FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14239

FusionGeneSummary for GABRB3_FAF1

check button Fusion gene summary
Fusion gene informationFusion gene name: GABRB3_FAF1
Fusion gene ID: 14239
HgeneTgene
Gene symbol

GABRB3

FAF1

Gene ID

2562

11124

Gene namegamma-aminobutyric acid type A receptor beta3 subunitFas associated factor 1
SynonymsECA5|EIEE43CGI-03|HFAF1s|UBXD12|UBXN3A|hFAF1
Cytomap

15q12

1p32.3

Type of geneprotein-codingprotein-coding
Descriptiongamma-aminobutyric acid receptor subunit beta-3GABA-alpha receptor beta-2 subunitGABAA receptor beta-3 subunitgamma-aminobutyric acid (GABA) A receptor, beta 3gamma-aminobutyric acid A receptor beta 3FAS-associated factor 1Fas (TNFRSF6) associated factor 1TNFRSF6-associated factor 1UBX domain protein 3AUBX domain-containing protein 12UBX domain-containing protein 3A
Modification date2018052320180522
UniProtAcc

P28472

Q9UNN5

Ensembl transtripts involved in fusion geneENST00000311550, ENST00000541819, 
ENST00000299267, ENST00000400188, 
ENST00000545868, ENST00000557641, 
ENST00000396153, ENST00000371778, 
ENST00000545823, ENST00000472808, 
Fusion gene scores* DoF score3 X 3 X 2=1817 X 15 X 9=2295
# samples 322
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(22/2295*10)=-3.38291872477651
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: GABRB3 [Title/Abstract] AND FAF1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneGABRB3

GO:0071420

cellular response to histamine

18281286

HgeneGABRB3

GO:1902476

chloride transmembrane transport

9039914

TgeneFAF1

GO:0010942

positive regulation of cell death

15596450


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1DA493815GABRB3chr15

27017548

-FAF1chr1

51323670

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000311550ENST00000396153GABRB3chr15

27017548

-FAF1chr1

51323670

-
In-frameENST00000311550ENST00000371778GABRB3chr15

27017548

-FAF1chr1

51323670

-
5CDS-intronENST00000311550ENST00000545823GABRB3chr15

27017548

-FAF1chr1

51323670

-
5CDS-intronENST00000311550ENST00000472808GABRB3chr15

27017548

-FAF1chr1

51323670

-
In-frameENST00000541819ENST00000396153GABRB3chr15

27017548

-FAF1chr1

51323670

-
In-frameENST00000541819ENST00000371778GABRB3chr15

27017548

-FAF1chr1

51323670

-
5CDS-intronENST00000541819ENST00000545823GABRB3chr15

27017548

-FAF1chr1

51323670

-
5CDS-intronENST00000541819ENST00000472808GABRB3chr15

27017548

-FAF1chr1

51323670

-
In-frameENST00000299267ENST00000396153GABRB3chr15

27017548

-FAF1chr1

51323670

-
In-frameENST00000299267ENST00000371778GABRB3chr15

27017548

-FAF1chr1

51323670

-
5CDS-intronENST00000299267ENST00000545823GABRB3chr15

27017548

-FAF1chr1

51323670

-
5CDS-intronENST00000299267ENST00000472808GABRB3chr15

27017548

-FAF1chr1

51323670

-
intron-3CDSENST00000400188ENST00000396153GABRB3chr15

27017548

-FAF1chr1

51323670

-
intron-3CDSENST00000400188ENST00000371778GABRB3chr15

27017548

-FAF1chr1

51323670

-
intron-intronENST00000400188ENST00000545823GABRB3chr15

27017548

-FAF1chr1

51323670

-
intron-intronENST00000400188ENST00000472808GABRB3chr15

27017548

-FAF1chr1

51323670

-
intron-3CDSENST00000545868ENST00000396153GABRB3chr15

27017548

-FAF1chr1

51323670

-
intron-3CDSENST00000545868ENST00000371778GABRB3chr15

27017548

-FAF1chr1

51323670

-
intron-intronENST00000545868ENST00000545823GABRB3chr15

27017548

-FAF1chr1

51323670

-
intron-intronENST00000545868ENST00000472808GABRB3chr15

27017548

-FAF1chr1

51323670

-
5UTR-3CDSENST00000557641ENST00000396153GABRB3chr15

27017548

-FAF1chr1

51323670

-
5UTR-3CDSENST00000557641ENST00000371778GABRB3chr15

27017548

-FAF1chr1

51323670

-
5UTR-intronENST00000557641ENST00000545823GABRB3chr15

27017548

-FAF1chr1

51323670

-
5UTR-intronENST00000557641ENST00000472808GABRB3chr15

27017548

-FAF1chr1

51323670

-

Top

FusionProtFeatures for GABRB3_FAF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GABRB3

P28472

FAF1

Q9UNN5

Component of the heteropentameric receptor for GABA, themajor inhibitory neurotransmitter in the vertebrate brain.Functions also as histamine receptor and mediates cellularresponses to histamine. Functions as receptor for diazepines andvarious anesthetics, such as pentobarbital; these are bound at aseparate allosteric effector binding site. Functions as ligand-gated chloride channel. {ECO:0000269|PubMed:18281286,ECO:0000269|PubMed:18514161, ECO:0000269|PubMed:22243422,ECO:0000269|PubMed:22303015, ECO:0000269|PubMed:24909990,ECO:0000269|PubMed:26950270}. Ubiquitin-binding protein (PubMed:19722279). Requiredfor the progression of DNA replication forks by targeting DNAreplication licensing factor CDT1 for degradation(PubMed:26842564). Potentiates but cannot initiate FAS-inducedapoptosis (By similarity). {ECO:0000250|UniProtKB:P54731,ECO:0000269|PubMed:19722279, ECO:0000269|PubMed:26842564}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneFAF1chr15:27017548chr1:51323670ENST00000371778-120569_64615651DomainUBX
TgeneFAF1chr15:27017548chr1:51323670ENST00000396153-019569_64615651DomainUBX

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGABRB3chr15:27017548chr1:51323670ENST00000299267-39120_12280474RegionNote=Agonist binding
HgeneGABRB3chr15:27017548chr1:51323670ENST00000299267-39180_18280474RegionNote=Agonist binding
HgeneGABRB3chr15:27017548chr1:51323670ENST00000299267-39290_31180474RegionNote=Allosteric effector binding
HgeneGABRB3chr15:27017548chr1:51323670ENST00000311550-39120_12280474RegionNote=Agonist binding
HgeneGABRB3chr15:27017548chr1:51323670ENST00000311550-39180_18280474RegionNote=Agonist binding
HgeneGABRB3chr15:27017548chr1:51323670ENST00000311550-39290_31180474RegionNote=Allosteric effector binding
HgeneGABRB3chr15:27017548chr1:51323670ENST00000400188-17120_122-29403RegionNote=Agonist binding
HgeneGABRB3chr15:27017548chr1:51323670ENST00000400188-17180_182-29403RegionNote=Agonist binding
HgeneGABRB3chr15:27017548chr1:51323670ENST00000400188-17290_311-29403RegionNote=Allosteric effector binding
HgeneGABRB3chr15:27017548chr1:51323670ENST00000545868-17120_122-56389RegionNote=Agonist binding
HgeneGABRB3chr15:27017548chr1:51323670ENST00000545868-17180_182-56389RegionNote=Agonist binding
HgeneGABRB3chr15:27017548chr1:51323670ENST00000545868-17290_311-56389RegionNote=Allosteric effector binding
HgeneGABRB3chr15:27017548chr1:51323670ENST00000299267-39268_27080474Topological domainCytoplasmic
HgeneGABRB3chr15:27017548chr1:51323670ENST00000299267-3926_24580474Topological domainExtracellular
HgeneGABRB3chr15:27017548chr1:51323670ENST00000299267-39294_30480474Topological domainExtracellular
HgeneGABRB3chr15:27017548chr1:51323670ENST00000299267-39328_45080474Topological domainCytoplasmic
HgeneGABRB3chr15:27017548chr1:51323670ENST00000311550-39268_27080474Topological domainCytoplasmic
HgeneGABRB3chr15:27017548chr1:51323670ENST00000311550-3926_24580474Topological domainExtracellular
HgeneGABRB3chr15:27017548chr1:51323670ENST00000311550-39294_30480474Topological domainExtracellular
HgeneGABRB3chr15:27017548chr1:51323670ENST00000311550-39328_45080474Topological domainCytoplasmic
HgeneGABRB3chr15:27017548chr1:51323670ENST00000400188-17268_270-29403Topological domainCytoplasmic
HgeneGABRB3chr15:27017548chr1:51323670ENST00000400188-1726_245-29403Topological domainExtracellular
HgeneGABRB3chr15:27017548chr1:51323670ENST00000400188-17294_304-29403Topological domainExtracellular
HgeneGABRB3chr15:27017548chr1:51323670ENST00000400188-17328_450-29403Topological domainCytoplasmic
HgeneGABRB3chr15:27017548chr1:51323670ENST00000545868-17268_270-56389Topological domainCytoplasmic
HgeneGABRB3chr15:27017548chr1:51323670ENST00000545868-1726_245-56389Topological domainExtracellular
HgeneGABRB3chr15:27017548chr1:51323670ENST00000545868-17294_304-56389Topological domainExtracellular
HgeneGABRB3chr15:27017548chr1:51323670ENST00000545868-17328_450-56389Topological domainCytoplasmic
HgeneGABRB3chr15:27017548chr1:51323670ENST00000299267-39246_26780474TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000299267-39271_29380474TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000299267-39305_32780474TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000299267-39451_47280474TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000311550-39246_26780474TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000311550-39271_29380474TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000311550-39305_32780474TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000311550-39451_47280474TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000400188-17246_267-29403TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000400188-17271_293-29403TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000400188-17305_327-29403TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000400188-17451_472-29403TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000545868-17246_267-56389TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000545868-17271_293-56389TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000545868-17305_327-56389TransmembraneNote=Helical
HgeneGABRB3chr15:27017548chr1:51323670ENST00000545868-17451_472-56389TransmembraneNote=Helical
TgeneFAF1chr15:27017548chr1:51323670ENST00000371778-1201_5715651DomainUBA
TgeneFAF1chr15:27017548chr1:51323670ENST00000396153-0191_5715651DomainUBA


