FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1413

FusionGeneSummary for AKT3_ADSS

check button Fusion gene summary
Fusion gene informationFusion gene name: AKT3_ADSS
Fusion gene ID: 1413
HgeneTgene
Gene symbol

AKT3

ADSS

Gene ID

10000

159

Gene nameAKT serine/threonine kinase 3adenylosuccinate synthase
SynonymsMPPH|MPPH2|PKB-GAMMA|PKBG|PRKBG|RAC-PK-gamma|RAC-gamma|STK-2ADEH|ADSS 2
Cytomap

1q43-q44

1q44

Type of geneprotein-codingprotein-coding
DescriptionRAC-gamma serine/threonine-protein kinasePKB gammaRAC-gamma serine/threonine protein kinasev-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)adenylosuccinate synthetase isozyme 2AMPSase 2IMP--aspartate ligase 2L-type adenylosuccinate synthetaseadSS 2adenylosuccinate synthetase (Ade(-)H-complementing)adenylosuccinate synthetase, acidic isozymeadenylosuccinate synthetase, liver isozyme
Modification date2018052320180523
UniProtAcc

Q9Y243

P30520

Ensembl transtripts involved in fusion geneENST00000336199, ENST00000366540, 
ENST00000366539, ENST00000263826, 
ENST00000492957, 
ENST00000366535, 
ENST00000462358, 
Fusion gene scores* DoF score8 X 5 X 5=2003 X 1 X 3=9
# samples 93
** MAII scorelog2(9/200*10)=-1.15200309344505
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/9*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: AKT3 [Title/Abstract] AND ADSS [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneAKT3

GO:0043536

positive regulation of blood vessel endothelial cell migration

28254819

HgeneAKT3

GO:1905564

positive regulation of vascular endothelial cell proliferation

28254819

TgeneADSS

GO:0006167

AMP biosynthetic process

2004783


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-ZG-A9KY-01AAKT3chr1

244006427

-ADSSchr1

244601070

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000336199ENST00000366535AKT3chr1

