGGATAATTGGATGTTAGCGGTACTCTTCCACTTCCGGGCCTGGAGCTTG
GCTTGTATCCAAGTGTATGGTTGCTTTGCCTAAGAGGAATCCCTCTATTTCACCTGTTCTGGAGGCACCAGACCTTGAAAAGAACATGCT
CAAAATAAAATGTTATCTGTTATTTTTGTAAACTCAAAGTTAAGATGATCAAAGTTCTAAAATTCCAAGAATGTGCTTTTAGACGGTCTC
AATCTAAAAGCACTTCAAGGGGTCAAAGGGCAACCAGCTTGGGTGCTACCTCAGTGTTGTAGTTTCTGATACTTTATGTCTTTGCTCACC
CTCATCCCCAAACTACTTGAAAAGGGCATTTGGCACCACTCTCTGAAACAACACAGTCACTCTAGCAAGGCCCCCAAAGGGCCCTGGTTT
TACATTACATTTCAAACTTTATTTGCTTTGGGGTTTTGTTTCTGTTGTTGTTCAAATGCAAAAAAAAGAAAAAAAAAGAAAAAAAAAGGT
GACTCACATTGTTACACATGCTTTAAAATATGTATTCAAATGTTATTAACCACAATGACGACCTGCTTTGATTTAACCAAGAAGACGGCT
GCGGAGCCTAGCAGACTCAGGCCTGTGGGAATGGGATTTGTTACAAATCTAGGTTTGTTACTGGCTTCAGAAAGCTAATTAAGTGCTCTG
AAAAAGACACCGTTTCTTGAAACAAAGATGGTTGTATTCCTCACTTTGATGTTGTTTTGCAAGATGTTTGTGGAAATGTTCATTTGTATC
TGGATCTCTGTTATGTGCCATTTTTCTTCTAGCATCGAGATACAATAAAAAAAAAAAAAAAGAAAAGAAGAAGAAATACTATTTCAAGGA
AAACTGCTCTTTTTGAGAAACGTGGACCTAAACTACAAAGTGGGAACTGAGGAGGGAACTCAGGAGAAAGGAACTAACTGCGGAGCTTTA
ATCTTGGCCCCAGTGTTCAGCCACTCGGAGGGGCGGGGGCTGTGGCCCATTCAGGGGCTGCTGGTGGGCTGTAGTGGGGTGGGATGACCT
GGCCAGAGCCAACGAGGATACTGGAGCCCAAAGTCAAGTTTAGAGACCAGCTGGGAACGTGAATGGGGCTCTTGATTTTCTTATCAAAAT
CACCACTCCTCCCAGCTTGGACTAAATATTCTTTCTAGCAAGCAGCTTTGTGAGCTCCCTGAAGCCCAAGGAAACCCTTCGGTGGGAGAA
ATTTCATTTCTGTCTGAGAGGATTAAGGCAGCAGGTGACTCCCCCTCCTCGCCTGCCGTGTCCTGCTATTCTCAGGCAGCTCTAAGGAGA
ATTCTTATCACAGTTCAAGTGATTTCCAGAAGTTCCAGGGCTTCTGAGAGACCATCAAGGGAACTTTAACAACTTGACAAATGTCCTTGA
AGTAAGATGCCTCATCTTTAGGGAAAAATGGGGTTTGGATTTCTGCTTAGGCAAAGTCTCCTGCAGTTCATCCTTCTCTGTCCTCTTCTT
GCTTCAGGCTTGGGGACCGTCCCTGCTGTCCCCACTGTGGTGGCAATCAGGACCTAAGGTGAAGCAAACTTGAAGTTCTATCTGACAAGT
TTAGGCAGTAAGAGAAGGAGGGAAATCGGAGCAAAGCTCCCTCACTTTATTGTTGAGAAACTGGCATCTGGAAAGAGGAAGGAATTTGCC
CAAAGTCAGTCAGCTGGGATAAAAACCTGGGTGTCCTGTCCAGAAAGTGCAGGGTGCTTTCTGCTCTGTAGCAAGGCAGCAGACATCTCT
GAGCCAGGCCCACCAACAGGCCCTTATCTGGTGGTTGGATCATGATCCCATTTTGCTTGGACATGCTCTCAGGAAGATAAAAACCATGGA
GAAACACTAGGCCATTGACAAATGATCTGAGACAACTTTAGAAAACAATGTAGGATGAATGGAAAGAGAAAGAAAGGAAAGAAAGAAGAA
AAAGAAAGAAGGAAAGAAAGAAAGAGAAAGGAAGGAAGGAAAGAAGGAAGGAAAAGAAGGAAGGAAGGAAGGAATATAGTGTTATAAATA
CTGCACTCAACATTTTCCAAATTCTTGCCATTATTTTTCAAAAGTTTAATAGTTTGCAGAAATAGATACTCAAGCCAAAGTCTGTTTTAG
AGAAACTTTCCATGGAAAGTCAGAATTTCTACCACTTCCTTTTCTATCCACATTTCCAGTGCAGAAGAAACTGAGAAACAGAGCTTTTTG
AAGAGAGGACAGGGCCATAGCAACAAGGACCTTCTTGGGGGATTAATGGGAGGTCAGTAGAATTAATAACCCTCCTTGGATGAGTGCTAC
TGTTTTCACATGGCTTCAGATGCTATCAACCTCAAAGAAATGATCTCAACAGAGAAGCTTATTCTCTCCCAACTTCTACGGTAAAATCCA
GGAGTATTTTCTCTGGGGATCTGCCCACAGGACAAAGTCCATAAAAGCAAGTCCTGTCTGGACCATGTGGTTATCTGAAGCATTAGCCAT
CACCAGCACAACAAACGGGGCAGGGCTTTCCAAGGTGGGGCTGGTCAGAAGGGAATCTTTGATAAGAGGCCCACAGGCAGGGAAAGCGAA
ATAGGGTTGATGAGACCAGGGGAGACCTAAAAAAAAGGCAGCTTTGTGTCTTCTAGCTCCAAATATACCTGCCTTTTAGCTCACACACTG
TCCTGGAGTTCTCAGACCTTTAGGGGCCCTAACACAGTTCAGTTCATACAGGGGTTCAAAAGGGACAGTGGCCCATTTGGGAGACCTTTA
GGATCAATGGGAATCAATTCCATTGTTTTGCCTCAGAGTAAAGTTTCTGGCTCGGGGACAATTATAAGTTGCAAAAAGGATAGAGGCATA
TCCCAAGTCTTCCTTCATTCCACAAATAATTACAAACAACCTACTGTGTGCCAGGCACTATTCTTAGCACTGGAAATACACTAGTGAAGA
AGCAGATGAGGACCCTGTTTATTGTTTCTCTCCAAGAAATTCTCCAAGAATATTGTTTCTTGGAGAGAAATAATAAATAAACAAGACAAT
TTCTGAAAGCAATAAGTGCAATCAAGATAATTAAAGGATGCTAAAGTGTGACTTGTGGGGATTGGGAGAGAGATGCACAGACAATATTAA
AGAGGAGGCATTCGAGCTTTGTTGTGAACACCGGAAGTAACATGCCGAGCGCCTGGGGGATGGAAACTCCTATAGCACCCCACAGGCTAA
CAGCAAGCAGGACAAGACAAAAAGGGCAGGTGGGACATGGTAGAGATGGACCCTACCCAGGAAACAGCTCCATCAGCATCTTAGCCTGCC
CCACTCTAGCCACACATACCCACGTGTGCTCCTGAGTTCAGTGTGCCCACCTCACTCCCACACCCTCACATAGACTTGGCAAGAGTAAGG
AGGGAACTCCATAGAGACATTTTACCTATCTCAGGGGAGCAGCCACAAAGAAGCAAGTCTTGTAAAAGGTCTTTTGCAAAGGAGAGTGAA
CCCAGCAATGAGAGATCCTTAACAGCTAGTGCCCATTAGGGGGCTAAACCTAAAGCCTGGGTGGTGATGGCTCAAACGCTAATGAGTCAG
TGAATCCTTACCGACCCCCTGGCCTTTATAATCTGAGGCAACTTTGGCTGCAGCCCGGGAATGTGCAGGGCACTAGGGAATACAAGGCCT
TCTTCCCTGGTTGTCTTGTAATAAAACAGCCATGGGGTTGTCCCTCCAGTCCGAGAGACTGTGATGAGGCCTACATAGCAGCGATGTGGT
CAGGTAAAAATCAGGAACCCACTGAAATCTTGGGCAAGCCACCCTGCCTGCTTGTGCCTCGGTTCTCTCATATGTCATATATAGGAGGTG
AGGACTCCAGCTCCACCTGCCCCAGGTGGGTGTGGTGATGATGAGGAAAGACAAGAGGCTTGCAAGGACCCTGAAGAGGTCGGAGCATCA
TACAGATTCCTTTATTAGCCCACATTCTGATGTTCCCTGGTGAGACTTGCCCCAAGCAATTGCTAGTAAATGGGGGTTAATTTCTTCTCC
ACCTCCCTACTGAACAAAAAAAGAAATGCCAGACTTACTAGGAGAATCGAGTTGCTTTGAGTTTCTTTTGTTTTGTTTTGTTTTGTTTTG
TTTTAAGGCTCCCCTTACACACCCTCCTTTAAGCTTTGGGTTTTCTCTCTTATAGTTTGTTGACACATGCTAAAAATGTCTTTGGAGAGA
ACTTCTGCCTGATAAACACCCAATTCTAGACTGTGGGTGGATTTTCGAGCTGACGGTGGTCAATTCCTTTCATTAAGCAGTGATCTGATT
TCTCCACATGGCCATTCTGCCTTCTTGGGGGCAGAGTAGATGGGCAGCAGTTCACCTTTTCAGAGAAAGAGGTCTTCTAGCCACCTGGGC