Top

FusionGeneSequence for GABRB3_FAF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GABRB3_ENST00000311550_chr15_27017548_-_FAF1_ENST00000396153_chr1_51323670_-_636aa
ACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETIPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRV
EYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFM
LIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDV
HMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLL
AIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLN
VIQGNTTVDELMMRLMAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRL
SLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLF

>In-frame_GABRB3_ENST00000311550_chr15_27017548_-_FAF1_ENST00000371778_chr1_51323670_-_636aa
ACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETIPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRV
EYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFM
LIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDV
HMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLL
AIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLN
VIQGNTTVDELMMRLMAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRL
SLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLF

>In-frame_GABRB3_ENST00000541819_chr15_27017548_-_FAF1_ENST00000396153_chr1_51323670_-_636aa
ACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETIPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRV
EYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFM
LIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDV
HMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLL
AIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLN
VIQGNTTVDELMMRLMAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRL
SLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLF

>In-frame_GABRB3_ENST00000541819_chr15_27017548_-_FAF1_ENST00000371778_chr1_51323670_-_636aa
ACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETIPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRV
EYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFM
LIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDV
HMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLL
AIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLN
VIQGNTTVDELMMRLMAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRL
SLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLF

>In-frame_GABRB3_ENST00000299267_chr15_27017548_-_FAF1_ENST00000396153_chr1_51323670_-_636aa
ACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETIPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRV
EYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFM
LIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDV
HMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLL
AIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLN
VIQGNTTVDELMMRLMAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRL
SLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLF

>In-frame_GABRB3_ENST00000299267_chr15_27017548_-_FAF1_ENST00000371778_chr1_51323670_-_636aa
ACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETIPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRV
EYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFM
LIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDV
HMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLL
AIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLN
VIQGNTTVDELMMRLMAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRL
SLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GABRB3_ENST00000311550_chr15_27017548_-_FAF1_ENST00000396153_chr1_51323670_-_1908nt
GCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGCTTGAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATA
CCACAGGAAAATGGCATTCTACAAAGTGAATATGGAGGTGAGACCATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCT
CCTACTTCCTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCATCCAGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTT
GAATACAGAGACAGAAATGTTGATGTGGTACTTGAAGACACCTGTACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATA
CCTGTGTCCAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATGTGGAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAAC
AGTCTTTATGTCCTTACACCAGATTTGCCACCACCTTCATCATCTAGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATG
CTGATCATCACCCACCGAGAAGTCCAGCGGGAGTACAACCTGAACTTCTCAGGAAGCAGTACTATTCAAGAGGTAAAGAGAAATGTGTAT
GACCTTACAAGTATCCCCGTTCGCCACCAATTATGGGAGGGCTGGCCAACTTCTGCTACAGACGACTCAATGTGTCTTGCTGAATCAGGG
CTCTCTTATCCCTGCCATCGACTTACAGTGGGAAGAAGATCTTCACCTGCACAGACCCGGGAACAGTCGGAAGAACAAATCACCGATGTT
CATATGGTTAGTGATAGCGATGGAGATGACTTTGAAGATGCTACAGAATTTGGGGTGGATGATGGAGAAGTATTTGGCATGGCGTCATCT
GCCTTGAGAAAATCTCCAATGATGCCAGAAAACGCAGAAAATGAAGGAGATGCCTTATTACAATTTACAGCAGAGTTTTCTTCAAGATAT
GGTGATTGCCATCCTGTATTTTTTATTGGCTCATTAGAAGCTGCTTTTCAAGAGGCCTTCTATGTGAAAGCCCGAGATAGAAAGCTTCTT
GCTATCTACCTCCACCATGATGAAAGTGTGTTAACCAACGTGTTCTGCTCACAAATGCTTTGTGCTGAATCCATTGTTTCTTATCTGAGT
CAAAATTTTATAACCTGGGCTTGGGATCTGACAAAGGACTCCAACAGAGCAAGATTTCTCACTATGTGCAATAGACACTTTGGCAGTGTT
GTGGCACAAACCATTCGGACTCAAAAAACGGATCAGTTTCCGCTTTTCCTGATTATTATGGGAAAGCGATCATCTAATGAAGTGTTGAAT
GTGATACAAGGGAACACAACAGTAGATGAGTTAATGATGAGACTCATGGCTGCAATGGAGATCTTCACAGCCCAACAACAGGAAGATATA
AAGGACGAGGATGAACGTGAAGCCAGAGAAAATGTGAAGAGAGAGCAAGATGAGGCCTATCGCCTTTCACTTGAGGCTGACAGAGCAAAG
AGGGAAGCTCACGAGAGAGAGATGGCAGAACAGTTTCGTTTGGAGCAGATTCGCAAAGAACAAGAAGAGGAACGTGAGGCCATCCGGCTG
TCCTTAGAGCAAGCCCTGCCTCCTGAGCCAAAGGAAGAAAATGCTGAGCCTGTGAGCAAACTGCGGATCCGGACCCCCAGTGGCGAGTTC
TTGGAGCGGCGTTTCCTGGCCAGCAACAAGCTCCAGATTGTCTTTGATTTTGTAGCTTCCAAAGGATTTCCATGGGATGAGTACAAGTTA
CTGAGCACCTTTCCTAGGAGAGACGTAACTCAACTGGACCCAAATAAATCATTATTGGAGGTAAAGTTGTTCCCTCAAGAAACCCTTTTC

>In-frame_GABRB3_ENST00000311550_chr15_27017548_-_FAF1_ENST00000371778_chr1_51323670_-_1908nt
GCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGCTTGAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATA
CCACAGGAAAATGGCATTCTACAAAGTGAATATGGAGGTGAGACCATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCT
CCTACTTCCTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCATCCAGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTT
GAATACAGAGACAGAAATGTTGATGTGGTACTTGAAGACACCTGTACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATA
CCTGTGTCCAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATGTGGAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAAC
AGTCTTTATGTCCTTACACCAGATTTGCCACCACCTTCATCATCTAGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATG
CTGATCATCACCCACCGAGAAGTCCAGCGGGAGTACAACCTGAACTTCTCAGGAAGCAGTACTATTCAAGAGGTAAAGAGAAATGTGTAT
GACCTTACAAGTATCCCCGTTCGCCACCAATTATGGGAGGGCTGGCCAACTTCTGCTACAGACGACTCAATGTGTCTTGCTGAATCAGGG
CTCTCTTATCCCTGCCATCGACTTACAGTGGGAAGAAGATCTTCACCTGCACAGACCCGGGAACAGTCGGAAGAACAAATCACCGATGTT
CATATGGTTAGTGATAGCGATGGAGATGACTTTGAAGATGCTACAGAATTTGGGGTGGATGATGGAGAAGTATTTGGCATGGCGTCATCT
GCCTTGAGAAAATCTCCAATGATGCCAGAAAACGCAGAAAATGAAGGAGATGCCTTATTACAATTTACAGCAGAGTTTTCTTCAAGATAT
GGTGATTGCCATCCTGTATTTTTTATTGGCTCATTAGAAGCTGCTTTTCAAGAGGCCTTCTATGTGAAAGCCCGAGATAGAAAGCTTCTT
GCTATCTACCTCCACCATGATGAAAGTGTGTTAACCAACGTGTTCTGCTCACAAATGCTTTGTGCTGAATCCATTGTTTCTTATCTGAGT
CAAAATTTTATAACCTGGGCTTGGGATCTGACAAAGGACTCCAACAGAGCAAGATTTCTCACTATGTGCAATAGACACTTTGGCAGTGTT
GTGGCACAAACCATTCGGACTCAAAAAACGGATCAGTTTCCGCTTTTCCTGATTATTATGGGAAAGCGATCATCTAATGAAGTGTTGAAT
GTGATACAAGGGAACACAACAGTAGATGAGTTAATGATGAGACTCATGGCTGCAATGGAGATCTTCACAGCCCAACAACAGGAAGATATA
AAGGACGAGGATGAACGTGAAGCCAGAGAAAATGTGAAGAGAGAGCAAGATGAGGCCTATCGCCTTTCACTTGAGGCTGACAGAGCAAAG
AGGGAAGCTCACGAGAGAGAGATGGCAGAACAGTTTCGTTTGGAGCAGATTCGCAAAGAACAAGAAGAGGAACGTGAGGCCATCCGGCTG
TCCTTAGAGCAAGCCCTGCCTCCTGAGCCAAAGGAAGAAAATGCTGAGCCTGTGAGCAAACTGCGGATCCGGACCCCCAGTGGCGAGTTC
TTGGAGCGGCGTTTCCTGGCCAGCAACAAGCTCCAGATTGTCTTTGATTTTGTAGCTTCCAAAGGATTTCCATGGGATGAGTACAAGTTA
CTGAGCACCTTTCCTAGGAGAGACGTAACTCAACTGGACCCAAATAAATCATTATTGGAGGTAAAGTTGTTCCCTCAAGAAACCCTTTTC