244006427

-ADSSchr1

244601070

-
5CDS-intronENST00000336199ENST00000462358AKT3chr1

244006427

-ADSSchr1

244601070

-
Frame-shitENST00000366540ENST00000366535AKT3chr1

244006427

-ADSSchr1

244601070

-
5CDS-intronENST00000366540ENST00000462358AKT3chr1

244006427

-ADSSchr1

244601070

-
In-frameENST00000366539ENST00000366535AKT3chr1

244006427

-ADSSchr1

244601070

-
5CDS-intronENST00000366539ENST00000462358AKT3chr1

244006427

-ADSSchr1

244601070

-
In-frameENST00000263826ENST00000366535AKT3chr1

244006427

-ADSSchr1

244601070

-
5CDS-intronENST00000263826ENST00000462358AKT3chr1

244006427

-ADSSchr1

244601070

-
intron-3CDSENST00000492957ENST00000366535AKT3chr1

244006427

-ADSSchr1

244601070

-
intron-intronENST00000492957ENST00000462358AKT3chr1

244006427

-ADSSchr1

244601070

-

Top

FusionProtFeatures for AKT3_ADSS


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AKT3

Q9Y243

ADSS

P30520

AKT3 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, andwhich regulate many processes including metabolism, proliferation,cell survival, growth and angiogenesis. This is mediated throughserine and/or threonine phosphorylation of a range of downstreamsubstrates. Over 100 substrate candidates have been reported sofar, but for most of them, no isoform specificity has beenreported. AKT3 is the least studied AKT isoform. It plays animportant role in brain development and is crucial for theviability of malignant glioma cells. AKT3 isoform may also be thekey molecule in up-regulation and down-regulation of MMP13 viaIL13. Required for the coordination of mitochondrial biogenesiswith growth factor-induced increases in cellular energy demands.Down-regulation by RNA interference reduces the expression of thephosphorylated form of BAD, resulting in the induction of caspase-dependent apoptosis. {ECO:0000269|PubMed:18524868,ECO:0000269|PubMed:21191416}. Plays an important role in the de novo pathway and inthe salvage pathway of purine nucleotide biosynthesis. Catalyzesthe first committed step in the biosynthesis of AMP from IMP.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneADSSchr1:244006427chr1:244601070ENST00000366535-013362_36461457Nucleotide bindingNote=GTP
TgeneADSSchr1:244006427chr1:244601070ENST00000366535-013444_44761457Nucleotide bindingNote=GTP
TgeneADSSchr1:244006427chr1:244601070ENST00000366535-01367_6961457Nucleotide bindingNote=GTP
TgeneADSSchr1:244006427chr1:244601070ENST00000366535-013330_33661457RegionSubstrate binding
TgeneADSSchr1:244006427chr1:244601070ENST00000366535-01365_6861457RegionIMP binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAKT3chr1:244006427chr1:244601070ENST00000263826-113148_40515480DomainProtein kinase
HgeneAKT3chr1:244006427chr1:244601070ENST00000263826-113406_47915480DomainNote=AGC-kinase C-terminal
HgeneAKT3chr1:244006427chr1:244601070ENST00000263826-1135_10715480DomainPH
HgeneAKT3chr1:244006427chr1:244601070ENST00000336199-114148_40515476DomainProtein kinase
HgeneAKT3chr1:244006427chr1:244601070ENST00000336199-114406_47915476DomainNote=AGC-kinase C-terminal
HgeneAKT3chr1:244006427chr1:244601070ENST00000336199-1145_10715476DomainPH
HgeneAKT3chr1:244006427chr1:244601070ENST00000366539-214148_40515480DomainProtein kinase
HgeneAKT3chr1:244006427chr1:244601070ENST00000366539-214406_47915480DomainNote=AGC-kinase C-terminal
HgeneAKT3chr1:244006427chr1:244601070ENST00000366539-2145_10715480DomainPH
HgeneAKT3chr1:244006427chr1:244601070ENST00000366540-214148_40515466DomainProtein kinase
HgeneAKT3chr1:244006427chr1:244601070ENST00000366540-214406_47915466DomainNote=AGC-kinase C-terminal
HgeneAKT3chr1:244006427chr1:244601070ENST00000366540-2145_10715466DomainPH
HgeneAKT3chr1:244006427chr1:244601070ENST00000263826-113154_16215480Nucleotide bindingATP
HgeneAKT3chr1:244006427chr1:244601070ENST00000336199-114154_16215476Nucleotide bindingATP
HgeneAKT3chr1:244006427chr1:244601070ENST00000366539-214154_16215480Nucleotide bindingATP
HgeneAKT3chr1:244006427chr1:244601070ENST00000366540-214154_16215466Nucleotide bindingATP
TgeneADSSchr1:244006427chr1:244601070ENST00000366535-01339_4561457Nucleotide bindingNote=GTP
TgeneADSSchr1:244006427chr1:244601070ENST00000366535-01340_4361457RegionIMP binding


Top

FusionGeneSequence for AKT3_ADSS


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AKT3_ENST00000336199_chr1_244006427_-_ADSS_ENST00000366535_chr1_244601070_-_411aa
MSDVTIVKEGWVQKRGRKXCWPYSCCGFCGIXFSSLTQWNNXSKCHCIHWKWCGNSSTWIVXRSREKCSKRKRTRRLGKKAYYIXQSSYC
IXFSSSSXWYPGTTETRTSRKKFGYNKKGHWPSLFVQSCSEWTQDVRPCFXLXWLLXEVXSSSXPIQIYIPHFGNRHXRXITKTQGLYGK
DXTNGERWSLFSIXGPTWTTKENLGRRCKCSTIRYXFWDLPFCNLFKLYCWRCLYWFGYATSKCWRSVWSCESLYNXSWYWCLSYRARQX
NWRIITNKGXRVWCNYWKEKKMWLVGPRFAQICSYDQWIYCVGTYQVGYFGHVYGNQSWSCLQVRWXNHTSYPSKPRSLKXSXSSIXDSP

>In-frame_AKT3_ENST00000366539_chr1_244006427_-_ADSS_ENST00000366535_chr1_244601070_-_411aa
MSDVTIVKEGWVQKRGRKXCWPYSCCGFCGIXFSSLTQWNNXSKCHCIHWKWCGNSSTWIVXRSREKCSKRKRTRRLGKKAYYIXQSSYC
IXFSSSSXWYPGTTETRTSRKKFGYNKKGHWPSLFVQSCSEWTQDVRPCFXLXWLLXEVXSSSXPIQIYIPHFGNRHXRXITKTQGLYGK
DXTNGERWSLFSIXGPTWTTKENLGRRCKCSTIRYXFWDLPFCNLFKLYCWRCLYWFGYATSKCWRSVWSCESLYNXSWYWCLSYRARQX
NWRIITNKGXRVWCNYWKEKKMWLVGPRFAQICSYDQWIYCVGTYQVGYFGHVYGNQSWSCLQVRWXNHTSYPSKPRSLKXSXSSIXDSP

