FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13983

FusionGeneSummary for FRYL_CORIN

check button Fusion gene summary
Fusion gene informationFusion gene name: FRYL_CORIN
Fusion gene ID: 13983
HgeneTgene
Gene symbol

FRYL

CORIN

Gene ID

285527

10699

Gene nameFRY like transcription coactivatorcorin, serine peptidase
SynonymsAF4p12|KIAA0826|MOR2ATC2|CRN|Lrp4|PEE5|TMPRSS10
Cytomap

4p11

4p12

Type of geneprotein-codingprotein-coding
Descriptionprotein furry homolog-likeALL1-fused gene from chromosome 4p12 proteinFRY-likefurry homolog-likefurry-likemor2 cell polarity protein homologatrial natriuretic peptide-converting enzymeheart-specific serine proteinase ATC2pro-ANP-convertasepro-ANP-converting enzymetransmembrane protease serine 10
Modification date2018052320180506
UniProtAcc

O94915

Q9Y5Q5

Ensembl transtripts involved in fusion geneENST00000503238, ENST00000358350, 
ENST00000537810, ENST00000264319, 
ENST00000507711, ENST00000514783, 
ENST00000507873, ENST00000506685, 
ENST00000273857, ENST00000508498, 
ENST00000502252, ENST00000505909, 
ENST00000504584, ENST00000515827, 
Fusion gene scores* DoF score14 X 11 X 11=16945 X 6 X 5=150
# samples 215
** MAII scorelog2(21/1694*10)=-3.01197264166608
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/150*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FRYL [Title/Abstract] AND CORIN [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCORIN

GO:0016486

peptide hormone processing

10880574


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCOADTCGA-F4-6461-01AFRYLchr4

48572844

-CORINchr4

47628538

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000503238ENST00000273857FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000503238ENST00000508498FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000503238ENST00000502252FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000503238ENST00000505909FRYLchr4

48572844

-CORINchr4

47628538

-
5CDS-intronENST00000503238ENST00000504584FRYLchr4

48572844

-CORINchr4

47628538

-
5CDS-intronENST00000503238ENST00000515827FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000358350ENST00000273857FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000358350ENST00000508498FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000358350ENST00000502252FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000358350ENST00000505909FRYLchr4

48572844

-CORINchr4

47628538

-
5CDS-intronENST00000358350ENST00000504584FRYLchr4

48572844

-CORINchr4

47628538

-
5CDS-intronENST00000358350ENST00000515827FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000537810ENST00000273857FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000537810ENST00000508498FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000537810ENST00000502252FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000537810ENST00000505909FRYLchr4

48572844

-CORINchr4

47628538

-
5CDS-intronENST00000537810ENST00000504584FRYLchr4

48572844

-CORINchr4

47628538

-
5CDS-intronENST00000537810ENST00000515827FRYLchr4

48572844

-CORINchr4

47628538

-
5UTR-3CDSENST00000264319ENST00000273857FRYLchr4

48572844

-CORINchr4

47628538

-
5UTR-3CDSENST00000264319ENST00000508498FRYLchr4

48572844

-CORINchr4

47628538

-
5UTR-3CDSENST00000264319ENST00000502252FRYLchr4

48572844

-CORINchr4

47628538

-
5UTR-3CDSENST00000264319ENST00000505909FRYLchr4

48572844

-CORINchr4

47628538

-
5UTR-intronENST00000264319ENST00000504584FRYLchr4

48572844

-CORINchr4

47628538

-
5UTR-intronENST00000264319ENST00000515827FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000507711ENST00000273857FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000507711ENST00000508498FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000507711ENST00000502252FRYLchr4