>In-frame_GABRB3_ENST00000541819_chr15_27017548_-_FAF1_ENST00000396153_chr1_51323670_-_1908nt
GCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGCTTGAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATA
CCACAGGAAAATGGCATTCTACAAAGTGAATATGGAGGTGAGACCATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCT
CCTACTTCCTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCATCCAGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTT
GAATACAGAGACAGAAATGTTGATGTGGTACTTGAAGACACCTGTACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATA
CCTGTGTCCAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATGTGGAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAAC
AGTCTTTATGTCCTTACACCAGATTTGCCACCACCTTCATCATCTAGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATG
CTGATCATCACCCACCGAGAAGTCCAGCGGGAGTACAACCTGAACTTCTCAGGAAGCAGTACTATTCAAGAGGTAAAGAGAAATGTGTAT
GACCTTACAAGTATCCCCGTTCGCCACCAATTATGGGAGGGCTGGCCAACTTCTGCTACAGACGACTCAATGTGTCTTGCTGAATCAGGG
CTCTCTTATCCCTGCCATCGACTTACAGTGGGAAGAAGATCTTCACCTGCACAGACCCGGGAACAGTCGGAAGAACAAATCACCGATGTT
CATATGGTTAGTGATAGCGATGGAGATGACTTTGAAGATGCTACAGAATTTGGGGTGGATGATGGAGAAGTATTTGGCATGGCGTCATCT
GCCTTGAGAAAATCTCCAATGATGCCAGAAAACGCAGAAAATGAAGGAGATGCCTTATTACAATTTACAGCAGAGTTTTCTTCAAGATAT
GGTGATTGCCATCCTGTATTTTTTATTGGCTCATTAGAAGCTGCTTTTCAAGAGGCCTTCTATGTGAAAGCCCGAGATAGAAAGCTTCTT
GCTATCTACCTCCACCATGATGAAAGTGTGTTAACCAACGTGTTCTGCTCACAAATGCTTTGTGCTGAATCCATTGTTTCTTATCTGAGT
CAAAATTTTATAACCTGGGCTTGGGATCTGACAAAGGACTCCAACAGAGCAAGATTTCTCACTATGTGCAATAGACACTTTGGCAGTGTT
GTGGCACAAACCATTCGGACTCAAAAAACGGATCAGTTTCCGCTTTTCCTGATTATTATGGGAAAGCGATCATCTAATGAAGTGTTGAAT
GTGATACAAGGGAACACAACAGTAGATGAGTTAATGATGAGACTCATGGCTGCAATGGAGATCTTCACAGCCCAACAACAGGAAGATATA
AAGGACGAGGATGAACGTGAAGCCAGAGAAAATGTGAAGAGAGAGCAAGATGAGGCCTATCGCCTTTCACTTGAGGCTGACAGAGCAAAG
AGGGAAGCTCACGAGAGAGAGATGGCAGAACAGTTTCGTTTGGAGCAGATTCGCAAAGAACAAGAAGAGGAACGTGAGGCCATCCGGCTG
TCCTTAGAGCAAGCCCTGCCTCCTGAGCCAAAGGAAGAAAATGCTGAGCCTGTGAGCAAACTGCGGATCCGGACCCCCAGTGGCGAGTTC
TTGGAGCGGCGTTTCCTGGCCAGCAACAAGCTCCAGATTGTCTTTGATTTTGTAGCTTCCAAAGGATTTCCATGGGATGAGTACAAGTTA
CTGAGCACCTTTCCTAGGAGAGACGTAACTCAACTGGACCCAAATAAATCATTATTGGAGGTAAAGTTGTTCCCTCAAGAAACCCTTTTC

>In-frame_GABRB3_ENST00000541819_chr15_27017548_-_FAF1_ENST00000371778_chr1_51323670_-_1908nt
GCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGCTTGAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATA
CCACAGGAAAATGGCATTCTACAAAGTGAATATGGAGGTGAGACCATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCT
CCTACTTCCTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCATCCAGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTT
GAATACAGAGACAGAAATGTTGATGTGGTACTTGAAGACACCTGTACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATA
CCTGTGTCCAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATGTGGAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAAC
AGTCTTTATGTCCTTACACCAGATTTGCCACCACCTTCATCATCTAGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATG
CTGATCATCACCCACCGAGAAGTCCAGCGGGAGTACAACCTGAACTTCTCAGGAAGCAGTACTATTCAAGAGGTAAAGAGAAATGTGTAT
GACCTTACAAGTATCCCCGTTCGCCACCAATTATGGGAGGGCTGGCCAACTTCTGCTACAGACGACTCAATGTGTCTTGCTGAATCAGGG
CTCTCTTATCCCTGCCATCGACTTACAGTGGGAAGAAGATCTTCACCTGCACAGACCCGGGAACAGTCGGAAGAACAAATCACCGATGTT
CATATGGTTAGTGATAGCGATGGAGATGACTTTGAAGATGCTACAGAATTTGGGGTGGATGATGGAGAAGTATTTGGCATGGCGTCATCT
GCCTTGAGAAAATCTCCAATGATGCCAGAAAACGCAGAAAATGAAGGAGATGCCTTATTACAATTTACAGCAGAGTTTTCTTCAAGATAT
GGTGATTGCCATCCTGTATTTTTTATTGGCTCATTAGAAGCTGCTTTTCAAGAGGCCTTCTATGTGAAAGCCCGAGATAGAAAGCTTCTT
GCTATCTACCTCCACCATGATGAAAGTGTGTTAACCAACGTGTTCTGCTCACAAATGCTTTGTGCTGAATCCATTGTTTCTTATCTGAGT
CAAAATTTTATAACCTGGGCTTGGGATCTGACAAAGGACTCCAACAGAGCAAGATTTCTCACTATGTGCAATAGACACTTTGGCAGTGTT
GTGGCACAAACCATTCGGACTCAAAAAACGGATCAGTTTCCGCTTTTCCTGATTATTATGGGAAAGCGATCATCTAATGAAGTGTTGAAT
GTGATACAAGGGAACACAACAGTAGATGAGTTAATGATGAGACTCATGGCTGCAATGGAGATCTTCACAGCCCAACAACAGGAAGATATA
AAGGACGAGGATGAACGTGAAGCCAGAGAAAATGTGAAGAGAGAGCAAGATGAGGCCTATCGCCTTTCACTTGAGGCTGACAGAGCAAAG
AGGGAAGCTCACGAGAGAGAGATGGCAGAACAGTTTCGTTTGGAGCAGATTCGCAAAGAACAAGAAGAGGAACGTGAGGCCATCCGGCTG
TCCTTAGAGCAAGCCCTGCCTCCTGAGCCAAAGGAAGAAAATGCTGAGCCTGTGAGCAAACTGCGGATCCGGACCCCCAGTGGCGAGTTC
TTGGAGCGGCGTTTCCTGGCCAGCAACAAGCTCCAGATTGTCTTTGATTTTGTAGCTTCCAAAGGATTTCCATGGGATGAGTACAAGTTA
CTGAGCACCTTTCCTAGGAGAGACGTAACTCAACTGGACCCAAATAAATCATTATTGGAGGTAAAGTTGTTCCCTCAAGAAACCCTTTTC

>In-frame_GABRB3_ENST00000299267_chr15_27017548_-_FAF1_ENST00000396153_chr1_51323670_-_1908nt
GCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGCTTGAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATA
CCACAGGAAAATGGCATTCTACAAAGTGAATATGGAGGTGAGACCATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCT
CCTACTTCCTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCATCCAGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTT
GAATACAGAGACAGAAATGTTGATGTGGTACTTGAAGACACCTGTACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATA
CCTGTGTCCAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATGTGGAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAAC
AGTCTTTATGTCCTTACACCAGATTTGCCACCACCTTCATCATCTAGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATG
CTGATCATCACCCACCGAGAAGTCCAGCGGGAGTACAACCTGAACTTCTCAGGAAGCAGTACTATTCAAGAGGTAAAGAGAAATGTGTAT
GACCTTACAAGTATCCCCGTTCGCCACCAATTATGGGAGGGCTGGCCAACTTCTGCTACAGACGACTCAATGTGTCTTGCTGAATCAGGG
CTCTCTTATCCCTGCCATCGACTTACAGTGGGAAGAAGATCTTCACCTGCACAGACCCGGGAACAGTCGGAAGAACAAATCACCGATGTT
CATATGGTTAGTGATAGCGATGGAGATGACTTTGAAGATGCTACAGAATTTGGGGTGGATGATGGAGAAGTATTTGGCATGGCGTCATCT
GCCTTGAGAAAATCTCCAATGATGCCAGAAAACGCAGAAAATGAAGGAGATGCCTTATTACAATTTACAGCAGAGTTTTCTTCAAGATAT
GGTGATTGCCATCCTGTATTTTTTATTGGCTCATTAGAAGCTGCTTTTCAAGAGGCCTTCTATGTGAAAGCCCGAGATAGAAAGCTTCTT
GCTATCTACCTCCACCATGATGAAAGTGTGTTAACCAACGTGTTCTGCTCACAAATGCTTTGTGCTGAATCCATTGTTTCTTATCTGAGT
CAAAATTTTATAACCTGGGCTTGGGATCTGACAAAGGACTCCAACAGAGCAAGATTTCTCACTATGTGCAATAGACACTTTGGCAGTGTT
GTGGCACAAACCATTCGGACTCAAAAAACGGATCAGTTTCCGCTTTTCCTGATTATTATGGGAAAGCGATCATCTAATGAAGTGTTGAAT
GTGATACAAGGGAACACAACAGTAGATGAGTTAATGATGAGACTCATGGCTGCAATGGAGATCTTCACAGCCCAACAACAGGAAGATATA
AAGGACGAGGATGAACGTGAAGCCAGAGAAAATGTGAAGAGAGAGCAAGATGAGGCCTATCGCCTTTCACTTGAGGCTGACAGAGCAAAG
AGGGAAGCTCACGAGAGAGAGATGGCAGAACAGTTTCGTTTGGAGCAGATTCGCAAAGAACAAGAAGAGGAACGTGAGGCCATCCGGCTG
TCCTTAGAGCAAGCCCTGCCTCCTGAGCCAAAGGAAGAAAATGCTGAGCCTGTGAGCAAACTGCGGATCCGGACCCCCAGTGGCGAGTTC
TTGGAGCGGCGTTTCCTGGCCAGCAACAAGCTCCAGATTGTCTTTGATTTTGTAGCTTCCAAAGGATTTCCATGGGATGAGTACAAGTTA
CTGAGCACCTTTCCTAGGAGAGACGTAACTCAACTGGACCCAAATAAATCATTATTGGAGGTAAAGTTGTTCCCTCAAGAAACCCTTTTC