TGCTACTGAATGGTTTTCTCCAGGACGCTCTACCTAATGATTATTTCTATAACATTAAGCATGGTAATAAGTAGCTTCCAATTCAATTCA
TCCTAAAGCCAAAGAAAATACAGCAACACACACACACACACACACACACACACACACACACACACACACACACCACTTTATGGCAATTCT
TAACTGACATTCAATGACTTACTTCTTTTCTTAGAAAATTTCCACCACATTTCTATCCCCAAGCCAACATACAATGTGAAATGAAAGCCA
GTGCGTGGAGTGCAGCTGCTAAAAATTTTCAGCACAGGGCTCTTTCTGACTCTGCTCATGAGATGGTATCAGCCACCCAATGACTGGCGT
ATCTTGGTCCTGTGTCTTTCTTCTTACGCTGTGTTAATGTGTTTACTTTCCATTTGGCAGAGAGACAAGAGAGACACCTCCAACTTCGAC
AAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAATTTGCTGGCTTCTCT
TATACTAACCCAGAGTTTGTCATTAATGTGTAGGTGAATGCAAACTCCATCGTTGAGCCTGGGGTGTAAGACTTCAAGCCAAGCGTATGT
ATCAATTCTAGTCTTCCAGGATTCACGGTGCACATGCTGGCATTCAACATGTGGAAAGCTTGTCTTAGAGGGCTTTTCTTTGTATGTGTA
GCTTGCTAGTTTGTTTTCTACATTTGAAAATGTTTAGTTTAGAATAAGCGCATTATCCAATTATAGAGGTACAATTTTCCAAACTTCCAG
AAACTCATCAAATGAACAGACAATGTCAAAACTACTGTGTCTGATACCAAAATGCTTCAGTATTTGTAATTTTTCAAGTCAGAAGCTGAT
GTTCCTGGTAAAAGTTTTTACAGTTATTCTATAATATCTTCTTTGAATGCTAAGCATGAGCGATATTTTTAAAAATTGTGAGTAAGCTTT

>In-frame_ABCC1_ENST00000345148_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_5128nt
CCAGGCGGCGTTGCGGCCCCGGCCCCGGCTCCCTGCGCCGCCGCCGCCGCCGCCGCCAGCGCTAGCGCCAGCAGCCGGGCCCGATCACCC
GCCGCCCGGTGCCCGCCGCCGCCCGCGCCAGCAACCGGGCCCGATCACCCGCCGCCCGGTGCCCGCCGCCGCCCGCGCCACCGGCATGGC
GCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACCAAGTG
CTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACATGACCG
AGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTC
TTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCTACCTT
TTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCAT
CCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCCCTCTT
ACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAGTCCAG
CGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGACCTCTG
GTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCC
GGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTGATCGT
CAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTCTTCAA
GGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGACTGGCA
GGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTCAGTGG
CATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTCGGGGA
GATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAAGTCAT
CCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAATGCTGT
GATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAATGGGAT
CAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAGAAGTC
TGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACCATTGA
CGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCCATGGT
CATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATCGAGCG
ACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACACTGAA
TGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTT
GGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGATTCTCT
CCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTGGAAAT
CCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGGGCCGT
GTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTGATTGG
CCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTCATGAG
TGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCCAGCAC
AGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCTGGCGC
TGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCACTGTGG
GTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTTCCCAG
CCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTAAGAGA
TGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAGAGCAA
ACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGACAGAAG
ACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAGAAAGC
CAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCCAATGA
AGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAATTTGA
CAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATGCTTTC
AGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACTATGGT
GGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTACTTTGT
GATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCTGCAGA
AATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAGGGACA
CATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTACATCGC
CCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGGCAGGC
ACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAAGCTGT
GGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCATGCATT
TTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTAGAGACAAGAGAGACACCTCCAA
CTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAATTTGCTGG
CTTCTCTTATACTAACCCAGAGTTTGTCATTAATGTGTAGGTGAATGCAAACTCCATCGTTGAGCCTGGGGTGTAAGACTTCAAGCCAAG