48572844

-CORINchr4

47628538

-
In-frameENST00000507711ENST00000505909FRYLchr4

48572844

-CORINchr4

47628538

-
5CDS-intronENST00000507711ENST00000504584FRYLchr4

48572844

-CORINchr4

47628538

-
5CDS-intronENST00000507711ENST00000515827FRYLchr4

48572844

-CORINchr4

47628538

-
intron-3CDSENST00000514783ENST00000273857FRYLchr4

48572844

-CORINchr4

47628538

-
intron-3CDSENST00000514783ENST00000508498FRYLchr4

48572844

-CORINchr4

47628538

-
intron-3CDSENST00000514783ENST00000502252FRYLchr4

48572844

-CORINchr4

47628538

-
intron-3CDSENST00000514783ENST00000505909FRYLchr4

48572844

-CORINchr4

47628538

-
intron-intronENST00000514783ENST00000504584FRYLchr4

48572844

-CORINchr4

47628538

-
intron-intronENST00000514783ENST00000515827FRYLchr4

48572844

-CORINchr4

47628538

-
intron-3CDSENST00000507873ENST00000273857FRYLchr4

48572844

-CORINchr4

47628538

-
intron-3CDSENST00000507873ENST00000508498FRYLchr4

48572844

-CORINchr4

47628538

-
intron-3CDSENST00000507873ENST00000502252FRYLchr4

48572844

-CORINchr4

47628538

-
intron-3CDSENST00000507873ENST00000505909FRYLchr4

48572844

-CORINchr4

47628538

-
intron-intronENST00000507873ENST00000504584FRYLchr4

48572844

-CORINchr4

47628538

-
intron-intronENST00000507873ENST00000515827FRYLchr4

48572844

-CORINchr4

47628538

-
intron-3CDSENST00000506685ENST00000273857FRYLchr4

48572844

-CORINchr4

47628538

-
intron-3CDSENST00000506685ENST00000508498FRYLchr4

48572844

-CORINchr4

47628538

-
intron-3CDSENST00000506685ENST00000502252FRYLchr4

48572844

-CORINchr4

47628538

-
intron-3CDSENST00000506685ENST00000505909FRYLchr4

48572844

-CORINchr4

47628538

-
intron-intronENST00000506685ENST00000504584FRYLchr4

48572844

-CORINchr4

47628538

-
intron-intronENST00000506685ENST00000515827FRYLchr4

48572844

-CORINchr4

47628538

-

Top

FusionProtFeatures for FRYL_CORIN


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FRYL

O94915

CORIN

Q9Y5Q5

Plays a key role in maintaining the integrity ofpolarized cell extensions during morphogenesis, regulates theactin cytoskeleton and plays a key role in patterning sensoryneuron dendritic fields by promoting avoidance between homologousdendrites as well as by limiting dendritic branching (Bysimilarity). May function as a transcriptional activator.{ECO:0000250, ECO:0000269|PubMed:16061630}. Serine-type endopeptidase involved in atrial natriureticpeptide hormone (NPPA) processing. Converts through proteolyticcleavage the non-functional propeptide NPPA into the activehormone, thereby regulating blood pressure in heart and promotingnatriuresis, diuresis and vasodilation. Proteolytic cleavage ofpro-NPPA also plays a role in female pregnancy by promotingtrophoblast invasion and spiral artery remodeling in uterus. Alsoacts as a regulator of sodium reabsorption in kidney. May alsoprocess pro-NPPB the B-type natriuretic peptide. Isoform 2: has weaker endopeptidase activity compared toisoform 1.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-1522802_10357321043DomainPeptidase S1

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-1522134_2597321043DomainFZ 1
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-1522268_3047321043DomainLDL-receptor class A 1
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-1522305_3407321043DomainLDL-receptor class A 2
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-1522341_3777321043DomainLDL-receptor class A 3
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-1522378_4157321043DomainLDL-receptor class A 4
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-1522450_5737321043DomainFZ 2
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-1522579_6147321043DomainLDL-receptor class A 5
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-1522615_6537321043DomainLDL-receptor class A 6
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-1522654_6897321043DomainLDL-receptor class A 7
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-1522690_8017321043DomainNote=SRCR
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-152226_297321043MotifNote=DDNN motif
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-15221_457321043Topological domainCytoplasmic
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-152267_10427321043Topological domainExtracellular
TgeneCORINchr4:48572844chr4:47628538ENST00000273857-152246_667321043TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for FRYL_CORIN