>In-frame_GABRB3_ENST00000299267_chr15_27017548_-_FAF1_ENST00000371778_chr1_51323670_-_1908nt
GCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGCTTGAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATA
CCACAGGAAAATGGCATTCTACAAAGTGAATATGGAGGTGAGACCATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCT
CCTACTTCCTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCATCCAGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTT
GAATACAGAGACAGAAATGTTGATGTGGTACTTGAAGACACCTGTACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATA
CCTGTGTCCAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATGTGGAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAAC
AGTCTTTATGTCCTTACACCAGATTTGCCACCACCTTCATCATCTAGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATG
CTGATCATCACCCACCGAGAAGTCCAGCGGGAGTACAACCTGAACTTCTCAGGAAGCAGTACTATTCAAGAGGTAAAGAGAAATGTGTAT
GACCTTACAAGTATCCCCGTTCGCCACCAATTATGGGAGGGCTGGCCAACTTCTGCTACAGACGACTCAATGTGTCTTGCTGAATCAGGG
CTCTCTTATCCCTGCCATCGACTTACAGTGGGAAGAAGATCTTCACCTGCACAGACCCGGGAACAGTCGGAAGAACAAATCACCGATGTT
CATATGGTTAGTGATAGCGATGGAGATGACTTTGAAGATGCTACAGAATTTGGGGTGGATGATGGAGAAGTATTTGGCATGGCGTCATCT
GCCTTGAGAAAATCTCCAATGATGCCAGAAAACGCAGAAAATGAAGGAGATGCCTTATTACAATTTACAGCAGAGTTTTCTTCAAGATAT
GGTGATTGCCATCCTGTATTTTTTATTGGCTCATTAGAAGCTGCTTTTCAAGAGGCCTTCTATGTGAAAGCCCGAGATAGAAAGCTTCTT
GCTATCTACCTCCACCATGATGAAAGTGTGTTAACCAACGTGTTCTGCTCACAAATGCTTTGTGCTGAATCCATTGTTTCTTATCTGAGT
CAAAATTTTATAACCTGGGCTTGGGATCTGACAAAGGACTCCAACAGAGCAAGATTTCTCACTATGTGCAATAGACACTTTGGCAGTGTT
GTGGCACAAACCATTCGGACTCAAAAAACGGATCAGTTTCCGCTTTTCCTGATTATTATGGGAAAGCGATCATCTAATGAAGTGTTGAAT
GTGATACAAGGGAACACAACAGTAGATGAGTTAATGATGAGACTCATGGCTGCAATGGAGATCTTCACAGCCCAACAACAGGAAGATATA
AAGGACGAGGATGAACGTGAAGCCAGAGAAAATGTGAAGAGAGAGCAAGATGAGGCCTATCGCCTTTCACTTGAGGCTGACAGAGCAAAG
AGGGAAGCTCACGAGAGAGAGATGGCAGAACAGTTTCGTTTGGAGCAGATTCGCAAAGAACAAGAAGAGGAACGTGAGGCCATCCGGCTG
TCCTTAGAGCAAGCCCTGCCTCCTGAGCCAAAGGAAGAAAATGCTGAGCCTGTGAGCAAACTGCGGATCCGGACCCCCAGTGGCGAGTTC
TTGGAGCGGCGTTTCCTGGCCAGCAACAAGCTCCAGATTGTCTTTGATTTTGTAGCTTCCAAAGGATTTCCATGGGATGAGTACAAGTTA
CTGAGCACCTTTCCTAGGAGAGACGTAACTCAACTGGACCCAAATAAATCATTATTGGAGGTAAAGTTGTTCCCTCAAGAAACCCTTTTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_GABRB3_ENST00000311550_chr15_27017548_-_FAF1_ENST00000396153_chr1_51323670_-_4222nt
TCCGGGCCAGCGCGGCGGCGGCGGCGGCGGCGGCAGCAGCAGGAGCAGCCCCGGCTGCGGGTCGCGACGGCGGCGGGGCGCCCCCTCCCC
CGTGCCGGGGCGCGGCGGAGGGATGTGGGGCCTTGCGGGAGGAAGGCTTTTCGGCATCTTCTCGGCCCCGGTGCTGGTGGCTGTGGTGTG
CTGCGCCCAGAGTGTGAACGATCCCGGGAACATGTCCTTTGTGAAGGAGACGGTGGACAAGCTGTTGAAAGGCTACGACATTCGCCTAAG
ACCCGACTTCGGGGGTCCCCCGGTCTGCGTGGGGATGAACATCGACATCGCCAGCATCGACATGGTTTCCGAAGTCAACATGGCATGTAC
TGGCATTGAAAACATTGACGAAGCTATTACATTGCTTGAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATACCACAGGA
AAATGGCATTCTACAAAGTGAATATGGAGGTGAGACCATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCTCCTACTTC
CTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCATCCAGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTTGAATACAG
AGACAGAAATGTTGATGTGGTACTTGAAGACACCTGTACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATACCTGTGTC
CAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATGTGGAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAACAGTCTTTA
TGTCCTTACACCAGATTTGCCACCACCTTCATCATCTAGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATGCTGATCAT
CACCCACCGAGAAGTCCAGCGGGAGTACAACCTGAACTTCTCAGGAAGCAGTACTATTCAAGAGGTAAAGAGAAATGTGTATGACCTTAC
AAGTATCCCCGTTCGCCACCAATTATGGGAGGGCTGGCCAACTTCTGCTACAGACGACTCAATGTGTCTTGCTGAATCAGGGCTCTCTTA
TCCCTGCCATCGACTTACAGTGGGAAGAAGATCTTCACCTGCACAGACCCGGGAACAGTCGGAAGAACAAATCACCGATGTTCATATGGT
TAGTGATAGCGATGGAGATGACTTTGAAGATGCTACAGAATTTGGGGTGGATGATGGAGAAGTATTTGGCATGGCGTCATCTGCCTTGAG
AAAATCTCCAATGATGCCAGAAAACGCAGAAAATGAAGGAGATGCCTTATTACAATTTACAGCAGAGTTTTCTTCAAGATATGGTGATTG
CCATCCTGTATTTTTTATTGGCTCATTAGAAGCTGCTTTTCAAGAGGCCTTCTATGTGAAAGCCCGAGATAGAAAGCTTCTTGCTATCTA
CCTCCACCATGATGAAAGTGTGTTAACCAACGTGTTCTGCTCACAAATGCTTTGTGCTGAATCCATTGTTTCTTATCTGAGTCAAAATTT
TATAACCTGGGCTTGGGATCTGACAAAGGACTCCAACAGAGCAAGATTTCTCACTATGTGCAATAGACACTTTGGCAGTGTTGTGGCACA
AACCATTCGGACTCAAAAAACGGATCAGTTTCCGCTTTTCCTGATTATTATGGGAAAGCGATCATCTAATGAAGTGTTGAATGTGATACA
AGGGAACACAACAGTAGATGAGTTAATGATGAGACTCATGGCTGCAATGGAGATCTTCACAGCCCAACAACAGGAAGATATAAAGGACGA
GGATGAACGTGAAGCCAGAGAAAATGTGAAGAGAGAGCAAGATGAGGCCTATCGCCTTTCACTTGAGGCTGACAGAGCAAAGAGGGAAGC
TCACGAGAGAGAGATGGCAGAACAGTTTCGTTTGGAGCAGATTCGCAAAGAACAAGAAGAGGAACGTGAGGCCATCCGGCTGTCCTTAGA
GCAAGCCCTGCCTCCTGAGCCAAAGGAAGAAAATGCTGAGCCTGTGAGCAAACTGCGGATCCGGACCCCCAGTGGCGAGTTCTTGGAGCG
GCGTTTCCTGGCCAGCAACAAGCTCCAGATTGTCTTTGATTTTGTAGCTTCCAAAGGATTTCCATGGGATGAGTACAAGTTACTGAGCAC
CTTTCCTAGGAGAGACGTAACTCAACTGGACCCAAATAAATCATTATTGGAGGTAAAGTTGTTCCCTCAAGAAACCCTTTTCCTTGAAGC
AAAAGAGTAAACACGGCCCAGCGGTGGAACCAGCCATTCCTTGACAAGCCAGCAGCCTGCGTCAGGAGAAGGGCTCCTCGCCAACCCACC
CACACGCTCGTCTCACTCAATTCAATGTCACACTTCTGCCTCTTGCAAAATTGCTGGAAAAAGTAATAATAAATATAGCTACTTAAGATT
TCCCATCCATGAGTATATATTCCCAACCCTTATTACAGAGAATTACAACTCTGCCACCCTCCCCTACCCCCTGCACTTCACCCTCCTTCA
ATGACGAATGCATTGTTCAAGTGTGAGTGATCACTAAATAGAATTTTTACCTCTCCAGTGCCCATCTTTTCCCCACAGTGTCTAGGACAG
TTCTGTCTGTTCTGTGACACCAGGATGCTGTATATTTGATATATGTCTTTTTATTTTCATGACTGAATTTCTACTTCATCACCTAATTTT
AAGGGGCAGAGGGAAAAAAAGTCAAATGAGACATTGTCGGCATGGAGATTAAACATTGTAGGAAAAAAGTATACCATTTTTGTTAGAACT
TTCTGATGGCTTTACTAAGATGTCAGGTTTTGTTTGAGGACTGAATTTGACATATATGCAAGATATTTATTTACTGCTGCTGCCTTGGGT
CTCCAGGTTCTACCTAGGAGGTATTTGCTGTTCCATTGCAGCATAGGGAAACTGTTCAAGCACACAATGTGAATGTTGAGATCATGTGCA
GAGAGGCCAGTACCAAAACTTCAGTATCTGGCCCAATGGCAAGAGGCTACTGTTAGGTTTGCATTTGGGCAGTTAGAACCTCACAGATAC
CAGCTCCCAAGTTGCTAGTCCATCAGTGTAAACTGAACACAATTCTCTCTTGCTTTCTCTCTCTCTACTCCCTCACACATTTGGACCTTG
TCACTTGGTGTTTAAGCACCTTGCCTATCAACAAAATCTGATGAGCAGCCCCATGGACTCTCCTGTAATAAGGAACTTGCTCTACTATTT
TATTCTTTTAATGTTTTAGTATTTGATATTGGACTCAAATGAAAGGGATCTCATTCTGTGGCTGAAAAATCAGACTTCATATGTTGAAGA
GAGCAAACTTGGGGACTCAACTCAGAAGACATGTGTTGCCTGAAACCTGCATATAATAATTTTTGATTTGATTTAGTAAGTGTGGATTTT
TCTTAATCTACAGATTTGGGGTTTGGGGTTTAGATCATGAGAACACCGTTTATACCTTCACAGCCAATGATTTATTTTTAGTCTTGAAAT
ATTTCTCCATATCTGTTTTTGTGTCACCTGTGGGTTTTATCCTAGGGGTTGGGATCCTGATTTTAACATTTTGTACTTGTCCAAAAAAGA
GTTCAAATGCTGGGTTTGTTCCCCCAGCCTCGGCCAAGGGGTTCTCAGAAGATTCTAACCAAAGCTGGAGATAGGTCTGCTCATTTTCCT
TCTGCCCAGAAGTGGATGTTGGCCAGGAAAATTACACCTTGTGTCTTCTCTGATGCTCCAACCAGGGACCTCTCCAGATTACTATCTAGC
ACAGACTAGTGCTACATCTGCCTAGGTATGGGCTTTCTCTGGCAGCAGGGGTCTCTCTAGGGAGGCTGAGAGACCCATGGGTCTCCCTTC
AGGGGAAGTGTTCAGGGGAGTTCAAACTGAACACTTCTCTCCAGCTCTATTCCTATCTTCCTAATCTAATGGCTCTACAAGATAGTCATT
TCCAGTGCTACAGATGCACCAGGGCACCACCTCTTTTTTTTTCTAGGTAGACCTTGTTCTGTAGCTGCTGTGAAGAAGCTGCAGCCCTGA
ACTCAGGTCATACTCAGGAACAGCAGCAGGGGTGTGGGTGGGGTTTGAGGGAAGGTACTCTGAATTCACCTTCATGTTTAACCTGTTCCA