CGTATGTATCAATTCTAGTCTTCCAGGATTCACGGTGCACATGCTGGCATTCAACATGTGGAAAGCTTGTCTTAGAGGGCTTTTCTTTGT
ATGTGTAGCTTGCTAGTTTGTTTTCTACATTTGAAAATGTTTAGTTTAGAATAAGCGCATTATCCAATTATAGAGGTACAATTTTCCAAA
CTTCCAGAAACTCATCAAATGAACAGACAATGTCAAAACTACTGTGTCTGATACCAAAATGCTTCAGTATTTGTAATTTTTCAAGTCAGA
AGCTGATGTTCCTGGTAAAAGTTTTTACAGTTATTCTATAATATCTTCTTTGAATGCTAAGCATGAGCGATATTTTTAAAAATTGTGAGT

>In-frame_ABCC1_ENST00000345148_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_10431nt
CCAGGCGGCGTTGCGGCCCCGGCCCCGGCTCCCTGCGCCGCCGCCGCCGCCGCCGCCAGCGCTAGCGCCAGCAGCCGGGCCCGATCACCC
GCCGCCCGGTGCCCGCCGCCGCCCGCGCCAGCAACCGGGCCCGATCACCCGCCGCCCGGTGCCCGCCGCCGCCCGCGCCACCGGCATGGC
GCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACCAAGTG
CTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACATGACCG
AGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTC
TTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCTACCTT
TTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCAT
CCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCCCTCTT
ACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAGTCCAG
CGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGACCTCTG
GTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCC
GGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTGATCGT
CAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTCTTCAA
GGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGACTGGCA
GGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTCAGTGG
CATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTCGGGGA
GATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAAGTCAT
CCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAATGCTGT
GATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAATGGGAT
CAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAGAAGTC
TGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACCATTGA
CGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCCATGGT
CATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATCGAGCG
ACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACACTGAA
TGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTT
GGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGATTCTCT
CCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTGGAAAT
CCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGGGCGTGAACCTGTCTGGGGGCCAGAAGCAGCGCGTGAGCCTGGCCCGGGCCGT
GTACTCCAACGCTGACATTTACCTCTTCGATGATCCCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTGATTGG
CCCCAAGGGGATGCTGAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTCATGAG
TGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTACCTATGCCAGCAC
AGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTCCTGCCCTGGCGC
TGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTGTGACCACTGTGG
GTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGATGAATGTTCCCAG
CCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGTCCTCGTAAGAGA
TGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAAAAGTGAGAGCAA
ACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGACAAAGACAGAAG
ACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGAACTTCAGAAAGC
CAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAGTGAGGCCAATGA
AGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGTCTCCAAATTTGA
CAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAAGGTCATGCTTTC
AGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGAGTGCACTATGGT
GGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCGCCTGTACTTTGT
GATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATTTTACGCTGCAGA
AATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGATTCTGAGGGACA
CATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCCAGACTACATCGC
CCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTTGGCTGGGCAGGC
ACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTCCAAGGAAGCTGT
GGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAAAGAGCATGCATT
TTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTTGTGGGCGAAATGCTGAAAACTT
CGACCGATTTTTCACCCGCCATCCACCAGTCCTAACACCTCCCGACCAGGAAGTCATCAGGAATATTGACCAATCAGAATTCGAAGGATT
TTCCTTTGTTAACTCTGAATTTTTAAAACCCGAAGTCAAGAGCTAAGTAGATGTGTAGATCTCCGTCCTTCATTTCTGTCATTCAAGCTC
AACGGCTATTGTGGTGACATTTTTATGTTTTTCATTGCCAAGTTGCATCCATGTTTGATTTTCTGATGAGACTAGAGTGACAGTGTTTCA
GAACCCAAATGTCCTCAGGTAGTTTGGAGCATCTCTATGAGATGGGATTATGCAGATGGCCTATGGAAAATGCAGCTGCATAATTAACAC
ATTATCAAAGTCCTCTTACAATTTATTTTCCGCAGCATGTCAGCTAAGTAGACCCAATGGGGAGAGAAAATGCCTGCTTTCTTTCCCTCT