>In-frame_AKT3_ENST00000263826_chr1_244006427_-_ADSS_ENST00000366535_chr1_244601070_-_411aa
MSDVTIVKEGWVQKRGRKXCWPYSCCGFCGIXFSSLTQWNNXSKCHCIHWKWCGNSSTWIVXRSREKCSKRKRTRRLGKKAYYIXQSSYC
IXFSSSSXWYPGTTETRTSRKKFGYNKKGHWPSLFVQSCSEWTQDVRPCFXLXWLLXEVXSSSXPIQIYIPHFGNRHXRXITKTQGLYGK
DXTNGERWSLFSIXGPTWTTKENLGRRCKCSTIRYXFWDLPFCNLFKLYCWRCLYWFGYATSKCWRSVWSCESLYNXSWYWCLSYRARQX
NWRIITNKGXRVWCNYWKEKKMWLVGPRFAQICSYDQWIYCVGTYQVGYFGHVYGNQSWSCLQVRWXNHTSYPSKPRSLKXSXSSIXDSP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AKT3_ENST00000336199_chr1_244006427_-_ADSS_ENST00000366535_chr1_244601070_-_1234nt
ATGAGCGATGTTACCATTGTGAAAGAAGGTTGGGTTCAGAAGAGGGGGAGGAAATAATGCTGGCCATACAGTTGTTGTGGATTCTGTGGA
ATATGATTTTCATCTCTTACCCAGTGGAATAATTAATCCAAATGTCACTGCATTCATTGGAAATGGTGTGGTAATTCATCTACCTGGATT
GTTTGAAGAAGCAGAGAAAAATGTTCAAAAAGGAAAAGGACTAGAAGGCTGGGAAAAAAGGCTTATTATATCTGACAGAGCTCATATTGT
ATTTGATTTTCATCAAGCAGCTGATGGTATCCAGGAACAACAGAGACAAGAACAAGCAGGAAAAAATTTGGGTACAACAAAAAAGGGCAT
TGGCCCAGTTTATTCGTCCAAAGCTGCTCGGAGTGGACTCAGGATGTGCGACCTTGTTTCTGACTTTGATGGCTTCTCTGAGAGGTTTAA
AGTTCTAGCTAACCAATACAAATCTATATACCCCACTTTGGAAATAGACATTGAAGGTGAATTACAAAAACTCAAGGGTTATATGGAAAA
GATTAAACCAATGGTGAGAGATGGAGTTTATTTTCTATATGAGGCCCTACATGGACCACCAAAGAAAATCTTGGTAGAAGGTGCAAATGC
AGCACTATTAGATATTGATTTTGGGACTTACCCTTTTGTAACCTCTTCAAATTGTACTGTTGGAGGTGTTTGTACTGGTTTGGGTATGCC
ACCTCAAAATGTTGGAGAAGTGTATGGAGTTGTGAAAGCTTATACAACTAGAGTTGGTATTGGTGCCTTTCCTACAGAGCAAGACAATGA
AATTGGAGAATTATTACAAACAAGGGGTAGAGAGTTTGGTGTAACTACTGGAAGGAAAAGAAGATGTGGCTGGTTGGACCTCGTTTTGCT
CAAATATGCTCATATGATCAATGGATTTACTGCGTTGGCACTTACCAAGTTGGATATTTTGGACATGTTTACGGAAATCAAAGTTGGAGT
TGCTTACAAGTTAGATGGTGAAATCATACCTCATATCCCAGCAAACCAAGAAGTCTTAAATAAAGTTGAAGTTCAATATAAGACTCTCCC
AGGATGGAACACAGACATATCAAATGCAAGGGCGTTTAAAGAACTACCTGTTAATGCACAAAACTATGTTCGATTTATTGAAGATGAGCT