>In-frame_GABRB3_ENST00000311550_chr15_27017548_-_FAF1_ENST00000371778_chr1_51323670_-_2663nt
TCCGGGCCAGCGCGGCGGCGGCGGCGGCGGCGGCAGCAGCAGGAGCAGCCCCGGCTGCGGGTCGCGACGGCGGCGGGGCGCCCCCTCCCC
CGTGCCGGGGCGCGGCGGAGGGATGTGGGGCCTTGCGGGAGGAAGGCTTTTCGGCATCTTCTCGGCCCCGGTGCTGGTGGCTGTGGTGTG
CTGCGCCCAGAGTGTGAACGATCCCGGGAACATGTCCTTTGTGAAGGAGACGGTGGACAAGCTGTTGAAAGGCTACGACATTCGCCTAAG
ACCCGACTTCGGGGGTCCCCCGGTCTGCGTGGGGATGAACATCGACATCGCCAGCATCGACATGGTTTCCGAAGTCAACATGGCATGTAC
TGGCATTGAAAACATTGACGAAGCTATTACATTGCTTGAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATACCACAGGA
AAATGGCATTCTACAAAGTGAATATGGAGGTGAGACCATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCTCCTACTTC
CTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCATCCAGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTTGAATACAG
AGACAGAAATGTTGATGTGGTACTTGAAGACACCTGTACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATACCTGTGTC
CAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATGTGGAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAACAGTCTTTA
TGTCCTTACACCAGATTTGCCACCACCTTCATCATCTAGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATGCTGATCAT
CACCCACCGAGAAGTCCAGCGGGAGTACAACCTGAACTTCTCAGGAAGCAGTACTATTCAAGAGGTAAAGAGAAATGTGTATGACCTTAC
AAGTATCCCCGTTCGCCACCAATTATGGGAGGGCTGGCCAACTTCTGCTACAGACGACTCAATGTGTCTTGCTGAATCAGGGCTCTCTTA
TCCCTGCCATCGACTTACAGTGGGAAGAAGATCTTCACCTGCACAGACCCGGGAACAGTCGGAAGAACAAATCACCGATGTTCATATGGT
TAGTGATAGCGATGGAGATGACTTTGAAGATGCTACAGAATTTGGGGTGGATGATGGAGAAGTATTTGGCATGGCGTCATCTGCCTTGAG
AAAATCTCCAATGATGCCAGAAAACGCAGAAAATGAAGGAGATGCCTTATTACAATTTACAGCAGAGTTTTCTTCAAGATATGGTGATTG
CCATCCTGTATTTTTTATTGGCTCATTAGAAGCTGCTTTTCAAGAGGCCTTCTATGTGAAAGCCCGAGATAGAAAGCTTCTTGCTATCTA
CCTCCACCATGATGAAAGTGTGTTAACCAACGTGTTCTGCTCACAAATGCTTTGTGCTGAATCCATTGTTTCTTATCTGAGTCAAAATTT
TATAACCTGGGCTTGGGATCTGACAAAGGACTCCAACAGAGCAAGATTTCTCACTATGTGCAATAGACACTTTGGCAGTGTTGTGGCACA
AACCATTCGGACTCAAAAAACGGATCAGTTTCCGCTTTTCCTGATTATTATGGGAAAGCGATCATCTAATGAAGTGTTGAATGTGATACA
AGGGAACACAACAGTAGATGAGTTAATGATGAGACTCATGGCTGCAATGGAGATCTTCACAGCCCAACAACAGGAAGATATAAAGGACGA
GGATGAACGTGAAGCCAGAGAAAATGTGAAGAGAGAGCAAGATGAGGCCTATCGCCTTTCACTTGAGGCTGACAGAGCAAAGAGGGAAGC
TCACGAGAGAGAGATGGCAGAACAGTTTCGTTTGGAGCAGATTCGCAAAGAACAAGAAGAGGAACGTGAGGCCATCCGGCTGTCCTTAGA
GCAAGCCCTGCCTCCTGAGCCAAAGGAAGAAAATGCTGAGCCTGTGAGCAAACTGCGGATCCGGACCCCCAGTGGCGAGTTCTTGGAGCG
GCGTTTCCTGGCCAGCAACAAGCTCCAGATTGTCTTTGATTTTGTAGCTTCCAAAGGATTTCCATGGGATGAGTACAAGTTACTGAGCAC
CTTTCCTAGGAGAGACGTAACTCAACTGGACCCAAATAAATCATTATTGGAGGTAAAGTTGTTCCCTCAAGAAACCCTTTTCCTTGAAGC
AAAAGAGTAAACACGGCCCAGCGGTGGAACCAGCCATTCCTTGACAAGCCAGCAGCCTGCGTCAGGAGAAGGGCTCCTCGCCAACCCACC
CACACGCTCGTCTCACTCAATTCAATGTCACACTTCTGCCTCTTGCAAAATTGCTGGAAAAAGTAATAATAAATATAGCTACTTAAGATT
TCCCATCCATGAGTATATATTCCCAACCCTTATTACAGAGAATTACAACTCTGCCACCCTCCCCTACCCCCTGCACTTCACCCTCCTTCA
ATGACGAATGCATTGTTCAAGTGTGAGTGATCACTAAATAGAATTTTTACCTCTCCAGTGCCCATCTTTTCCCCACAGTGTCTAGGACAG