TTTTCTGCACTGCCATATTCACCCCCAACCATCCAATCTGTGGATAATTGGATGTTAGCGGTACTCTTCCACTTCCGGGCCTGGAGCTTG
GCTTGTATCCAAGTGTATGGTTGCTTTGCCTAAGAGGAATCCCTCTATTTCACCTGTTCTGGAGGCACCAGACCTTGAAAAGAACATGCT
CAAAATAAAATGTTATCTGTTATTTTTGTAAACTCAAAGTTAAGATGATCAAAGTTCTAAAATTCCAAGAATGTGCTTTTAGACGGTCTC
AATCTAAAAGCACTTCAAGGGGTCAAAGGGCAACCAGCTTGGGTGCTACCTCAGTGTTGTAGTTTCTGATACTTTATGTCTTTGCTCACC
CTCATCCCCAAACTACTTGAAAAGGGCATTTGGCACCACTCTCTGAAACAACACAGTCACTCTAGCAAGGCCCCCAAAGGGCCCTGGTTT
TACATTACATTTCAAACTTTATTTGCTTTGGGGTTTTGTTTCTGTTGTTGTTCAAATGCAAAAAAAAGAAAAAAAAAGAAAAAAAAAGGT
GACTCACATTGTTACACATGCTTTAAAATATGTATTCAAATGTTATTAACCACAATGACGACCTGCTTTGATTTAACCAAGAAGACGGCT
GCGGAGCCTAGCAGACTCAGGCCTGTGGGAATGGGATTTGTTACAAATCTAGGTTTGTTACTGGCTTCAGAAAGCTAATTAAGTGCTCTG
AAAAAGACACCGTTTCTTGAAACAAAGATGGTTGTATTCCTCACTTTGATGTTGTTTTGCAAGATGTTTGTGGAAATGTTCATTTGTATC
TGGATCTCTGTTATGTGCCATTTTTCTTCTAGCATCGAGATACAATAAAAAAAAAAAAAAAGAAAAGAAGAAGAAATACTATTTCAAGGA
AAACTGCTCTTTTTGAGAAACGTGGACCTAAACTACAAAGTGGGAACTGAGGAGGGAACTCAGGAGAAAGGAACTAACTGCGGAGCTTTA
ATCTTGGCCCCAGTGTTCAGCCACTCGGAGGGGCGGGGGCTGTGGCCCATTCAGGGGCTGCTGGTGGGCTGTAGTGGGGTGGGATGACCT
GGCCAGAGCCAACGAGGATACTGGAGCCCAAAGTCAAGTTTAGAGACCAGCTGGGAACGTGAATGGGGCTCTTGATTTTCTTATCAAAAT
CACCACTCCTCCCAGCTTGGACTAAATATTCTTTCTAGCAAGCAGCTTTGTGAGCTCCCTGAAGCCCAAGGAAACCCTTCGGTGGGAGAA
ATTTCATTTCTGTCTGAGAGGATTAAGGCAGCAGGTGACTCCCCCTCCTCGCCTGCCGTGTCCTGCTATTCTCAGGCAGCTCTAAGGAGA
ATTCTTATCACAGTTCAAGTGATTTCCAGAAGTTCCAGGGCTTCTGAGAGACCATCAAGGGAACTTTAACAACTTGACAAATGTCCTTGA
AGTAAGATGCCTCATCTTTAGGGAAAAATGGGGTTTGGATTTCTGCTTAGGCAAAGTCTCCTGCAGTTCATCCTTCTCTGTCCTCTTCTT
GCTTCAGGCTTGGGGACCGTCCCTGCTGTCCCCACTGTGGTGGCAATCAGGACCTAAGGTGAAGCAAACTTGAAGTTCTATCTGACAAGT
TTAGGCAGTAAGAGAAGGAGGGAAATCGGAGCAAAGCTCCCTCACTTTATTGTTGAGAAACTGGCATCTGGAAAGAGGAAGGAATTTGCC
CAAAGTCAGTCAGCTGGGATAAAAACCTGGGTGTCCTGTCCAGAAAGTGCAGGGTGCTTTCTGCTCTGTAGCAAGGCAGCAGACATCTCT
GAGCCAGGCCCACCAACAGGCCCTTATCTGGTGGTTGGATCATGATCCCATTTTGCTTGGACATGCTCTCAGGAAGATAAAAACCATGGA
GAAACACTAGGCCATTGACAAATGATCTGAGACAACTTTAGAAAACAATGTAGGATGAATGGAAAGAGAAAGAAAGGAAAGAAAGAAGAA
AAAGAAAGAAGGAAAGAAAGAAAGAGAAAGGAAGGAAGGAAAGAAGGAAGGAAAAGAAGGAAGGAAGGAAGGAATATAGTGTTATAAATA
CTGCACTCAACATTTTCCAAATTCTTGCCATTATTTTTCAAAAGTTTAATAGTTTGCAGAAATAGATACTCAAGCCAAAGTCTGTTTTAG
AGAAACTTTCCATGGAAAGTCAGAATTTCTACCACTTCCTTTTCTATCCACATTTCCAGTGCAGAAGAAACTGAGAAACAGAGCTTTTTG
AAGAGAGGACAGGGCCATAGCAACAAGGACCTTCTTGGGGGATTAATGGGAGGTCAGTAGAATTAATAACCCTCCTTGGATGAGTGCTAC
TGTTTTCACATGGCTTCAGATGCTATCAACCTCAAAGAAATGATCTCAACAGAGAAGCTTATTCTCTCCCAACTTCTACGGTAAAATCCA
GGAGTATTTTCTCTGGGGATCTGCCCACAGGACAAAGTCCATAAAAGCAAGTCCTGTCTGGACCATGTGGTTATCTGAAGCATTAGCCAT
CACCAGCACAACAAACGGGGCAGGGCTTTCCAAGGTGGGGCTGGTCAGAAGGGAATCTTTGATAAGAGGCCCACAGGCAGGGAAAGCGAA
ATAGGGTTGATGAGACCAGGGGAGACCTAAAAAAAAGGCAGCTTTGTGTCTTCTAGCTCCAAATATACCTGCCTTTTAGCTCACACACTG
TCCTGGAGTTCTCAGACCTTTAGGGGCCCTAACACAGTTCAGTTCATACAGGGGTTCAAAAGGGACAGTGGCCCATTTGGGAGACCTTTA
GGATCAATGGGAATCAATTCCATTGTTTTGCCTCAGAGTAAAGTTTCTGGCTCGGGGACAATTATAAGTTGCAAAAAGGATAGAGGCATA
TCCCAAGTCTTCCTTCATTCCACAAATAATTACAAACAACCTACTGTGTGCCAGGCACTATTCTTAGCACTGGAAATACACTAGTGAAGA
AGCAGATGAGGACCCTGTTTATTGTTTCTCTCCAAGAAATTCTCCAAGAATATTGTTTCTTGGAGAGAAATAATAAATAAACAAGACAAT
TTCTGAAAGCAATAAGTGCAATCAAGATAATTAAAGGATGCTAAAGTGTGACTTGTGGGGATTGGGAGAGAGATGCACAGACAATATTAA
AGAGGAGGCATTCGAGCTTTGTTGTGAACACCGGAAGTAACATGCCGAGCGCCTGGGGGATGGAAACTCCTATAGCACCCCACAGGCTAA
CAGCAAGCAGGACAAGACAAAAAGGGCAGGTGGGACATGGTAGAGATGGACCCTACCCAGGAAACAGCTCCATCAGCATCTTAGCCTGCC
CCACTCTAGCCACACATACCCACGTGTGCTCCTGAGTTCAGTGTGCCCACCTCACTCCCACACCCTCACATAGACTTGGCAAGAGTAAGG
AGGGAACTCCATAGAGACATTTTACCTATCTCAGGGGAGCAGCCACAAAGAAGCAAGTCTTGTAAAAGGTCTTTTGCAAAGGAGAGTGAA
CCCAGCAATGAGAGATCCTTAACAGCTAGTGCCCATTAGGGGGCTAAACCTAAAGCCTGGGTGGTGATGGCTCAAACGCTAATGAGTCAG
TGAATCCTTACCGACCCCCTGGCCTTTATAATCTGAGGCAACTTTGGCTGCAGCCCGGGAATGTGCAGGGCACTAGGGAATACAAGGCCT
TCTTCCCTGGTTGTCTTGTAATAAAACAGCCATGGGGTTGTCCCTCCAGTCCGAGAGACTGTGATGAGGCCTACATAGCAGCGATGTGGT
CAGGTAAAAATCAGGAACCCACTGAAATCTTGGGCAAGCCACCCTGCCTGCTTGTGCCTCGGTTCTCTCATATGTCATATATAGGAGGTG
AGGACTCCAGCTCCACCTGCCCCAGGTGGGTGTGGTGATGATGAGGAAAGACAAGAGGCTTGCAAGGACCCTGAAGAGGTCGGAGCATCA
TACAGATTCCTTTATTAGCCCACATTCTGATGTTCCCTGGTGAGACTTGCCCCAAGCAATTGCTAGTAAATGGGGGTTAATTTCTTCTCC
ACCTCCCTACTGAACAAAAAAAGAAATGCCAGACTTACTAGGAGAATCGAGTTGCTTTGAGTTTCTTTTGTTTTGTTTTGTTTTGTTTTG
TTTTAAGGCTCCCCTTACACACCCTCCTTTAAGCTTTGGGTTTTCTCTCTTATAGTTTGTTGACACATGCTAAAAATGTCTTTGGAGAGA
ACTTCTGCCTGATAAACACCCAATTCTAGACTGTGGGTGGATTTTCGAGCTGACGGTGGTCAATTCCTTTCATTAAGCAGTGATCTGATT
TCTCCACATGGCCATTCTGCCTTCTTGGGGGCAGAGTAGATGGGCAGCAGTTCACCTTTTCAGAGAAAGAGGTCTTCTAGCCACCTGGGC