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FRYL_ENST00000503238_chr4_48572844_-_CORIN_ENST00000273857_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000503238_chr4_48572844_-_CORIN_ENST00000508498_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000503238_chr4_48572844_-_CORIN_ENST00000502252_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000503238_chr4_48572844_-_CORIN_ENST00000505909_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000358350_chr4_48572844_-_CORIN_ENST00000273857_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000358350_chr4_48572844_-_CORIN_ENST00000508498_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000358350_chr4_48572844_-_CORIN_ENST00000502252_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000358350_chr4_48572844_-_CORIN_ENST00000505909_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000537810_chr4_48572844_-_CORIN_ENST00000273857_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000537810_chr4_48572844_-_CORIN_ENST00000508498_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000537810_chr4_48572844_-_CORIN_ENST00000502252_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000537810_chr4_48572844_-_CORIN_ENST00000505909_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000507711_chr4_48572844_-_CORIN_ENST00000273857_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000507711_chr4_48572844_-_CORIN_ENST00000508498_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000507711_chr4_48572844_-_CORIN_ENST00000502252_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP

>In-frame_FRYL_ENST00000507711_chr4_48572844_-_CORIN_ENST00000505909_chr4_47628538_-_1309aa
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQNGTED
ESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFV
EILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIG
LRVFLVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVH
PTLLDNAVKMLVQLINQWKQAAQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQFDVISPSHIWIFAHVTQGQDPWIISLSSFLK
QENLPKHCSTAVSYAWMFAYTRLQLLSPQVDINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELL
ADAGVISHREPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWP
WQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISE
TGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FRYL_ENST00000503238_chr4_48572844_-_CORIN_ENST00000273857_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000503238_chr4_48572844_-_CORIN_ENST00000508498_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000503238_chr4_48572844_-_CORIN_ENST00000502252_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000503238_chr4_48572844_-_CORIN_ENST00000505909_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000358350_chr4_48572844_-_CORIN_ENST00000273857_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000358350_chr4_48572844_-_CORIN_ENST00000508498_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000358350_chr4_48572844_-_CORIN_ENST00000502252_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000358350_chr4_48572844_-_CORIN_ENST00000505909_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000537810_chr4_48572844_-_CORIN_ENST00000273857_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000537810_chr4_48572844_-_CORIN_ENST00000508498_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000537810_chr4_48572844_-_CORIN_ENST00000502252_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000537810_chr4_48572844_-_CORIN_ENST00000505909_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000507711_chr4_48572844_-_CORIN_ENST00000273857_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000507711_chr4_48572844_-_CORIN_ENST00000508498_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000507711_chr4_48572844_-_CORIN_ENST00000502252_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000507711_chr4_48572844_-_CORIN_ENST00000505909_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_FRYL_ENST00000503238_chr4_48572844_-_CORIN_ENST00000273857_chr4_47628538_-_5650nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA
TATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTAC
ACTAAAAGAAAATGGCCTTCTTGACTGTGAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTG
CACTGCAAATTTGCATGTTTGTTTTGGACTAATTTTTTTCAATTTATTTTTTCACCTTCATTTTTCTCTTATTTCAAGTTCAATGAAAGA
CTTTACAAAAGCAAACAAAGCAGACTTTGTCCTTTTGCCAGGCCTAACCATGACTGCAGCACAAAATTATCGACTCTGGCGAGATTTAAA
ATCAGGTGCTACAGTAACAGGTTATGGAATGGTCTCTTTTATCCTATCACAAAAAAAGACATAGATATTTAGGCTGATTAATTATCTCTA
CCAGTTTTTGTTTCTCAAGCTCAGTGCATAGTGGTAAATTTCAGTGTTAACATTGGAGACTTGCTTTTCTTTTTCTTTTTTTATACCCCA
CAATTCTTTTTTATTACACTTCGAATTTTAGGGTACACGAGCACAACGTGCAGGTTAGTTACATATGTATACATGTGCCATGTTGGTGTG
CTGAACCCAGTAACTCGTCATTTGATTTATTAAAAGCCAAGATAATTTACATGTTTAAAGTATTTACTATTACCCCCTTCTAATGTTTGC
ATAATTCTGAGAACTGATAAAAGACAGCAATAAAAGACCAGTGTCATCCATTTAGGTAGCAAGACATATTGAATGCAAAGTTCTTTAGAT
ATCAATATTAACACTTGACATTATTGGACCCCCCATTCTGGATGTATATCAAGATCATAATTTTATAGAAGAGTCTCTATAGAACTGTCC
TCATAGCTGGGTTTGTTCAGGATATATGAGTTGGCTGATTGAGACTGCAACAACTACATCTATATTTATGGGCAATATTTTGTTTTACTT
ATGTGGCAAAGAACTGGATATTAAACTTTGCAAAAGAGAATTTAGATGAGAGATGCAATTTTTTAAAAAGAAAATTAATTTGCATCCCTC
GTTTAATTAAATTTATTTTTCAGTTTTCTTGCGTTCATCCATACCAACAAAGTCATAAAGAGCATATTTTAGAGCACAGTAAGACTTTGC
ATGGAGTAAAACATTTTGTAATTTTCCTCAAAAGATGTTTAATATCTGGTTTCTTCTCATTGGTAATTAAAATTTTAGAAATGATTTTTA
GCTCTAGGCCACTTTACGCAACTCAATTTCTGAAGCAATTAGTGGTAAAAAGTATTTTTCCCCACTAAAAAACTTTAAAACACAAATCTT
CATATATACTTAATTTAATTAGTCAGGCATCCATTTTGCCTTTTAAACAACTAGGATTCCCTACTAACCTCCACCAGCAACCTGGACTGC
CTCAGCATTCCAAATAGATACTACCTGCAATTTTATACATGTATTTTTGTATCTTTTCTGTGTGTAAACATAGTTGAAATTCAAAAAGTT
GTAGCAATTTCTATACTATTCATCTCCTGTCCTTCAGTTTGTATAAACCTAAGGAGAGTGTGAAATCCAGCAACTGAATTGTGGTCACGA
TTGTATGAAAGTTCAAGAACATATGTCAGTTTTGTTACAGTTGTAGCTACATACTCAATGTATCAACTTTTAGCCTGCTCAACTTAGGCT