>In-frame_GABRB3_ENST00000541819_chr15_27017548_-_FAF1_ENST00000396153_chr1_51323670_-_4381nt
ACAGAGTCCTTCCTGTTTCCAGTCTAGAGGCTCCAGGGAGGTGAGACGACCACTCCCACCAGCAGCAGGCCCTGTGCTGGCTGTGTCGCA
GGTGCAGAGTGAGATGCAGCAGCTCAGGAGGCTCTGGGTCCTGGCAGCTCAACCCTTCTGCCACCTACCAGAGAGGTGTCGCCTGTTCTT
TGAAATCGGGGGCATTTCATTGGCGATGCCCCAGTGCCTTCTCTGGATTTGCCTGGCTGTGTGGGAGGCACGAGGAGACCTCCCATTCAT
TGCTGAGAATGATGCCGTCCTCACGGTGAACTGGAACGCAGTCAAAGAACACAGAACATTTTATGCCATTTATGAAACCAGTGTGAACGA
TCCCGGGAACATGTCCTTTGTGAAGGAGACGGTGGACAAGCTGTTGAAAGGCTACGACATTCGCCTAAGACCCGACTTCGGGGGTCCCCC
GGTCTGCGTGGGGATGAACATCGACATCGCCAGCATCGACATGGTTTCCGAAGTCAACATGGCATGTACTGGCATTGAAAACATTGACGA
AGCTATTACATTGCTTGAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATACCACAGGAAAATGGCATTCTACAAAGTGA
ATATGGAGGTGAGACCATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCTCCTACTTCCTCTTCTTCTTCAGCGTTTCG
ACCTGTAATGCCATCCAGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTTGAATACAGAGACAGAAATGTTGATGTGGT
ACTTGAAGACACCTGTACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATACCTGTGTCCAAAATGCTGTTAAAAGGCTG
GAAGACGGGAGATGTGGAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAACAGTCTTTATGTCCTTACACCAGATTTGCC
ACCACCTTCATCATCTAGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATGCTGATCATCACCCACCGAGAAGTCCAGCG
GGAGTACAACCTGAACTTCTCAGGAAGCAGTACTATTCAAGAGGTAAAGAGAAATGTGTATGACCTTACAAGTATCCCCGTTCGCCACCA
ATTATGGGAGGGCTGGCCAACTTCTGCTACAGACGACTCAATGTGTCTTGCTGAATCAGGGCTCTCTTATCCCTGCCATCGACTTACAGT
GGGAAGAAGATCTTCACCTGCACAGACCCGGGAACAGTCGGAAGAACAAATCACCGATGTTCATATGGTTAGTGATAGCGATGGAGATGA
CTTTGAAGATGCTACAGAATTTGGGGTGGATGATGGAGAAGTATTTGGCATGGCGTCATCTGCCTTGAGAAAATCTCCAATGATGCCAGA
AAACGCAGAAAATGAAGGAGATGCCTTATTACAATTTACAGCAGAGTTTTCTTCAAGATATGGTGATTGCCATCCTGTATTTTTTATTGG
CTCATTAGAAGCTGCTTTTCAAGAGGCCTTCTATGTGAAAGCCCGAGATAGAAAGCTTCTTGCTATCTACCTCCACCATGATGAAAGTGT
GTTAACCAACGTGTTCTGCTCACAAATGCTTTGTGCTGAATCCATTGTTTCTTATCTGAGTCAAAATTTTATAACCTGGGCTTGGGATCT
GACAAAGGACTCCAACAGAGCAAGATTTCTCACTATGTGCAATAGACACTTTGGCAGTGTTGTGGCACAAACCATTCGGACTCAAAAAAC
GGATCAGTTTCCGCTTTTCCTGATTATTATGGGAAAGCGATCATCTAATGAAGTGTTGAATGTGATACAAGGGAACACAACAGTAGATGA
GTTAATGATGAGACTCATGGCTGCAATGGAGATCTTCACAGCCCAACAACAGGAAGATATAAAGGACGAGGATGAACGTGAAGCCAGAGA
AAATGTGAAGAGAGAGCAAGATGAGGCCTATCGCCTTTCACTTGAGGCTGACAGAGCAAAGAGGGAAGCTCACGAGAGAGAGATGGCAGA
ACAGTTTCGTTTGGAGCAGATTCGCAAAGAACAAGAAGAGGAACGTGAGGCCATCCGGCTGTCCTTAGAGCAAGCCCTGCCTCCTGAGCC
AAAGGAAGAAAATGCTGAGCCTGTGAGCAAACTGCGGATCCGGACCCCCAGTGGCGAGTTCTTGGAGCGGCGTTTCCTGGCCAGCAACAA
GCTCCAGATTGTCTTTGATTTTGTAGCTTCCAAAGGATTTCCATGGGATGAGTACAAGTTACTGAGCACCTTTCCTAGGAGAGACGTAAC
TCAACTGGACCCAAATAAATCATTATTGGAGGTAAAGTTGTTCCCTCAAGAAACCCTTTTCCTTGAAGCAAAAGAGTAAACACGGCCCAG
CGGTGGAACCAGCCATTCCTTGACAAGCCAGCAGCCTGCGTCAGGAGAAGGGCTCCTCGCCAACCCACCCACACGCTCGTCTCACTCAAT
TCAATGTCACACTTCTGCCTCTTGCAAAATTGCTGGAAAAAGTAATAATAAATATAGCTACTTAAGATTTCCCATCCATGAGTATATATT
CCCAACCCTTATTACAGAGAATTACAACTCTGCCACCCTCCCCTACCCCCTGCACTTCACCCTCCTTCAATGACGAATGCATTGTTCAAG
TGTGAGTGATCACTAAATAGAATTTTTACCTCTCCAGTGCCCATCTTTTCCCCACAGTGTCTAGGACAGTTCTGTCTGTTCTGTGACACC
AGGATGCTGTATATTTGATATATGTCTTTTTATTTTCATGACTGAATTTCTACTTCATCACCTAATTTTAAGGGGCAGAGGGAAAAAAAG
TCAAATGAGACATTGTCGGCATGGAGATTAAACATTGTAGGAAAAAAGTATACCATTTTTGTTAGAACTTTCTGATGGCTTTACTAAGAT
GTCAGGTTTTGTTTGAGGACTGAATTTGACATATATGCAAGATATTTATTTACTGCTGCTGCCTTGGGTCTCCAGGTTCTACCTAGGAGG
TATTTGCTGTTCCATTGCAGCATAGGGAAACTGTTCAAGCACACAATGTGAATGTTGAGATCATGTGCAGAGAGGCCAGTACCAAAACTT
CAGTATCTGGCCCAATGGCAAGAGGCTACTGTTAGGTTTGCATTTGGGCAGTTAGAACCTCACAGATACCAGCTCCCAAGTTGCTAGTCC
ATCAGTGTAAACTGAACACAATTCTCTCTTGCTTTCTCTCTCTCTACTCCCTCACACATTTGGACCTTGTCACTTGGTGTTTAAGCACCT
TGCCTATCAACAAAATCTGATGAGCAGCCCCATGGACTCTCCTGTAATAAGGAACTTGCTCTACTATTTTATTCTTTTAATGTTTTAGTA
TTTGATATTGGACTCAAATGAAAGGGATCTCATTCTGTGGCTGAAAAATCAGACTTCATATGTTGAAGAGAGCAAACTTGGGGACTCAAC
TCAGAAGACATGTGTTGCCTGAAACCTGCATATAATAATTTTTGATTTGATTTAGTAAGTGTGGATTTTTCTTAATCTACAGATTTGGGG
TTTGGGGTTTAGATCATGAGAACACCGTTTATACCTTCACAGCCAATGATTTATTTTTAGTCTTGAAATATTTCTCCATATCTGTTTTTG
TGTCACCTGTGGGTTTTATCCTAGGGGTTGGGATCCTGATTTTAACATTTTGTACTTGTCCAAAAAAGAGTTCAAATGCTGGGTTTGTTC
CCCCAGCCTCGGCCAAGGGGTTCTCAGAAGATTCTAACCAAAGCTGGAGATAGGTCTGCTCATTTTCCTTCTGCCCAGAAGTGGATGTTG
GCCAGGAAAATTACACCTTGTGTCTTCTCTGATGCTCCAACCAGGGACCTCTCCAGATTACTATCTAGCACAGACTAGTGCTACATCTGC
CTAGGTATGGGCTTTCTCTGGCAGCAGGGGTCTCTCTAGGGAGGCTGAGAGACCCATGGGTCTCCCTTCAGGGGAAGTGTTCAGGGGAGT
TCAAACTGAACACTTCTCTCCAGCTCTATTCCTATCTTCCTAATCTAATGGCTCTACAAGATAGTCATTTCCAGTGCTACAGATGCACCA
GGGCACCACCTCTTTTTTTTTCTAGGTAGACCTTGTTCTGTAGCTGCTGTGAAGAAGCTGCAGCCCTGAACTCAGGTCATACTCAGGAAC
AGCAGCAGGGGTGTGGGTGGGGTTTGAGGGAAGGTACTCTGAATTCACCTTCATGTTTAACCTGTTCCATCTGACTTGGGTTTCTTCATT

>In-frame_GABRB3_ENST00000541819_chr15_27017548_-_FAF1_ENST00000371778_chr1_51323670_-_2822nt
ACAGAGTCCTTCCTGTTTCCAGTCTAGAGGCTCCAGGGAGGTGAGACGACCACTCCCACCAGCAGCAGGCCCTGTGCTGGCTGTGTCGCA
GGTGCAGAGTGAGATGCAGCAGCTCAGGAGGCTCTGGGTCCTGGCAGCTCAACCCTTCTGCCACCTACCAGAGAGGTGTCGCCTGTTCTT
TGAAATCGGGGGCATTTCATTGGCGATGCCCCAGTGCCTTCTCTGGATTTGCCTGGCTGTGTGGGAGGCACGAGGAGACCTCCCATTCAT
TGCTGAGAATGATGCCGTCCTCACGGTGAACTGGAACGCAGTCAAAGAACACAGAACATTTTATGCCATTTATGAAACCAGTGTGAACGA
TCCCGGGAACATGTCCTTTGTGAAGGAGACGGTGGACAAGCTGTTGAAAGGCTACGACATTCGCCTAAGACCCGACTTCGGGGGTCCCCC
GGTCTGCGTGGGGATGAACATCGACATCGCCAGCATCGACATGGTTTCCGAAGTCAACATGGCATGTACTGGCATTGAAAACATTGACGA
AGCTATTACATTGCTTGAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATACCACAGGAAAATGGCATTCTACAAAGTGA
ATATGGAGGTGAGACCATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCTCCTACTTCCTCTTCTTCTTCAGCGTTTCG
ACCTGTAATGCCATCCAGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTTGAATACAGAGACAGAAATGTTGATGTGGT
ACTTGAAGACACCTGTACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATACCTGTGTCCAAAATGCTGTTAAAAGGCTG
GAAGACGGGAGATGTGGAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAACAGTCTTTATGTCCTTACACCAGATTTGCC
ACCACCTTCATCATCTAGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATGCTGATCATCACCCACCGAGAAGTCCAGCG
GGAGTACAACCTGAACTTCTCAGGAAGCAGTACTATTCAAGAGGTAAAGAGAAATGTGTATGACCTTACAAGTATCCCCGTTCGCCACCA
ATTATGGGAGGGCTGGCCAACTTCTGCTACAGACGACTCAATGTGTCTTGCTGAATCAGGGCTCTCTTATCCCTGCCATCGACTTACAGT
GGGAAGAAGATCTTCACCTGCACAGACCCGGGAACAGTCGGAAGAACAAATCACCGATGTTCATATGGTTAGTGATAGCGATGGAGATGA
CTTTGAAGATGCTACAGAATTTGGGGTGGATGATGGAGAAGTATTTGGCATGGCGTCATCTGCCTTGAGAAAATCTCCAATGATGCCAGA
AAACGCAGAAAATGAAGGAGATGCCTTATTACAATTTACAGCAGAGTTTTCTTCAAGATATGGTGATTGCCATCCTGTATTTTTTATTGG
CTCATTAGAAGCTGCTTTTCAAGAGGCCTTCTATGTGAAAGCCCGAGATAGAAAGCTTCTTGCTATCTACCTCCACCATGATGAAAGTGT
GTTAACCAACGTGTTCTGCTCACAAATGCTTTGTGCTGAATCCATTGTTTCTTATCTGAGTCAAAATTTTATAACCTGGGCTTGGGATCT
GACAAAGGACTCCAACAGAGCAAGATTTCTCACTATGTGCAATAGACACTTTGGCAGTGTTGTGGCACAAACCATTCGGACTCAAAAAAC
GGATCAGTTTCCGCTTTTCCTGATTATTATGGGAAAGCGATCATCTAATGAAGTGTTGAATGTGATACAAGGGAACACAACAGTAGATGA
GTTAATGATGAGACTCATGGCTGCAATGGAGATCTTCACAGCCCAACAACAGGAAGATATAAAGGACGAGGATGAACGTGAAGCCAGAGA
AAATGTGAAGAGAGAGCAAGATGAGGCCTATCGCCTTTCACTTGAGGCTGACAGAGCAAAGAGGGAAGCTCACGAGAGAGAGATGGCAGA
ACAGTTTCGTTTGGAGCAGATTCGCAAAGAACAAGAAGAGGAACGTGAGGCCATCCGGCTGTCCTTAGAGCAAGCCCTGCCTCCTGAGCC
AAAGGAAGAAAATGCTGAGCCTGTGAGCAAACTGCGGATCCGGACCCCCAGTGGCGAGTTCTTGGAGCGGCGTTTCCTGGCCAGCAACAA
GCTCCAGATTGTCTTTGATTTTGTAGCTTCCAAAGGATTTCCATGGGATGAGTACAAGTTACTGAGCACCTTTCCTAGGAGAGACGTAAC
TCAACTGGACCCAAATAAATCATTATTGGAGGTAAAGTTGTTCCCTCAAGAAACCCTTTTCCTTGAAGCAAAAGAGTAAACACGGCCCAG
CGGTGGAACCAGCCATTCCTTGACAAGCCAGCAGCCTGCGTCAGGAGAAGGGCTCCTCGCCAACCCACCCACACGCTCGTCTCACTCAAT
TCAATGTCACACTTCTGCCTCTTGCAAAATTGCTGGAAAAAGTAATAATAAATATAGCTACTTAAGATTTCCCATCCATGAGTATATATT
CCCAACCCTTATTACAGAGAATTACAACTCTGCCACCCTCCCCTACCCCCTGCACTTCACCCTCCTTCAATGACGAATGCATTGTTCAAG
TGTGAGTGATCACTAAATAGAATTTTTACCTCTCCAGTGCCCATCTTTTCCCCACAGTGTCTAGGACAGTTCTGTCTGTTCTGTGACACC