TGCTACTGAATGGTTTTCTCCAGGACGCTCTACCTAATGATTATTTCTATAACATTAAGCATGGTAATAAGTAGCTTCCAATTCAATTCA
TCCTAAAGCCAAAGAAAATACAGCAACACACACACACACACACACACACACACACACACACACACACACACACCACTTTATGGCAATTCT
TAACTGACATTCAATGACTTACTTCTTTTCTTAGAAAATTTCCACCACATTTCTATCCCCAAGCCAACATACAATGTGAAATGAAAGCCA
GTGCGTGGAGTGCAGCTGCTAAAAATTTTCAGCACAGGGCTCTTTCTGACTCTGCTCATGAGATGGTATCAGCCACCCAATGACTGGCGT
ATCTTGGTCCTGTGTCTTTCTTCTTACGCTGTGTTAATGTGTTTACTTTCCATTTGGCAGAGAGACAAGAGAGACACCTCCAACTTCGAC
AAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAATTTGCTGGCTTCTCT
TATACTAACCCAGAGTTTGTCATTAATGTGTAGGTGAATGCAAACTCCATCGTTGAGCCTGGGGTGTAAGACTTCAAGCCAAGCGTATGT
ATCAATTCTAGTCTTCCAGGATTCACGGTGCACATGCTGGCATTCAACATGTGGAAAGCTTGTCTTAGAGGGCTTTTCTTTGTATGTGTA
GCTTGCTAGTTTGTTTTCTACATTTGAAAATGTTTAGTTTAGAATAAGCGCATTATCCAATTATAGAGGTACAATTTTCCAAACTTCCAG
AAACTCATCAAATGAACAGACAATGTCAAAACTACTGTGTCTGATACCAAAATGCTTCAGTATTTGTAATTTTTCAAGTCAGAAGCTGAT
GTTCCTGGTAAAAGTTTTTACAGTTATTCTATAATATCTTCTTTGAATGCTAAGCATGAGCGATATTTTTAAAAATTGTGAGTAAGCTTT

>In-frame_ABCC1_ENST00000346370_chr16_16184445_+_PRKCB_ENST00000321728_chr16_23999829_+_4960nt
CCAGGCGGCGTTGCGGCCCCGGCCCCGGCTCCCTGCGCCGCCGCCGCCGCCGCCGCCAGCGCTAGCGCCAGCAGCCGGGCCCGATCACCC
GCCGCCCGGTGCCCGCCGCCGCCCGCGCCAGCAACCGGGCCCGATCACCCGCCGCCCGGTGCCCGCCGCCGCCCGCGCCACCGGCATGGC
GCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACCAAGTG
CTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACATGACCG
AGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTC
TTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCTACCTT
TTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCAT
CCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCCCTCTT
ACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAGTCCAG
CGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGACCTCTG
GTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCC
GGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTGATCGT
CAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTCTTCAA
GGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGACTGGCA
GGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTCAGTGG
CATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTCGGGGA
GATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAAGTCAT
CCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAATGCTGT
GATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAATGGGAT
CAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAGAAGTC
TGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACCATTGA
CGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCCATGGT
CATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATCGAGCG
ACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACACTGAA
TGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTT
GGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGATTCTCT
CCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTGGAAAT
CCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCAT
CATCGTCATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTAC
CTATGCCAGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTC
CTGCCCTGGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTG
TGACCACTGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGAT
GAATGTTCCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGT
CCTCGTAAGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAA
AAGTGAGAGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGA
CAAAGACAGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGA
ACTTCAGAAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAG
TGAGGCCAATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGT
CTCCAAATTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAA
GGTCATGCTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGA
GTGCACTATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCG
CCTGTACTTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATT
TTACGCTGCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGA
TTCTGAGGGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCC
AGACTACATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTT
GGCTGGGCAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTC
CAAGGAAGCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAA
AGAGCATGCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTAGAGACAAGAG
AGACACCTCCAACTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAA
TGAATTTGCTGGCTTCTCTTATACTAACCCAGAGTTTGTCATTAATGTGTAGGTGAATGCAAACTCCATCGTTGAGCCTGGGGTGTAAGA
CTTCAAGCCAAGCGTATGTATCAATTCTAGTCTTCCAGGATTCACGGTGCACATGCTGGCATTCAACATGTGGAAAGCTTGTCTTAGAGG