>In-frame_FRYL_ENST00000503238_chr4_48572844_-_CORIN_ENST00000508498_chr4_47628538_-_4166nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA
TATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTAC
ACTAAAAGAAAATGGCCTTCTTGACTGTGAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTG
CACTGCAAATTTGCATGTTTGTTTTGGACTAATTTTTTTCAATTTATTTTTTCACCTTCATTTTTCTCTTATTTCAAGTTCAATGAAAGA

>In-frame_FRYL_ENST00000503238_chr4_48572844_-_CORIN_ENST00000502252_chr4_47628538_-_3988nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA
TATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTAC

>In-frame_FRYL_ENST00000503238_chr4_48572844_-_CORIN_ENST00000505909_chr4_47628538_-_3927nt
ATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAG
AAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATA
AGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGAT
GAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGAC
TTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAA
GTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATAT
GCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAA
CAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAA
GCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTG
GAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACT
TTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTA
AATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTAT
AGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTT
CCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGAT
TTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGT
CTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGA
AATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAA
GTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAG
GAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGAC
GGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTG
CAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCAT
CCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGAC
ACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTT
GCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTG
GAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGG
GCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTT
GATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAG
CAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTC
GATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTT
TGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGC
GGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATG
GAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAA
GAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTG
GCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACAC
TCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTG
TGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCA
TGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGC
TTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTT
GTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAG
ACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATG
GGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATC
ACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCT
GGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCA

>In-frame_FRYL_ENST00000358350_chr4_48572844_-_CORIN_ENST00000273857_chr4_47628538_-_6255nt
GAAGACCTCGCAGCACAGCCGGGCGCCCGTCGGGCTCTGGGAGAGAGCGAGAGAGAAATCCGGTTAAAATCAGAGTCGGAGGGAGGTTTA
ACCACAGATCGGTTCCGATCGGATTATTCCTTAAAGGGGACGCGCCATTGTCAAGAGAACGGAGCCAGGGGCCCGAGGGCGGGGACCGGC
GGCGCTGGAGGAGCGAGGCAGCTGTACTAGGACTGGGAACGGCCTAGAACATTCCATATTCTGCTTCACACACGGTGACTCACTCACTAC
TGCTTTGTACCAGTGTGCCCACTCGAGTGCCTGTAAAGTACAAGCTCCAGATCAAAAAAGCTTCTAGATGGATCCTTTCCAAACTTGGTG
TCTTTTCTACAAACTCTGTGCCTCAACAACCATTTCTAAGTGAGCTGAAGCCATTTATTGGTATCTTGGATGGTTAACATCTAAATGCTT
AATTCCTGAAACCACTCAAGAGTCATAGGATTAGATGATCCAAGTCACCAAGAAATTACTGTCTCAAGTGATACGCTTCAGCGCCAGTCA
GCAAAGTAAATAAATACTGTGCTTCTTCCAACTTTCATTCCACTTGGGGAAAAAAAAATATCATCATGTCAAACATTACGATTGACCCAG
ATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAGAAAATTGAAGTTGTAATGGCCGAAC
CCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATAAGCTCTATGAGCTCAGTAGCAGAGC
ACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGATGAATCTTATGAATATAGGCCTCGGT
CTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGACTTAGCAGTAGACTTCATTTTTTGTT
TAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAAGTTCTAAACTTAGCTTTTAAGCACT
TTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATATGCAGAGGTGATAGGGGTTCTTGCCC
AATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAACAAAGCCCACATGTGGTACAAAGTG
TCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAAGCATCATTTCAATTTATGCAGGAAT
GTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTGGAGATTCTTATCCCTGTAGCTGCTG
CTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACTTTTGAACTGAGCTCGAGAAAGAAGC
ATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTAAATAACTGGCATATTTTCCTACAGA
ACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTATAGATTATTGTGGGTTTATGTAATTA
GAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTTCCAAAAGGCTCACGAAGTGTGGTTC
CTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGATTTTGCAATGAAAGAAATAATATTTG
ATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGTCTCAGAGTCTTCCTTGTAATAGCAG
ACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGAAATACTCTTCGTGTAAAGAAAATAT
TTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAAGTAAGAAAAGCATTAGATAGCATCC
TCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAGGAGCCTGAAGACATGATTACGGGGG
AAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGACGGTATGAGCAGAACTGACCTGATTG
AATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTGCAGGCACTAATGCTTGATTTTCCAG
ATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCATCCCACACTTCTTGATAATGCCGTAA
AGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGACACTCAGCATGGTGTAGCTAATGGAG
CTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTTGCGCTTGTCATTCTCTGTAGCAGTC
GACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTGGAAATACCTAAGGGTGATGATGAAT
TAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGGGCTGATCAGACTACTTTGCTCTATT
GCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTTGATGTGATTAGTCCATCACATATAT
GGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAGCAAGAAAATCTTCCTAAACACTGCT
CTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTCGATATAAATAGCCCCATCAATGCTA
AGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTTTGCTGCAGTGCAGCAACATCGTCAT
CTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGCGGCTATAGCATTGATTCTAAAATTA
TTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATGGAAATCACAGAATCCCTTGTTCTAG
GTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAAGAAGCACTCGAAAGAAGGCCAGAGA
ATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTGGCAGATGCTGGTGTCATTAGTCACA
GAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGA
CCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCC
GCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAAC
CCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAG
TTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCC
GCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCT
TGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGC
AAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCT
ATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGAT
TAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGAC
AGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGAC
TGTGAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTGCACTGCAAATTTGCATGTTTGTTTT
GGACTAATTTTTTTCAATTTATTTTTTCACCTTCATTTTTCTCTTATTTCAAGTTCAATGAAAGACTTTACAAAAGCAAACAAAGCAGAC
TTTGTCCTTTTGCCAGGCCTAACCATGACTGCAGCACAAAATTATCGACTCTGGCGAGATTTAAAATCAGGTGCTACAGTAACAGGTTAT
GGAATGGTCTCTTTTATCCTATCACAAAAAAAGACATAGATATTTAGGCTGATTAATTATCTCTACCAGTTTTTGTTTCTCAAGCTCAGT
GCATAGTGGTAAATTTCAGTGTTAACATTGGAGACTTGCTTTTCTTTTTCTTTTTTTATACCCCACAATTCTTTTTTATTACACTTCGAA
TTTTAGGGTACACGAGCACAACGTGCAGGTTAGTTACATATGTATACATGTGCCATGTTGGTGTGCTGAACCCAGTAACTCGTCATTTGA
TTTATTAAAAGCCAAGATAATTTACATGTTTAAAGTATTTACTATTACCCCCTTCTAATGTTTGCATAATTCTGAGAACTGATAAAAGAC
AGCAATAAAAGACCAGTGTCATCCATTTAGGTAGCAAGACATATTGAATGCAAAGTTCTTTAGATATCAATATTAACACTTGACATTATT
GGACCCCCCATTCTGGATGTATATCAAGATCATAATTTTATAGAAGAGTCTCTATAGAACTGTCCTCATAGCTGGGTTTGTTCAGGATAT
ATGAGTTGGCTGATTGAGACTGCAACAACTACATCTATATTTATGGGCAATATTTTGTTTTACTTATGTGGCAAAGAACTGGATATTAAA
CTTTGCAAAAGAGAATTTAGATGAGAGATGCAATTTTTTAAAAAGAAAATTAATTTGCATCCCTCGTTTAATTAAATTTATTTTTCAGTT
TTCTTGCGTTCATCCATACCAACAAAGTCATAAAGAGCATATTTTAGAGCACAGTAAGACTTTGCATGGAGTAAAACATTTTGTAATTTT
CCTCAAAAGATGTTTAATATCTGGTTTCTTCTCATTGGTAATTAAAATTTTAGAAATGATTTTTAGCTCTAGGCCACTTTACGCAACTCA
ATTTCTGAAGCAATTAGTGGTAAAAAGTATTTTTCCCCACTAAAAAACTTTAAAACACAAATCTTCATATATACTTAATTTAATTAGTCA
GGCATCCATTTTGCCTTTTAAACAACTAGGATTCCCTACTAACCTCCACCAGCAACCTGGACTGCCTCAGCATTCCAAATAGATACTACC
TGCAATTTTATACATGTATTTTTGTATCTTTTCTGTGTGTAAACATAGTTGAAATTCAAAAAGTTGTAGCAATTTCTATACTATTCATCT
CCTGTCCTTCAGTTTGTATAAACCTAAGGAGAGTGTGAAATCCAGCAACTGAATTGTGGTCACGATTGTATGAAAGTTCAAGAACATATG
TCAGTTTTGTTACAGTTGTAGCTACATACTCAATGTATCAACTTTTAGCCTGCTCAACTTAGGCTCAGTGAAATATATATATTATACTTA