>In-frame_GABRB3_ENST00000299267_chr15_27017548_-_FAF1_ENST00000396153_chr1_51323670_-_4174nt
TTTGGCTGCTCGGAGAGTAGGGGGGAGAGCGGATCCCAGCAGGTTAGGCCGGAGGAACAGCGCCATGTGCTCCGGGCTCCTGGAGCTCCT
GCTGCCCATCTGGCTCTCCTGGACCCTGGGGACCCGAGGCTCTGAGCCCCGCAGTGTGAACGATCCCGGGAACATGTCCTTTGTGAAGGA
GACGGTGGACAAGCTGTTGAAAGGCTACGACATTCGCCTAAGACCCGACTTCGGGGGTCCCCCGGTCTGCGTGGGGATGAACATCGACAT
CGCCAGCATCGACATGGTTTCCGAAGTCAACATGGCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGCTTGAACAAAATAA
TTGGGACTTAGTGGCAGCTATCAATGGTGTAATACCACAGGAAAATGGCATTCTACAAAGTGAATATGGAGGTGAGACCATACCAGGACC
TGCATTTAATCCAGCAAGTCATCCAGCTTCAGCTCCTACTTCCTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCATCCAGGCAGATTGT
AGAAAGGCAACCTCGGATGCTGGACTTCAGGGTTGAATACAGAGACAGAAATGTTGATGTGGTACTTGAAGACACCTGTACTGTTGGAGA
GATTAAACAGATTCTAGAAAATGAACTTCAGATACCTGTGTCCAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATGTGGAAGACAGTAC
GGTCCTAAAATCTCTACACTTGCCAAAAAACAACAGTCTTTATGTCCTTACACCAGATTTGCCACCACCTTCATCATCTAGTCATGCTGG
TGCCCTGCAGGAGTCATTAAATCAAAACTTCATGCTGATCATCACCCACCGAGAAGTCCAGCGGGAGTACAACCTGAACTTCTCAGGAAG
CAGTACTATTCAAGAGGTAAAGAGAAATGTGTATGACCTTACAAGTATCCCCGTTCGCCACCAATTATGGGAGGGCTGGCCAACTTCTGC
TACAGACGACTCAATGTGTCTTGCTGAATCAGGGCTCTCTTATCCCTGCCATCGACTTACAGTGGGAAGAAGATCTTCACCTGCACAGAC
CCGGGAACAGTCGGAAGAACAAATCACCGATGTTCATATGGTTAGTGATAGCGATGGAGATGACTTTGAAGATGCTACAGAATTTGGGGT
GGATGATGGAGAAGTATTTGGCATGGCGTCATCTGCCTTGAGAAAATCTCCAATGATGCCAGAAAACGCAGAAAATGAAGGAGATGCCTT
ATTACAATTTACAGCAGAGTTTTCTTCAAGATATGGTGATTGCCATCCTGTATTTTTTATTGGCTCATTAGAAGCTGCTTTTCAAGAGGC
CTTCTATGTGAAAGCCCGAGATAGAAAGCTTCTTGCTATCTACCTCCACCATGATGAAAGTGTGTTAACCAACGTGTTCTGCTCACAAAT
GCTTTGTGCTGAATCCATTGTTTCTTATCTGAGTCAAAATTTTATAACCTGGGCTTGGGATCTGACAAAGGACTCCAACAGAGCAAGATT
TCTCACTATGTGCAATAGACACTTTGGCAGTGTTGTGGCACAAACCATTCGGACTCAAAAAACGGATCAGTTTCCGCTTTTCCTGATTAT
TATGGGAAAGCGATCATCTAATGAAGTGTTGAATGTGATACAAGGGAACACAACAGTAGATGAGTTAATGATGAGACTCATGGCTGCAAT
GGAGATCTTCACAGCCCAACAACAGGAAGATATAAAGGACGAGGATGAACGTGAAGCCAGAGAAAATGTGAAGAGAGAGCAAGATGAGGC
CTATCGCCTTTCACTTGAGGCTGACAGAGCAAAGAGGGAAGCTCACGAGAGAGAGATGGCAGAACAGTTTCGTTTGGAGCAGATTCGCAA
AGAACAAGAAGAGGAACGTGAGGCCATCCGGCTGTCCTTAGAGCAAGCCCTGCCTCCTGAGCCAAAGGAAGAAAATGCTGAGCCTGTGAG
CAAACTGCGGATCCGGACCCCCAGTGGCGAGTTCTTGGAGCGGCGTTTCCTGGCCAGCAACAAGCTCCAGATTGTCTTTGATTTTGTAGC
TTCCAAAGGATTTCCATGGGATGAGTACAAGTTACTGAGCACCTTTCCTAGGAGAGACGTAACTCAACTGGACCCAAATAAATCATTATT
GGAGGTAAAGTTGTTCCCTCAAGAAACCCTTTTCCTTGAAGCAAAAGAGTAAACACGGCCCAGCGGTGGAACCAGCCATTCCTTGACAAG
CCAGCAGCCTGCGTCAGGAGAAGGGCTCCTCGCCAACCCACCCACACGCTCGTCTCACTCAATTCAATGTCACACTTCTGCCTCTTGCAA
AATTGCTGGAAAAAGTAATAATAAATATAGCTACTTAAGATTTCCCATCCATGAGTATATATTCCCAACCCTTATTACAGAGAATTACAA
CTCTGCCACCCTCCCCTACCCCCTGCACTTCACCCTCCTTCAATGACGAATGCATTGTTCAAGTGTGAGTGATCACTAAATAGAATTTTT
ACCTCTCCAGTGCCCATCTTTTCCCCACAGTGTCTAGGACAGTTCTGTCTGTTCTGTGACACCAGGATGCTGTATATTTGATATATGTCT
TTTTATTTTCATGACTGAATTTCTACTTCATCACCTAATTTTAAGGGGCAGAGGGAAAAAAAGTCAAATGAGACATTGTCGGCATGGAGA
TTAAACATTGTAGGAAAAAAGTATACCATTTTTGTTAGAACTTTCTGATGGCTTTACTAAGATGTCAGGTTTTGTTTGAGGACTGAATTT
GACATATATGCAAGATATTTATTTACTGCTGCTGCCTTGGGTCTCCAGGTTCTACCTAGGAGGTATTTGCTGTTCCATTGCAGCATAGGG
AAACTGTTCAAGCACACAATGTGAATGTTGAGATCATGTGCAGAGAGGCCAGTACCAAAACTTCAGTATCTGGCCCAATGGCAAGAGGCT
ACTGTTAGGTTTGCATTTGGGCAGTTAGAACCTCACAGATACCAGCTCCCAAGTTGCTAGTCCATCAGTGTAAACTGAACACAATTCTCT
CTTGCTTTCTCTCTCTCTACTCCCTCACACATTTGGACCTTGTCACTTGGTGTTTAAGCACCTTGCCTATCAACAAAATCTGATGAGCAG
CCCCATGGACTCTCCTGTAATAAGGAACTTGCTCTACTATTTTATTCTTTTAATGTTTTAGTATTTGATATTGGACTCAAATGAAAGGGA
TCTCATTCTGTGGCTGAAAAATCAGACTTCATATGTTGAAGAGAGCAAACTTGGGGACTCAACTCAGAAGACATGTGTTGCCTGAAACCT
GCATATAATAATTTTTGATTTGATTTAGTAAGTGTGGATTTTTCTTAATCTACAGATTTGGGGTTTGGGGTTTAGATCATGAGAACACCG
TTTATACCTTCACAGCCAATGATTTATTTTTAGTCTTGAAATATTTCTCCATATCTGTTTTTGTGTCACCTGTGGGTTTTATCCTAGGGG
TTGGGATCCTGATTTTAACATTTTGTACTTGTCCAAAAAAGAGTTCAAATGCTGGGTTTGTTCCCCCAGCCTCGGCCAAGGGGTTCTCAG
AAGATTCTAACCAAAGCTGGAGATAGGTCTGCTCATTTTCCTTCTGCCCAGAAGTGGATGTTGGCCAGGAAAATTACACCTTGTGTCTTC
TCTGATGCTCCAACCAGGGACCTCTCCAGATTACTATCTAGCACAGACTAGTGCTACATCTGCCTAGGTATGGGCTTTCTCTGGCAGCAG
GGGTCTCTCTAGGGAGGCTGAGAGACCCATGGGTCTCCCTTCAGGGGAAGTGTTCAGGGGAGTTCAAACTGAACACTTCTCTCCAGCTCT
ATTCCTATCTTCCTAATCTAATGGCTCTACAAGATAGTCATTTCCAGTGCTACAGATGCACCAGGGCACCACCTCTTTTTTTTTCTAGGT
AGACCTTGTTCTGTAGCTGCTGTGAAGAAGCTGCAGCCCTGAACTCAGGTCATACTCAGGAACAGCAGCAGGGGTGTGGGTGGGGTTTGA
GGGAAGGTACTCTGAATTCACCTTCATGTTTAACCTGTTCCATCTGACTTGGGTTTCTTCATTATATTGTTCCCTCCCACTCACCTTCAC