GCTTTTCTTTGTATGTGTAGCTTGCTAGTTTGTTTTCTACATTTGAAAATGTTTAGTTTAGAATAAGCGCATTATCCAATTATAGAGGTA
CAATTTTCCAAACTTCCAGAAACTCATCAAATGAACAGACAATGTCAAAACTACTGTGTCTGATACCAAAATGCTTCAGTATTTGTAATT
TTTCAAGTCAGAAGCTGATGTTCCTGGTAAAAGTTTTTACAGTTATTCTATAATATCTTCTTTGAATGCTAAGCATGAGCGATATTTTTA
AAAATTGTGAGTAAGCTTTGCAGTTACTGTGAACTATTGTCTCTTGGAGGAAGTTTTTTGTTTAAGAATTGATATGATTAAACTGAATTA

>In-frame_ABCC1_ENST00000346370_chr16_16184445_+_PRKCB_ENST00000303531_chr16_23999829_+_10263nt
CCAGGCGGCGTTGCGGCCCCGGCCCCGGCTCCCTGCGCCGCCGCCGCCGCCGCCGCCAGCGCTAGCGCCAGCAGCCGGGCCCGATCACCC
GCCGCCCGGTGCCCGCCGCCGCCCGCGCCAGCAACCGGGCCCGATCACCCGCCGCCCGGTGCCCGCCGCCGCCCGCGCCACCGGCATGGC
GCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATACCAGCAACCCCGACTTCACCAAGTG
CTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTGGGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACATGACCG
AGGCTACATTCAGATGACACCTCTCAACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTC
TTTCTGGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCATGCTGCTTGCTACCTT
TTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACTTTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCAT
CCTGAGATCCAAAATTATGACAGCCTTAAAAGAGGATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCCCTCTT
ACTCATTCAGCTCGTCTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAGTCCAG
CGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCCAGCCCCTGGAGGGCAGTGACCTCTG
GTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTTGGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCC
GGTGAAGGTTGTGTACTCCTCCAAGGATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTGATCGT
CAAGTCCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCATGAGCTTCTTCTTCAA
GGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATCAAGTTCGTGAATGACACGAAGGCCCCAGACTGGCA
GGGCTACTTCTACACCGTGCTGCTGTTTGTCACTGCCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTCAGTGG
CATGAGGATCAAGACCGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTCGGGGA
GATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGATCTGGTCAGCCCCCCTGCAAGTCAT
CCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCTGGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAATGCTGT
GATGGCGATGAAGACCAAGACGTATCAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAATGGGAT
CAAAGTGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAAGGTGCTGAAGAAGTC
TGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTGGCCTTGTGCACATTTGCCGTCTACGTGACCATTGA
CGAGAACAACATCCTGGATGCCCAGACAGCCTTCGTGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCCATGGT
CATCAGCAGCATCGTGCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATCGAGCG
ACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGGCCAGGAGCGACCCTCCCACACTGAA
TGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGTGGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTT
GGCTGAGATGGACAAAGTGGAGGGGCACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGATTCTCT
CCGAGAAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCTCCCAGACCTGGAAAT
CCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCAT
CATCGTCATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTGAGTTCCTGCGTAC
CTATGCCAGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGTTTGCTGCTTTGTGGTGCACAAGCGGTGCCATGAATTTGTCACATTCTC
CTGCCCTGGCGCTGACAAGGGTCCAGCCTCCGATGACCCCCGCAGCAAACACAAGTTTAAGATCCACACGTACTCCAGCCCCACGTTTTG
TGACCACTGTGGGTCACTGCTGTATGGACTCATCCACCAGGGGATGAAATGTGACACCTGCATGATGAATGTGCACAAGCGCTGCGTGAT
GAATGTTCCCAGCCTGTGTGGCACGGACCACACGGAGCGCCGCGGCCGCATCTACATCCAGGCCCACATCGACAGGGACGTCCTCATTGT
CCTCGTAAGAGATGCTAAAAACCTTGTACCTATGGACCCCAATGGCCTGTCAGATCCCTACGTAAAACTGAAACTGATTCCCGATCCCAA
AAGTGAGAGCAAACAGAAGACCAAAACCATCAAATGCTCCCTCAACCCTGAGTGGAATGAGACATTTAGATTTCAGCTGAAAGAATCGGA
CAAAGACAGAAGACTGTCAGTAGAGATTTGGGATTGGGATTTGACCAGCAGGAATGACTTCATGGGATCTTTGTCCTTTGGGATTTCTGA
ACTTCAGAAAGCCAGTGTTGATGGCTGGTTTAAGTTACTGAGCCAGGAGGAAGGCGAGTACTTCAATGTGCCTGTGCCACCAGAAGGAAG
TGAGGCCAATGAAGAACTGCGGCAGAAATTTGAGAGGGCCAAGATCAGTCAGGGAACCAAGGTCCCGGAAGAAAAGACGACCAACACTGT
CTCCAAATTTGACAACAATGGCAACAGAGACCGGATGAAACTGACCGATTTTAACTTCCTAATGGTGCTGGGGAAAGGCAGCTTTGGCAA
GGTCATGCTTTCAGAACGAAAAGGCACAGATGAGCTCTATGCTGTGAAGATCCTGAAGAAGGACGTTGTGATCCAAGATGATGACGTGGA
GTGCACTATGGTGGAGAAGCGGGTGTTGGCCCTGCCTGGGAAGCCGCCCTTCCTGACCCAGCTCCACTCCTGCTTCCAGACCATGGACCG
CCTGTACTTTGTGATGGAGTACGTGAATGGGGGCGACCTCATGTATCACATCCAGCAAGTCGGCCGGTTCAAGGAGCCCCATGCTGTATT
TTACGCTGCAGAAATTGCCATCGGTCTGTTCTTCTTACAGAGTAAGGGCATCATTTACCGTGACCTAAAACTTGACAACGTGATGCTCGA