>In-frame_AKT3_ENST00000366539_chr1_244006427_-_ADSS_ENST00000366535_chr1_244601070_-_1234nt
ATGAGCGATGTTACCATTGTGAAAGAAGGTTGGGTTCAGAAGAGGGGGAGGAAATAATGCTGGCCATACAGTTGTTGTGGATTCTGTGGA
ATATGATTTTCATCTCTTACCCAGTGGAATAATTAATCCAAATGTCACTGCATTCATTGGAAATGGTGTGGTAATTCATCTACCTGGATT
GTTTGAAGAAGCAGAGAAAAATGTTCAAAAAGGAAAAGGACTAGAAGGCTGGGAAAAAAGGCTTATTATATCTGACAGAGCTCATATTGT
ATTTGATTTTCATCAAGCAGCTGATGGTATCCAGGAACAACAGAGACAAGAACAAGCAGGAAAAAATTTGGGTACAACAAAAAAGGGCAT
TGGCCCAGTTTATTCGTCCAAAGCTGCTCGGAGTGGACTCAGGATGTGCGACCTTGTTTCTGACTTTGATGGCTTCTCTGAGAGGTTTAA
AGTTCTAGCTAACCAATACAAATCTATATACCCCACTTTGGAAATAGACATTGAAGGTGAATTACAAAAACTCAAGGGTTATATGGAAAA
GATTAAACCAATGGTGAGAGATGGAGTTTATTTTCTATATGAGGCCCTACATGGACCACCAAAGAAAATCTTGGTAGAAGGTGCAAATGC
AGCACTATTAGATATTGATTTTGGGACTTACCCTTTTGTAACCTCTTCAAATTGTACTGTTGGAGGTGTTTGTACTGGTTTGGGTATGCC
ACCTCAAAATGTTGGAGAAGTGTATGGAGTTGTGAAAGCTTATACAACTAGAGTTGGTATTGGTGCCTTTCCTACAGAGCAAGACAATGA
AATTGGAGAATTATTACAAACAAGGGGTAGAGAGTTTGGTGTAACTACTGGAAGGAAAAGAAGATGTGGCTGGTTGGACCTCGTTTTGCT
CAAATATGCTCATATGATCAATGGATTTACTGCGTTGGCACTTACCAAGTTGGATATTTTGGACATGTTTACGGAAATCAAAGTTGGAGT
TGCTTACAAGTTAGATGGTGAAATCATACCTCATATCCCAGCAAACCAAGAAGTCTTAAATAAAGTTGAAGTTCAATATAAGACTCTCCC
AGGATGGAACACAGACATATCAAATGCAAGGGCGTTTAAAGAACTACCTGTTAATGCACAAAACTATGTTCGATTTATTGAAGATGAGCT