>In-frame_GABRB3_ENST00000299267_chr15_27017548_-_FAF1_ENST00000371778_chr1_51323670_-_2615nt
TTTGGCTGCTCGGAGAGTAGGGGGGAGAGCGGATCCCAGCAGGTTAGGCCGGAGGAACAGCGCCATGTGCTCCGGGCTCCTGGAGCTCCT
GCTGCCCATCTGGCTCTCCTGGACCCTGGGGACCCGAGGCTCTGAGCCCCGCAGTGTGAACGATCCCGGGAACATGTCCTTTGTGAAGGA
GACGGTGGACAAGCTGTTGAAAGGCTACGACATTCGCCTAAGACCCGACTTCGGGGGTCCCCCGGTCTGCGTGGGGATGAACATCGACAT
CGCCAGCATCGACATGGTTTCCGAAGTCAACATGGCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGCTTGAACAAAATAA
TTGGGACTTAGTGGCAGCTATCAATGGTGTAATACCACAGGAAAATGGCATTCTACAAAGTGAATATGGAGGTGAGACCATACCAGGACC
TGCATTTAATCCAGCAAGTCATCCAGCTTCAGCTCCTACTTCCTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCATCCAGGCAGATTGT
AGAAAGGCAACCTCGGATGCTGGACTTCAGGGTTGAATACAGAGACAGAAATGTTGATGTGGTACTTGAAGACACCTGTACTGTTGGAGA
GATTAAACAGATTCTAGAAAATGAACTTCAGATACCTGTGTCCAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATGTGGAAGACAGTAC
GGTCCTAAAATCTCTACACTTGCCAAAAAACAACAGTCTTTATGTCCTTACACCAGATTTGCCACCACCTTCATCATCTAGTCATGCTGG
TGCCCTGCAGGAGTCATTAAATCAAAACTTCATGCTGATCATCACCCACCGAGAAGTCCAGCGGGAGTACAACCTGAACTTCTCAGGAAG
CAGTACTATTCAAGAGGTAAAGAGAAATGTGTATGACCTTACAAGTATCCCCGTTCGCCACCAATTATGGGAGGGCTGGCCAACTTCTGC
TACAGACGACTCAATGTGTCTTGCTGAATCAGGGCTCTCTTATCCCTGCCATCGACTTACAGTGGGAAGAAGATCTTCACCTGCACAGAC
CCGGGAACAGTCGGAAGAACAAATCACCGATGTTCATATGGTTAGTGATAGCGATGGAGATGACTTTGAAGATGCTACAGAATTTGGGGT
GGATGATGGAGAAGTATTTGGCATGGCGTCATCTGCCTTGAGAAAATCTCCAATGATGCCAGAAAACGCAGAAAATGAAGGAGATGCCTT
ATTACAATTTACAGCAGAGTTTTCTTCAAGATATGGTGATTGCCATCCTGTATTTTTTATTGGCTCATTAGAAGCTGCTTTTCAAGAGGC
CTTCTATGTGAAAGCCCGAGATAGAAAGCTTCTTGCTATCTACCTCCACCATGATGAAAGTGTGTTAACCAACGTGTTCTGCTCACAAAT
GCTTTGTGCTGAATCCATTGTTTCTTATCTGAGTCAAAATTTTATAACCTGGGCTTGGGATCTGACAAAGGACTCCAACAGAGCAAGATT
TCTCACTATGTGCAATAGACACTTTGGCAGTGTTGTGGCACAAACCATTCGGACTCAAAAAACGGATCAGTTTCCGCTTTTCCTGATTAT
TATGGGAAAGCGATCATCTAATGAAGTGTTGAATGTGATACAAGGGAACACAACAGTAGATGAGTTAATGATGAGACTCATGGCTGCAAT
GGAGATCTTCACAGCCCAACAACAGGAAGATATAAAGGACGAGGATGAACGTGAAGCCAGAGAAAATGTGAAGAGAGAGCAAGATGAGGC
CTATCGCCTTTCACTTGAGGCTGACAGAGCAAAGAGGGAAGCTCACGAGAGAGAGATGGCAGAACAGTTTCGTTTGGAGCAGATTCGCAA
AGAACAAGAAGAGGAACGTGAGGCCATCCGGCTGTCCTTAGAGCAAGCCCTGCCTCCTGAGCCAAAGGAAGAAAATGCTGAGCCTGTGAG
CAAACTGCGGATCCGGACCCCCAGTGGCGAGTTCTTGGAGCGGCGTTTCCTGGCCAGCAACAAGCTCCAGATTGTCTTTGATTTTGTAGC
TTCCAAAGGATTTCCATGGGATGAGTACAAGTTACTGAGCACCTTTCCTAGGAGAGACGTAACTCAACTGGACCCAAATAAATCATTATT
GGAGGTAAAGTTGTTCCCTCAAGAAACCCTTTTCCTTGAAGCAAAAGAGTAAACACGGCCCAGCGGTGGAACCAGCCATTCCTTGACAAG
CCAGCAGCCTGCGTCAGGAGAAGGGCTCCTCGCCAACCCACCCACACGCTCGTCTCACTCAATTCAATGTCACACTTCTGCCTCTTGCAA
AATTGCTGGAAAAAGTAATAATAAATATAGCTACTTAAGATTTCCCATCCATGAGTATATATTCCCAACCCTTATTACAGAGAATTACAA
CTCTGCCACCCTCCCCTACCCCCTGCACTTCACCCTCCTTCAATGACGAATGCATTGTTCAAGTGTGAGTGATCACTAAATAGAATTTTT
ACCTCTCCAGTGCCCATCTTTTCCCCACAGTGTCTAGGACAGTTCTGTCTGTTCTGTGACACCAGGATGCTGTATATTTGATATATGTCT


Top

FusionGenePPI for GABRB3_FAF1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GABRB3AKAP5, PRKCA, PRKACA, UBQLN1, MEOX2, MCOLN3, GABRB2, GABRA6, ASIC4FAF1ASCC2, FAS, CSNK2B, G3BP1, RAE1, CASP8, CTNNB1, VCP, NPLOC4, UFD1L, CUL1, CUL2, CUL3, UBR1, HIF1A, ALPP, VCPIP1, SKP1, FBXW11, KLHL22, KBTBD7, WDR26, AMFR, UBR2, UBR4, PJA2, CDC73, TAF1D, RAP1B, UROD, TK1, ANXA1, DNAJB11, CDKN1A, TNNT1, SIRT6, HSD17B10, RCC1, NR1H2, ANXA7, TSC22D1, NR4A1, ITGB1BP1, IGF2, RAD23A, BTRC, NGLY1, UBC, HSPA4, RELA, HSPA8, FADD, IKBKB, NLRP3, NLRP2, NLRP7, NLRP12, NUDT21, SKIL, CARM1, CARS, FAM114A1, FARSB, GART, HIRIP3, HIST1H4A, HSPH1, ILK, PLOD2, PPM1G, PPP2R5C, PRMT3, PUF60, RANBP3, RPL24, SAMHD1, SEC23A, SET, SF1, SWAP70, TLN1, TROVE2, UGP2, XPO7, VAPA, VAPB, UBL4A, ASNA1, GET4, BAG6, RPN2, DDOST, FAF1, CD40, MAGIX, TCEAL1, CBX3, DNAJA1, ZC3H15, NTRK1, RAP1A, CDT1, IPO5, WDR24, YTHDF1, CDC5L, KCTD10, YTHDF3, WDR59, MMAB, NUP98, MYCBP2, USP11, NSFL1C, UBXN7, UBXN1, ASPSCR1, HSPA2, MIOS, UBXN6, BTBD9, KCTD13, TNFAIP1, UBXN2B, BHLHA15, CHCHD10, CLEC3A, PRCC, TRIM25, XIAP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GABRB3_FAF1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneGABRB3P28472DB00425ZolpidemGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved
HgeneGABRB3P28472DB00546AdinazolamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved
HgeneGABRB3P28472DB00842OxazepamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved
HgeneGABRB3P28472DB00898EthanolGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved
HgeneGABRB3P28472DB01594CinolazepamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved
HgeneGABRB3P28472DB01595NitrazepamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved
HgeneGABRB3P28472DB00683MidazolamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|illicit
HgeneGABRB3P28472DB01215EstazolamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|illicit
HgeneGABRB3P28472DB01544FlunitrazepamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|illicit
HgeneGABRB3P28472DB01559ClotiazepamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|illicit
HgeneGABRB3P28472DB01567FludiazepamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|illicit
HgeneGABRB3P28472DB01588PrazepamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|illicit
HgeneGABRB3P28472DB01589QuazepamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|illicit
HgeneGABRB3P28472DB00690FlurazepamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|illicit|investigational
HgeneGABRB3P28472DB01558BromazepamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|illicit|investigational
HgeneGABRB3P28472DB00829DiazepamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|illicit|investigational|vet_approved
HgeneGABRB3P28472DB00801HalazepamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|illicit|withdrawn
HgeneGABRB3P28472DB00231TemazepamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|investigational
HgeneGABRB3P28472DB00897TriazolamGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|investigational
HgeneGABRB3P28472DB00602IvermectinGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|investigational|vet_approved
HgeneGABRB3P28472DB00818PropofolGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|investigational|vet_approved
HgeneGABRB3P28472DB00592PiperazineGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|vet_approved
HgeneGABRB3P28472DB00431LindaneGamma-aminobutyric acid receptor subunit beta-3small moleculeapproved|withdrawn

Top

RelatedDiseases for GABRB3_FAF1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGABRB3C0011570Mental Depression5PSYGENET
HgeneGABRB3C0011581Depressive disorder5PSYGENET
HgeneGABRB3C0001973Alcoholic Intoxication, Chronic4PSYGENET
HgeneGABRB3C0004352Autistic Disorder2CTD_human
HgeneGABRB3C0005586Bipolar Disorder2PSYGENET
HgeneGABRB3C0036341Schizophrenia2PSYGENET
HgeneGABRB3C0014544Epilepsy1CTD_human
HgeneGABRB3C0014553Absence Epilepsy1CTD_human
HgeneGABRB3C0021603Sleep Initiation and Maintenance Disorders1CTD_human
HgeneGABRB3C0162635Angelman Syndrome1CTD_human
HgeneGABRB3C0376634Craniofacial Abnormalities1CTD_human
HgeneGABRB3C1510586Autism Spectrum Disorders1CTD_human;HPO
HgeneGABRB3C2677087EPILEPSY, CHILDHOOD ABSENCE, SUSCEPTIBILITY TO, 51UNIPROT
HgeneGABRB3C3711376Isodicentric Chromosome 15 Syndrome1CTD_human