TTCTGAGGGACACATCAAGATTGCCGATTTTGGCATGTGTAAGGAAAACATCTGGGATGGGGTGACAACCAAGACATTCTGTGGCACTCC
AGACTACATCGCCCCCGAGATAATTGCTTATCAGCCCTATGGGAAGTCCGTGGATTGGTGGGCATTTGGAGTCCTGCTGTATGAAATGTT
GGCTGGGCAGGCACCCTTTGAAGGGGAGGATGAAGATGAACTCTTCCAATCCATCATGGAACACAACGTAGCCTATCCCAAGTCTATGTC
CAAGGAAGCTGTGGCCATCTGCAAAGGGCTGATGACCAAACACCCAGGCAAACGTCTGGGTTGTGGACCTGAAGGCGAACGTGATATCAA
AGAGCATGCATTTTTCCGGTATATTGATTGGGAGAAACTTGAACGCAAAGAGATCCAGCCCCCTTATAAGCCAAAAGCTTGTGGGCGAAA
TGCTGAAAACTTCGACCGATTTTTCACCCGCCATCCACCAGTCCTAACACCTCCCGACCAGGAAGTCATCAGGAATATTGACCAATCAGA
ATTCGAAGGATTTTCCTTTGTTAACTCTGAATTTTTAAAACCCGAAGTCAAGAGCTAAGTAGATGTGTAGATCTCCGTCCTTCATTTCTG
TCATTCAAGCTCAACGGCTATTGTGGTGACATTTTTATGTTTTTCATTGCCAAGTTGCATCCATGTTTGATTTTCTGATGAGACTAGAGT
GACAGTGTTTCAGAACCCAAATGTCCTCAGGTAGTTTGGAGCATCTCTATGAGATGGGATTATGCAGATGGCCTATGGAAAATGCAGCTG
CATAATTAACACATTATCAAAGTCCTCTTACAATTTATTTTCCGCAGCATGTCAGCTAAGTAGACCCAATGGGGAGAGAAAATGCCTGCT
TTCTTTCCCTCTTTTTCTGCACTGCCATATTCACCCCCAACCATCCAATCTGTGGATAATTGGATGTTAGCGGTACTCTTCCACTTCCGG
GCCTGGAGCTTGGCTTGTATCCAAGTGTATGGTTGCTTTGCCTAAGAGGAATCCCTCTATTTCACCTGTTCTGGAGGCACCAGACCTTGA
AAAGAACATGCTCAAAATAAAATGTTATCTGTTATTTTTGTAAACTCAAAGTTAAGATGATCAAAGTTCTAAAATTCCAAGAATGTGCTT
TTAGACGGTCTCAATCTAAAAGCACTTCAAGGGGTCAAAGGGCAACCAGCTTGGGTGCTACCTCAGTGTTGTAGTTTCTGATACTTTATG
TCTTTGCTCACCCTCATCCCCAAACTACTTGAAAAGGGCATTTGGCACCACTCTCTGAAACAACACAGTCACTCTAGCAAGGCCCCCAAA
GGGCCCTGGTTTTACATTACATTTCAAACTTTATTTGCTTTGGGGTTTTGTTTCTGTTGTTGTTCAAATGCAAAAAAAAGAAAAAAAAAG
AAAAAAAAAGGTGACTCACATTGTTACACATGCTTTAAAATATGTATTCAAATGTTATTAACCACAATGACGACCTGCTTTGATTTAACC
AAGAAGACGGCTGCGGAGCCTAGCAGACTCAGGCCTGTGGGAATGGGATTTGTTACAAATCTAGGTTTGTTACTGGCTTCAGAAAGCTAA
TTAAGTGCTCTGAAAAAGACACCGTTTCTTGAAACAAAGATGGTTGTATTCCTCACTTTGATGTTGTTTTGCAAGATGTTTGTGGAAATG
TTCATTTGTATCTGGATCTCTGTTATGTGCCATTTTTCTTCTAGCATCGAGATACAATAAAAAAAAAAAAAAAGAAAAGAAGAAGAAATA
CTATTTCAAGGAAAACTGCTCTTTTTGAGAAACGTGGACCTAAACTACAAAGTGGGAACTGAGGAGGGAACTCAGGAGAAAGGAACTAAC
TGCGGAGCTTTAATCTTGGCCCCAGTGTTCAGCCACTCGGAGGGGCGGGGGCTGTGGCCCATTCAGGGGCTGCTGGTGGGCTGTAGTGGG
GTGGGATGACCTGGCCAGAGCCAACGAGGATACTGGAGCCCAAAGTCAAGTTTAGAGACCAGCTGGGAACGTGAATGGGGCTCTTGATTT
TCTTATCAAAATCACCACTCCTCCCAGCTTGGACTAAATATTCTTTCTAGCAAGCAGCTTTGTGAGCTCCCTGAAGCCCAAGGAAACCCT
TCGGTGGGAGAAATTTCATTTCTGTCTGAGAGGATTAAGGCAGCAGGTGACTCCCCCTCCTCGCCTGCCGTGTCCTGCTATTCTCAGGCA
GCTCTAAGGAGAATTCTTATCACAGTTCAAGTGATTTCCAGAAGTTCCAGGGCTTCTGAGAGACCATCAAGGGAACTTTAACAACTTGAC
AAATGTCCTTGAAGTAAGATGCCTCATCTTTAGGGAAAAATGGGGTTTGGATTTCTGCTTAGGCAAAGTCTCCTGCAGTTCATCCTTCTC
TGTCCTCTTCTTGCTTCAGGCTTGGGGACCGTCCCTGCTGTCCCCACTGTGGTGGCAATCAGGACCTAAGGTGAAGCAAACTTGAAGTTC
TATCTGACAAGTTTAGGCAGTAAGAGAAGGAGGGAAATCGGAGCAAAGCTCCCTCACTTTATTGTTGAGAAACTGGCATCTGGAAAGAGG
AAGGAATTTGCCCAAAGTCAGTCAGCTGGGATAAAAACCTGGGTGTCCTGTCCAGAAAGTGCAGGGTGCTTTCTGCTCTGTAGCAAGGCA
GCAGACATCTCTGAGCCAGGCCCACCAACAGGCCCTTATCTGGTGGTTGGATCATGATCCCATTTTGCTTGGACATGCTCTCAGGAAGAT
AAAAACCATGGAGAAACACTAGGCCATTGACAAATGATCTGAGACAACTTTAGAAAACAATGTAGGATGAATGGAAAGAGAAAGAAAGGA
AAGAAAGAAGAAAAAGAAAGAAGGAAAGAAAGAAAGAGAAAGGAAGGAAGGAAAGAAGGAAGGAAAAGAAGGAAGGAAGGAAGGAATATA
GTGTTATAAATACTGCACTCAACATTTTCCAAATTCTTGCCATTATTTTTCAAAAGTTTAATAGTTTGCAGAAATAGATACTCAAGCCAA
AGTCTGTTTTAGAGAAACTTTCCATGGAAAGTCAGAATTTCTACCACTTCCTTTTCTATCCACATTTCCAGTGCAGAAGAAACTGAGAAA
CAGAGCTTTTTGAAGAGAGGACAGGGCCATAGCAACAAGGACCTTCTTGGGGGATTAATGGGAGGTCAGTAGAATTAATAACCCTCCTTG
GATGAGTGCTACTGTTTTCACATGGCTTCAGATGCTATCAACCTCAAAGAAATGATCTCAACAGAGAAGCTTATTCTCTCCCAACTTCTA
CGGTAAAATCCAGGAGTATTTTCTCTGGGGATCTGCCCACAGGACAAAGTCCATAAAAGCAAGTCCTGTCTGGACCATGTGGTTATCTGA
AGCATTAGCCATCACCAGCACAACAAACGGGGCAGGGCTTTCCAAGGTGGGGCTGGTCAGAAGGGAATCTTTGATAAGAGGCCCACAGGC
AGGGAAAGCGAAATAGGGTTGATGAGACCAGGGGAGACCTAAAAAAAAGGCAGCTTTGTGTCTTCTAGCTCCAAATATACCTGCCTTTTA
GCTCACACACTGTCCTGGAGTTCTCAGACCTTTAGGGGCCCTAACACAGTTCAGTTCATACAGGGGTTCAAAAGGGACAGTGGCCCATTT
GGGAGACCTTTAGGATCAATGGGAATCAATTCCATTGTTTTGCCTCAGAGTAAAGTTTCTGGCTCGGGGACAATTATAAGTTGCAAAAAG
GATAGAGGCATATCCCAAGTCTTCCTTCATTCCACAAATAATTACAAACAACCTACTGTGTGCCAGGCACTATTCTTAGCACTGGAAATA
CACTAGTGAAGAAGCAGATGAGGACCCTGTTTATTGTTTCTCTCCAAGAAATTCTCCAAGAATATTGTTTCTTGGAGAGAAATAATAAAT
AAACAAGACAATTTCTGAAAGCAATAAGTGCAATCAAGATAATTAAAGGATGCTAAAGTGTGACTTGTGGGGATTGGGAGAGAGATGCAC
AGACAATATTAAAGAGGAGGCATTCGAGCTTTGTTGTGAACACCGGAAGTAACATGCCGAGCGCCTGGGGGATGGAAACTCCTATAGCAC
CCCACAGGCTAACAGCAAGCAGGACAAGACAAAAAGGGCAGGTGGGACATGGTAGAGATGGACCCTACCCAGGAAACAGCTCCATCAGCA
TCTTAGCCTGCCCCACTCTAGCCACACATACCCACGTGTGCTCCTGAGTTCAGTGTGCCCACCTCACTCCCACACCCTCACATAGACTTG
GCAAGAGTAAGGAGGGAACTCCATAGAGACATTTTACCTATCTCAGGGGAGCAGCCACAAAGAAGCAAGTCTTGTAAAAGGTCTTTTGCA