>In-frame_AKT3_ENST00000263826_chr1_244006427_-_ADSS_ENST00000366535_chr1_244601070_-_1234nt
ATGAGCGATGTTACCATTGTGAAAGAAGGTTGGGTTCAGAAGAGGGGGAGGAAATAATGCTGGCCATACAGTTGTTGTGGATTCTGTGGA
ATATGATTTTCATCTCTTACCCAGTGGAATAATTAATCCAAATGTCACTGCATTCATTGGAAATGGTGTGGTAATTCATCTACCTGGATT
GTTTGAAGAAGCAGAGAAAAATGTTCAAAAAGGAAAAGGACTAGAAGGCTGGGAAAAAAGGCTTATTATATCTGACAGAGCTCATATTGT
ATTTGATTTTCATCAAGCAGCTGATGGTATCCAGGAACAACAGAGACAAGAACAAGCAGGAAAAAATTTGGGTACAACAAAAAAGGGCAT
TGGCCCAGTTTATTCGTCCAAAGCTGCTCGGAGTGGACTCAGGATGTGCGACCTTGTTTCTGACTTTGATGGCTTCTCTGAGAGGTTTAA
AGTTCTAGCTAACCAATACAAATCTATATACCCCACTTTGGAAATAGACATTGAAGGTGAATTACAAAAACTCAAGGGTTATATGGAAAA
GATTAAACCAATGGTGAGAGATGGAGTTTATTTTCTATATGAGGCCCTACATGGACCACCAAAGAAAATCTTGGTAGAAGGTGCAAATGC
AGCACTATTAGATATTGATTTTGGGACTTACCCTTTTGTAACCTCTTCAAATTGTACTGTTGGAGGTGTTTGTACTGGTTTGGGTATGCC
ACCTCAAAATGTTGGAGAAGTGTATGGAGTTGTGAAAGCTTATACAACTAGAGTTGGTATTGGTGCCTTTCCTACAGAGCAAGACAATGA
AATTGGAGAATTATTACAAACAAGGGGTAGAGAGTTTGGTGTAACTACTGGAAGGAAAAGAAGATGTGGCTGGTTGGACCTCGTTTTGCT
CAAATATGCTCATATGATCAATGGATTTACTGCGTTGGCACTTACCAAGTTGGATATTTTGGACATGTTTACGGAAATCAAAGTTGGAGT
TGCTTACAAGTTAGATGGTGAAATCATACCTCATATCCCAGCAAACCAAGAAGTCTTAAATAAAGTTGAAGTTCAATATAAGACTCTCCC
AGGATGGAACACAGACATATCAAATGCAAGGGCGTTTAAAGAACTACCTGTTAATGCACAAAACTATGTTCGATTTATTGAAGATGAGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_AKT3_ENST00000336199_chr1_244006427_-_ADSS_ENST00000366535_chr1_244601070_-_2392nt
CCAAACCCTAAAGCTGATATCACAAAGTACCATTTCTCCAAGTTGGGGGCTCAGAGGGGAGTCATCATGAGCGATGTTACCATTGTGAAA
GAAGGTTGGGTTCAGAAGAGGGGGAGGAAATAATGCTGGCCATACAGTTGTTGTGGATTCTGTGGAATATGATTTTCATCTCTTACCCAG
TGGAATAATTAATCCAAATGTCACTGCATTCATTGGAAATGGTGTGGTAATTCATCTACCTGGATTGTTTGAAGAAGCAGAGAAAAATGT
TCAAAAAGGAAAAGGACTAGAAGGCTGGGAAAAAAGGCTTATTATATCTGACAGAGCTCATATTGTATTTGATTTTCATCAAGCAGCTGA
TGGTATCCAGGAACAACAGAGACAAGAACAAGCAGGAAAAAATTTGGGTACAACAAAAAAGGGCATTGGCCCAGTTTATTCGTCCAAAGC
TGCTCGGAGTGGACTCAGGATGTGCGACCTTGTTTCTGACTTTGATGGCTTCTCTGAGAGGTTTAAAGTTCTAGCTAACCAATACAAATC
TATATACCCCACTTTGGAAATAGACATTGAAGGTGAATTACAAAAACTCAAGGGTTATATGGAAAAGATTAAACCAATGGTGAGAGATGG
AGTTTATTTTCTATATGAGGCCCTACATGGACCACCAAAGAAAATCTTGGTAGAAGGTGCAAATGCAGCACTATTAGATATTGATTTTGG
GACTTACCCTTTTGTAACCTCTTCAAATTGTACTGTTGGAGGTGTTTGTACTGGTTTGGGTATGCCACCTCAAAATGTTGGAGAAGTGTA
TGGAGTTGTGAAAGCTTATACAACTAGAGTTGGTATTGGTGCCTTTCCTACAGAGCAAGACAATGAAATTGGAGAATTATTACAAACAAG
GGGTAGAGAGTTTGGTGTAACTACTGGAAGGAAAAGAAGATGTGGCTGGTTGGACCTCGTTTTGCTCAAATATGCTCATATGATCAATGG
ATTTACTGCGTTGGCACTTACCAAGTTGGATATTTTGGACATGTTTACGGAAATCAAAGTTGGAGTTGCTTACAAGTTAGATGGTGAAAT
CATACCTCATATCCCAGCAAACCAAGAAGTCTTAAATAAAGTTGAAGTTCAATATAAGACTCTCCCAGGATGGAACACAGACATATCAAA
TGCAAGGGCGTTTAAAGAACTACCTGTTAATGCACAAAACTATGTTCGATTTATTGAAGATGAGCTTCAAATTCCAGTTAAGTGGATTGG
TGTTGGTAAATCCAGAGAATCTATGATTCAACTCTTTTAATGATTGCCAGTAATGCAAGAAACACTCCTTGAGAGGGAGGGGAAAAGACT
TTCTTAAATATTTCATTTATGACCTGCAAATTCAAGAATAAAGACACTGAAGTAAGTTTGAAGCCCTACAGTTGTTTCCAGTCTTTTCAG
ATGGATGCCTACTGTGGAGATTAACTTTGGCATATTCCAGTGTCAGCTTTCTTTAGCTGGAATTGCCAAATCATTTGTTGCTCCTGCTGC
TCTCATGGTGCCACGTTTTTTTTTTCAATGTTTAGTAATAGTATAATCCATGTTGTTTGATATCAAAAGTAGAATTACTTTTAATGTAGT
TTTTCTTCATTATTGTCATTGCGTGTTCTTAAGTTTTACCCCTATTAGATGGTAAGAACAATTAATGCAGTTTTGCACAAATATTTTTAC
ATTCTGATCATTCAGTTCTGTCATTGTAATCTTTGTTGTTAGAAACAAATGATGAAAACATAGGGGTTCTGTAAACTTTTGTAATGCTAT
GAATTCTGTTTAAATTTTGGGCTGTCTATTTTCTGCTGAAACCATGCAAAATTGAGCTTTGGTGGGGCTGGGAGGGGGTTATGTATTCAT
GGGACCTTTAATTTGTACAGAACACAGAACTTATTTCTGTCAGTTATTTAATACATTGAAAATTTAGTGAAATGTTCAAAGAGAATAGAT
GTTTCCCAAAACAACAATCTTTATGTTAAAAATAGTCATTAAAAGATCTGTTGTAATATATGGTGGATATTTTTCTTTAATTTCAAACAT
TACCTCTGAAATGTGTATCTTTTCTTTTTTATCTTACCATTAATTTTAAATCTAGTGGATTGGTTTTCAACATCGTGCCTGCCGATATGC
CTACAGAATCATCTGTAAGTGTCAAAATGAACCCACGTTGTTAGCCATAATTTTGATTATGCCTTTATTTCTCCTTTCTTGAAAAAAAAA
AGGTGTTATTTTGACAATTAGGCATAACATTGTTTTGTAGATTATCTTTTAATGAACTATTTTAAATGTTAAATTAGGTGCCACTTAAAT