>In-frame_FRYL_ENST00000358350_chr4_48572844_-_CORIN_ENST00000508498_chr4_47628538_-_4771nt
GAAGACCTCGCAGCACAGCCGGGCGCCCGTCGGGCTCTGGGAGAGAGCGAGAGAGAAATCCGGTTAAAATCAGAGTCGGAGGGAGGTTTA
ACCACAGATCGGTTCCGATCGGATTATTCCTTAAAGGGGACGCGCCATTGTCAAGAGAACGGAGCCAGGGGCCCGAGGGCGGGGACCGGC
GGCGCTGGAGGAGCGAGGCAGCTGTACTAGGACTGGGAACGGCCTAGAACATTCCATATTCTGCTTCACACACGGTGACTCACTCACTAC
TGCTTTGTACCAGTGTGCCCACTCGAGTGCCTGTAAAGTACAAGCTCCAGATCAAAAAAGCTTCTAGATGGATCCTTTCCAAACTTGGTG
TCTTTTCTACAAACTCTGTGCCTCAACAACCATTTCTAAGTGAGCTGAAGCCATTTATTGGTATCTTGGATGGTTAACATCTAAATGCTT
AATTCCTGAAACCACTCAAGAGTCATAGGATTAGATGATCCAAGTCACCAAGAAATTACTGTCTCAAGTGATACGCTTCAGCGCCAGTCA
GCAAAGTAAATAAATACTGTGCTTCTTCCAACTTTCATTCCACTTGGGGAAAAAAAAATATCATCATGTCAAACATTACGATTGACCCAG
ATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAGAAAATTGAAGTTGTAATGGCCGAAC
CCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATAAGCTCTATGAGCTCAGTAGCAGAGC
ACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGATGAATCTTATGAATATAGGCCTCGGT
CTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGACTTAGCAGTAGACTTCATTTTTTGTT
TAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAAGTTCTAAACTTAGCTTTTAAGCACT
TTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATATGCAGAGGTGATAGGGGTTCTTGCCC
AATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAACAAAGCCCACATGTGGTACAAAGTG
TCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAAGCATCATTTCAATTTATGCAGGAAT
GTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTGGAGATTCTTATCCCTGTAGCTGCTG
CTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACTTTTGAACTGAGCTCGAGAAAGAAGC
ATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTAAATAACTGGCATATTTTCCTACAGA
ACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTATAGATTATTGTGGGTTTATGTAATTA
GAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTTCCAAAAGGCTCACGAAGTGTGGTTC
CTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGATTTTGCAATGAAAGAAATAATATTTG
ATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGTCTCAGAGTCTTCCTTGTAATAGCAG
ACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGAAATACTCTTCGTGTAAAGAAAATAT
TTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAAGTAAGAAAAGCATTAGATAGCATCC
TCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAGGAGCCTGAAGACATGATTACGGGGG
AAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGACGGTATGAGCAGAACTGACCTGATTG
AATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTGCAGGCACTAATGCTTGATTTTCCAG
ATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCATCCCACACTTCTTGATAATGCCGTAA
AGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGACACTCAGCATGGTGTAGCTAATGGAG
CTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTTGCGCTTGTCATTCTCTGTAGCAGTC
GACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTGGAAATACCTAAGGGTGATGATGAAT
TAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGGGCTGATCAGACTACTTTGCTCTATT
GCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTTGATGTGATTAGTCCATCACATATAT
GGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAGCAAGAAAATCTTCCTAAACACTGCT
CTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTCGATATAAATAGCCCCATCAATGCTA
AGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTTTGCTGCAGTGCAGCAACATCGTCAT
CTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGCGGCTATAGCATTGATTCTAAAATTA
TTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATGGAAATCACAGAATCCCTTGTTCTAG
GTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAAGAAGCACTCGAAAGAAGGCCAGAGA
ATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTGGCAGATGCTGGTGTCATTAGTCACA
GAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGA
CCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCC
GCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAAC
CCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAG
TTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCC
GCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCT
TGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGC
AAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCT
ATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGAT
TAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGAC
AGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGAC
TGTGAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTGCACTGCAAATTTGCATGTTTGTTTT
GGACTAATTTTTTTCAATTTATTTTTTCACCTTCATTTTTCTCTTATTTCAAGTTCAATGAAAGACTTTACAAAAGCAAACAAAGCAGAC