AAGGAGAGTGAACCCAGCAATGAGAGATCCTTAACAGCTAGTGCCCATTAGGGGGCTAAACCTAAAGCCTGGGTGGTGATGGCTCAAACG
CTAATGAGTCAGTGAATCCTTACCGACCCCCTGGCCTTTATAATCTGAGGCAACTTTGGCTGCAGCCCGGGAATGTGCAGGGCACTAGGG
AATACAAGGCCTTCTTCCCTGGTTGTCTTGTAATAAAACAGCCATGGGGTTGTCCCTCCAGTCCGAGAGACTGTGATGAGGCCTACATAG
CAGCGATGTGGTCAGGTAAAAATCAGGAACCCACTGAAATCTTGGGCAAGCCACCCTGCCTGCTTGTGCCTCGGTTCTCTCATATGTCAT
ATATAGGAGGTGAGGACTCCAGCTCCACCTGCCCCAGGTGGGTGTGGTGATGATGAGGAAAGACAAGAGGCTTGCAAGGACCCTGAAGAG
GTCGGAGCATCATACAGATTCCTTTATTAGCCCACATTCTGATGTTCCCTGGTGAGACTTGCCCCAAGCAATTGCTAGTAAATGGGGGTT
AATTTCTTCTCCACCTCCCTACTGAACAAAAAAAGAAATGCCAGACTTACTAGGAGAATCGAGTTGCTTTGAGTTTCTTTTGTTTTGTTT
TGTTTTGTTTTGTTTTAAGGCTCCCCTTACACACCCTCCTTTAAGCTTTGGGTTTTCTCTCTTATAGTTTGTTGACACATGCTAAAAATG
TCTTTGGAGAGAACTTCTGCCTGATAAACACCCAATTCTAGACTGTGGGTGGATTTTCGAGCTGACGGTGGTCAATTCCTTTCATTAAGC
AGTGATCTGATTTCTCCACATGGCCATTCTGCCTTCTTGGGGGCAGAGTAGATGGGCAGCAGTTCACCTTTTCAGAGAAAGAGGTCTTCT
AGCCACCTGGGCTGCTACTGAATGGTTTTCTCCAGGACGCTCTACCTAATGATTATTTCTATAACATTAAGCATGGTAATAAGTAGCTTC
CAATTCAATTCATCCTAAAGCCAAAGAAAATACAGCAACACACACACACACACACACACACACACACACACACACACACACACACCACTT
TATGGCAATTCTTAACTGACATTCAATGACTTACTTCTTTTCTTAGAAAATTTCCACCACATTTCTATCCCCAAGCCAACATACAATGTG
AAATGAAAGCCAGTGCGTGGAGTGCAGCTGCTAAAAATTTTCAGCACAGGGCTCTTTCTGACTCTGCTCATGAGATGGTATCAGCCACCC
AATGACTGGCGTATCTTGGTCCTGTGTCTTTCTTCTTACGCTGTGTTAATGTGTTTACTTTCCATTTGGCAGAGAGACAAGAGAGACACC
TCCAACTTCGACAAAGAGTTCACCAGACAGCCTGTGGAACTGACCCCCACTGATAAACTCTTCATCATGAACTTGGACCAAAATGAATTT
GCTGGCTTCTCTTATACTAACCCAGAGTTTGTCATTAATGTGTAGGTGAATGCAAACTCCATCGTTGAGCCTGGGGTGTAAGACTTCAAG
CCAAGCGTATGTATCAATTCTAGTCTTCCAGGATTCACGGTGCACATGCTGGCATTCAACATGTGGAAAGCTTGTCTTAGAGGGCTTTTC
TTTGTATGTGTAGCTTGCTAGTTTGTTTTCTACATTTGAAAATGTTTAGTTTAGAATAAGCGCATTATCCAATTATAGAGGTACAATTTT
CCAAACTTCCAGAAACTCATCAAATGAACAGACAATGTCAAAACTACTGTGTCTGATACCAAAATGCTTCAGTATTTGTAATTTTTCAAG
TCAGAAGCTGATGTTCCTGGTAAAAGTTTTTACAGTTATTCTATAATATCTTCTTTGAATGCTAAGCATGAGCGATATTTTTAAAAATTG
TGAGTAAGCTTTGCAGTTACTGTGAACTATTGTCTCTTGGAGGAAGTTTTTTGTTTAAGAATTGATATGATTAAACTGAATTAATATATG


Top

FusionGenePPI for ABCC1_PRKCB


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ABCC1TMEM173, UNC93B1, EIF3C, NDUFAF3, PUF60, MRPL17, NDUFB9, RPS7, VDAC3, TMX2, TMCO1, MCU, PGRMC2, RAVER1, STX4, FLOT1, ATP6V1F, DBT, FKBP8, STT3B, PDHX, SURF1, PDCD6IP, ATP6V1H, SAFB, TMOD2, AZGP1, NPM1, TRAF3, ABCC1, CAV1, CANX, CLGN, FASN, IDH3A, NFS1, PAICS, TMEM33, VCP, ECHS1, HNRNPL, PSMC5, PSMD2, PTGES3, SEC63, VDAC1, VDAC2, NTRK1, TMEM17, ATP5A1, EEF1A1, CSNK2A1, CTDSPL, LGALS8, TRIM25PRKCBRASGRP3, NCAM1, ADRBK1, BTK, GNB2L1, CSF2RB, YWHAG, GNA12, GNA13, RIPK4, RGS2, TIAM1, PDLIM5, NCF1, PDPK1, AFAP1, LMNB1, CDK1, RBCK1, HSPA4, IKBKG, HIST1H3A, PRKCB, DDX58, TRIM41, EGFR, TERF1, TINF2, RNF31, IBTK, KCNA5, TOP2A, HIST1H1A, LSP1, H1F0, CARD11, SDC2, ITGB2, PPP2R4, PPP1CA, TNFRSF1A, FN1, HSP90AA1, GSK3A, CASR, RB1, SYT6, HIST1H1B, MARCKS, NUMB, LYN, MBP, PRKCD, EP300, SHCBP1, DAB2, AKT1, IKBKB, CHUK, GSK3B, ARRB2, ITGB3, PRKCA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ABCC1_PRKCB


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneABCC1P33527DB01138SulfinpyrazoneMultidrug resistance-associated protein 1small moleculeapproved
HgeneABCC1P33527DB06176RomidepsinMultidrug resistance-associated protein 1small moleculeapproved|investigational
TgenePRKCBP05771DB08862CholecystokininProtein kinase C beta typesmall moleculeapproved|investigational

Top

RelatedDiseases for ABCC1_PRKCB


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneABCC1C0009404Colorectal Neoplasms1CTD_human
HgeneABCC1C0018799Heart Diseases1CTD_human
HgeneABCC1C0020538Hypertensive disease1CTD_human
HgeneABCC1C0031117Peripheral Neuropathy1CTD_human
HgeneABCC1C0041755Adverse reaction to drug1CTD_human
HgeneABCC1C1168401Squamous cell carcinoma of the head and neck1CTD_human
HgeneABCC1C1458155Mammary Neoplasms1CTD_human
HgeneABCC1C4277682Chemical and Drug Induced Liver Injury1CTD_human
TgenePRKCBC0004352Autistic Disorder1CTD_human
TgenePRKCBC0009404Colorectal Neoplasms1CTD_human
TgenePRKCBC0011860Diabetes Mellitus, Non-Insulin-Dependent1CTD_human
TgenePRKCBC0018800Cardiomegaly1CTD_human
TgenePRKCBC0020456Hyperglycemia1CTD_human
TgenePRKCBC0023493Adult T-Cell Lymphoma/Leukemia1CTD_human
TgenePRKCBC0023893Liver Cirrhosis, Experimental1CTD_human
TgenePRKCBC0038356Stomach Neoplasms1CTD_human
TgenePRKCBC0041696Unipolar Depression1PSYGENET
TgenePRKCBC1269683Major Depressive Disorder1PSYGENET