>In-frame_AKT3_ENST00000366539_chr1_244006427_-_ADSS_ENST00000366535_chr1_244601070_-_2527nt
CCCTCTCCTCCCCCCGCCCCCCCCCGGCTCCATCCTCCGCCGCCGCCCGAGCAGCTGCGGGGCCGCCACCGCCGCCGCCGCCGTTGCAGG
CTGAGTCATCACTAGAGAGTGGGAAGGGCAGCAGCAGCAGAGAATCCAAACCCTAAAGCTGATATCACAAAGTACCATTTCTCCAAGTTG
GGGGCTCAGAGGGGAGTCATCATGAGCGATGTTACCATTGTGAAAGAAGGTTGGGTTCAGAAGAGGGGGAGGAAATAATGCTGGCCATAC
AGTTGTTGTGGATTCTGTGGAATATGATTTTCATCTCTTACCCAGTGGAATAATTAATCCAAATGTCACTGCATTCATTGGAAATGGTGT
GGTAATTCATCTACCTGGATTGTTTGAAGAAGCAGAGAAAAATGTTCAAAAAGGAAAAGGACTAGAAGGCTGGGAAAAAAGGCTTATTAT
ATCTGACAGAGCTCATATTGTATTTGATTTTCATCAAGCAGCTGATGGTATCCAGGAACAACAGAGACAAGAACAAGCAGGAAAAAATTT
GGGTACAACAAAAAAGGGCATTGGCCCAGTTTATTCGTCCAAAGCTGCTCGGAGTGGACTCAGGATGTGCGACCTTGTTTCTGACTTTGA
TGGCTTCTCTGAGAGGTTTAAAGTTCTAGCTAACCAATACAAATCTATATACCCCACTTTGGAAATAGACATTGAAGGTGAATTACAAAA
ACTCAAGGGTTATATGGAAAAGATTAAACCAATGGTGAGAGATGGAGTTTATTTTCTATATGAGGCCCTACATGGACCACCAAAGAAAAT
CTTGGTAGAAGGTGCAAATGCAGCACTATTAGATATTGATTTTGGGACTTACCCTTTTGTAACCTCTTCAAATTGTACTGTTGGAGGTGT
TTGTACTGGTTTGGGTATGCCACCTCAAAATGTTGGAGAAGTGTATGGAGTTGTGAAAGCTTATACAACTAGAGTTGGTATTGGTGCCTT
TCCTACAGAGCAAGACAATGAAATTGGAGAATTATTACAAACAAGGGGTAGAGAGTTTGGTGTAACTACTGGAAGGAAAAGAAGATGTGG
CTGGTTGGACCTCGTTTTGCTCAAATATGCTCATATGATCAATGGATTTACTGCGTTGGCACTTACCAAGTTGGATATTTTGGACATGTT
TACGGAAATCAAAGTTGGAGTTGCTTACAAGTTAGATGGTGAAATCATACCTCATATCCCAGCAAACCAAGAAGTCTTAAATAAAGTTGA
AGTTCAATATAAGACTCTCCCAGGATGGAACACAGACATATCAAATGCAAGGGCGTTTAAAGAACTACCTGTTAATGCACAAAACTATGT
TCGATTTATTGAAGATGAGCTTCAAATTCCAGTTAAGTGGATTGGTGTTGGTAAATCCAGAGAATCTATGATTCAACTCTTTTAATGATT
GCCAGTAATGCAAGAAACACTCCTTGAGAGGGAGGGGAAAAGACTTTCTTAAATATTTCATTTATGACCTGCAAATTCAAGAATAAAGAC
ACTGAAGTAAGTTTGAAGCCCTACAGTTGTTTCCAGTCTTTTCAGATGGATGCCTACTGTGGAGATTAACTTTGGCATATTCCAGTGTCA
GCTTTCTTTAGCTGGAATTGCCAAATCATTTGTTGCTCCTGCTGCTCTCATGGTGCCACGTTTTTTTTTTCAATGTTTAGTAATAGTATA
ATCCATGTTGTTTGATATCAAAAGTAGAATTACTTTTAATGTAGTTTTTCTTCATTATTGTCATTGCGTGTTCTTAAGTTTTACCCCTAT
TAGATGGTAAGAACAATTAATGCAGTTTTGCACAAATATTTTTACATTCTGATCATTCAGTTCTGTCATTGTAATCTTTGTTGTTAGAAA
CAAATGATGAAAACATAGGGGTTCTGTAAACTTTTGTAATGCTATGAATTCTGTTTAAATTTTGGGCTGTCTATTTTCTGCTGAAACCAT
GCAAAATTGAGCTTTGGTGGGGCTGGGAGGGGGTTATGTATTCATGGGACCTTTAATTTGTACAGAACACAGAACTTATTTCTGTCAGTT
ATTTAATACATTGAAAATTTAGTGAAATGTTCAAAGAGAATAGATGTTTCCCAAAACAACAATCTTTATGTTAAAAATAGTCATTAAAAG
ATCTGTTGTAATATATGGTGGATATTTTTCTTTAATTTCAAACATTACCTCTGAAATGTGTATCTTTTCTTTTTTATCTTACCATTAATT
TTAAATCTAGTGGATTGGTTTTCAACATCGTGCCTGCCGATATGCCTACAGAATCATCTGTAAGTGTCAAAATGAACCCACGTTGTTAGC
CATAATTTTGATTATGCCTTTATTTCTCCTTTCTTGAAAAAAAAAAGGTGTTATTTTGACAATTAGGCATAACATTGTTTTGTAGATTAT
CTTTTAATGAACTATTTTAAATGTTAAATTAGGTGCCACTTAAATTTATTTTATTACACCATGAATAGCTGATTAAAAGAACCAAATATT

>In-frame_AKT3_ENST00000263826_chr1_244006427_-_ADSS_ENST00000366535_chr1_244601070_-_2407nt
GCAGCAGCAGAGAATCCAAACCCTAAAGCTGATATCACAAAGTACCATTTCTCCAAGTTGGGGGCTCAGAGGGGAGTCATCATGAGCGAT
GTTACCATTGTGAAAGAAGGTTGGGTTCAGAAGAGGGGGAGGAAATAATGCTGGCCATACAGTTGTTGTGGATTCTGTGGAATATGATTT
TCATCTCTTACCCAGTGGAATAATTAATCCAAATGTCACTGCATTCATTGGAAATGGTGTGGTAATTCATCTACCTGGATTGTTTGAAGA
AGCAGAGAAAAATGTTCAAAAAGGAAAAGGACTAGAAGGCTGGGAAAAAAGGCTTATTATATCTGACAGAGCTCATATTGTATTTGATTT
TCATCAAGCAGCTGATGGTATCCAGGAACAACAGAGACAAGAACAAGCAGGAAAAAATTTGGGTACAACAAAAAAGGGCATTGGCCCAGT
TTATTCGTCCAAAGCTGCTCGGAGTGGACTCAGGATGTGCGACCTTGTTTCTGACTTTGATGGCTTCTCTGAGAGGTTTAAAGTTCTAGC
TAACCAATACAAATCTATATACCCCACTTTGGAAATAGACATTGAAGGTGAATTACAAAAACTCAAGGGTTATATGGAAAAGATTAAACC
AATGGTGAGAGATGGAGTTTATTTTCTATATGAGGCCCTACATGGACCACCAAAGAAAATCTTGGTAGAAGGTGCAAATGCAGCACTATT
AGATATTGATTTTGGGACTTACCCTTTTGTAACCTCTTCAAATTGTACTGTTGGAGGTGTTTGTACTGGTTTGGGTATGCCACCTCAAAA
TGTTGGAGAAGTGTATGGAGTTGTGAAAGCTTATACAACTAGAGTTGGTATTGGTGCCTTTCCTACAGAGCAAGACAATGAAATTGGAGA
ATTATTACAAACAAGGGGTAGAGAGTTTGGTGTAACTACTGGAAGGAAAAGAAGATGTGGCTGGTTGGACCTCGTTTTGCTCAAATATGC
TCATATGATCAATGGATTTACTGCGTTGGCACTTACCAAGTTGGATATTTTGGACATGTTTACGGAAATCAAAGTTGGAGTTGCTTACAA
GTTAGATGGTGAAATCATACCTCATATCCCAGCAAACCAAGAAGTCTTAAATAAAGTTGAAGTTCAATATAAGACTCTCCCAGGATGGAA
CACAGACATATCAAATGCAAGGGCGTTTAAAGAACTACCTGTTAATGCACAAAACTATGTTCGATTTATTGAAGATGAGCTTCAAATTCC
AGTTAAGTGGATTGGTGTTGGTAAATCCAGAGAATCTATGATTCAACTCTTTTAATGATTGCCAGTAATGCAAGAAACACTCCTTGAGAG
GGAGGGGAAAAGACTTTCTTAAATATTTCATTTATGACCTGCAAATTCAAGAATAAAGACACTGAAGTAAGTTTGAAGCCCTACAGTTGT
TTCCAGTCTTTTCAGATGGATGCCTACTGTGGAGATTAACTTTGGCATATTCCAGTGTCAGCTTTCTTTAGCTGGAATTGCCAAATCATT
TGTTGCTCCTGCTGCTCTCATGGTGCCACGTTTTTTTTTTCAATGTTTAGTAATAGTATAATCCATGTTGTTTGATATCAAAAGTAGAAT
TACTTTTAATGTAGTTTTTCTTCATTATTGTCATTGCGTGTTCTTAAGTTTTACCCCTATTAGATGGTAAGAACAATTAATGCAGTTTTG
CACAAATATTTTTACATTCTGATCATTCAGTTCTGTCATTGTAATCTTTGTTGTTAGAAACAAATGATGAAAACATAGGGGTTCTGTAAA
CTTTTGTAATGCTATGAATTCTGTTTAAATTTTGGGCTGTCTATTTTCTGCTGAAACCATGCAAAATTGAGCTTTGGTGGGGCTGGGAGG
GGGTTATGTATTCATGGGACCTTTAATTTGTACAGAACACAGAACTTATTTCTGTCAGTTATTTAATACATTGAAAATTTAGTGAAATGT
TCAAAGAGAATAGATGTTTCCCAAAACAACAATCTTTATGTTAAAAATAGTCATTAAAAGATCTGTTGTAATATATGGTGGATATTTTTC
TTTAATTTCAAACATTACCTCTGAAATGTGTATCTTTTCTTTTTTATCTTACCATTAATTTTAAATCTAGTGGATTGGTTTTCAACATCG
TGCCTGCCGATATGCCTACAGAATCATCTGTAAGTGTCAAAATGAACCCACGTTGTTAGCCATAATTTTGATTATGCCTTTATTTCTCCT
TTCTTGAAAAAAAAAAGGTGTTATTTTGACAATTAGGCATAACATTGTTTTGTAGATTATCTTTTAATGAACTATTTTAAATGTTAAATT


Top

FusionGenePPI for AKT3_ADSS


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AKT3TCL1A, PRKCZ, NEDD4, TTC3, NEDD4L, GSK3B, PLEKHO1, EIF4EBP1, RPE, CASP3, AKT1, HSP90AB4P, HSP90AB3P, HSP90AA4P, HSP90AA5P, PIANP, HSP90AB1, FKBP5, HSP90AA1, CDC37, SNX8, TOX2, PRMT6, PPP2CAADSSATG10, CUL3, RNH1, SGTA, SMYD1, ANXA6, CBX3, CHMP4A, CHRAC1, DCK, GSR, IDH1, MAPK14, OXCT1, THOP1, FDPS, HSPE1, KYNU, PDIA3, PTMS, RBBP7, TALDO1, WDR1, AASDHPPT, CTBP1, OAT, AGL, ARFIP1, C6orf211, GART, GNPNAT1, HSD17B10, IMPA2, NME1-NME2, NME2, PCBD1, PFKL, RPE, TANGO2, UMPS, ADSSL1, NPB, LGALS7, TRIM25, YAP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AKT3_ADSS


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for AKT3_ADSS


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneAKT3C4014738MEGALENCEPHALY-POLYMICROGYRIA-POLYDACTYLY-HYDROCEPHALUS SYNDROME 23UNIPROT
HgeneAKT3C1863924Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome1CTD_human
HgeneAKT3C1955869Malformations of Cortical Development1CTD_human
TgeneADSSC0036341Schizophrenia1PSYGENET