>In-frame_FRYL_ENST00000358350_chr4_48572844_-_CORIN_ENST00000502252_chr4_47628538_-_4593nt
GAAGACCTCGCAGCACAGCCGGGCGCCCGTCGGGCTCTGGGAGAGAGCGAGAGAGAAATCCGGTTAAAATCAGAGTCGGAGGGAGGTTTA
ACCACAGATCGGTTCCGATCGGATTATTCCTTAAAGGGGACGCGCCATTGTCAAGAGAACGGAGCCAGGGGCCCGAGGGCGGGGACCGGC
GGCGCTGGAGGAGCGAGGCAGCTGTACTAGGACTGGGAACGGCCTAGAACATTCCATATTCTGCTTCACACACGGTGACTCACTCACTAC
TGCTTTGTACCAGTGTGCCCACTCGAGTGCCTGTAAAGTACAAGCTCCAGATCAAAAAAGCTTCTAGATGGATCCTTTCCAAACTTGGTG
TCTTTTCTACAAACTCTGTGCCTCAACAACCATTTCTAAGTGAGCTGAAGCCATTTATTGGTATCTTGGATGGTTAACATCTAAATGCTT
AATTCCTGAAACCACTCAAGAGTCATAGGATTAGATGATCCAAGTCACCAAGAAATTACTGTCTCAAGTGATACGCTTCAGCGCCAGTCA
GCAAAGTAAATAAATACTGTGCTTCTTCCAACTTTCATTCCACTTGGGGAAAAAAAAATATCATCATGTCAAACATTACGATTGACCCAG
ATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAGAAAATTGAAGTTGTAATGGCCGAAC
CCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATAAGCTCTATGAGCTCAGTAGCAGAGC
ACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGATGAATCTTATGAATATAGGCCTCGGT
CTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGACTTAGCAGTAGACTTCATTTTTTGTT
TAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAAGTTCTAAACTTAGCTTTTAAGCACT
TTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATATGCAGAGGTGATAGGGGTTCTTGCCC
AATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAACAAAGCCCACATGTGGTACAAAGTG
TCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAAGCATCATTTCAATTTATGCAGGAAT
GTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTGGAGATTCTTATCCCTGTAGCTGCTG
CTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACTTTTGAACTGAGCTCGAGAAAGAAGC
ATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTAAATAACTGGCATATTTTCCTACAGA
ACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTATAGATTATTGTGGGTTTATGTAATTA
GAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTTCCAAAAGGCTCACGAAGTGTGGTTC
CTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGATTTTGCAATGAAAGAAATAATATTTG
ATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGTCTCAGAGTCTTCCTTGTAATAGCAG
ACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGAAATACTCTTCGTGTAAAGAAAATAT
TTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAAGTAAGAAAAGCATTAGATAGCATCC
TCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAGGAGCCTGAAGACATGATTACGGGGG
AAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGACGGTATGAGCAGAACTGACCTGATTG
AATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTGCAGGCACTAATGCTTGATTTTCCAG
ATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCATCCCACACTTCTTGATAATGCCGTAA
AGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGACACTCAGCATGGTGTAGCTAATGGAG
CTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTTGCGCTTGTCATTCTCTGTAGCAGTC
GACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTGGAAATACCTAAGGGTGATGATGAAT
TAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGGGCTGATCAGACTACTTTGCTCTATT
GCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTTGATGTGATTAGTCCATCACATATAT
GGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAGCAAGAAAATCTTCCTAAACACTGCT
CTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTCGATATAAATAGCCCCATCAATGCTA
AGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTTTGCTGCAGTGCAGCAACATCGTCAT
CTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGCGGCTATAGCATTGATTCTAAAATTA
TTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATGGAAATCACAGAATCCCTTGTTCTAG
GTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAAGAAGCACTCGAAAGAAGGCCAGAGA
ATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTGGCAGATGCTGGTGTCATTAGTCACA
GAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGA
CCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCC
GCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAAC
CCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAG
TTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCC
GCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCT
TGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGC
AAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCT
ATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGAT
TAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGAC
AGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGAC

>In-frame_FRYL_ENST00000358350_chr4_48572844_-_CORIN_ENST00000505909_chr4_47628538_-_4532nt
GAAGACCTCGCAGCACAGCCGGGCGCCCGTCGGGCTCTGGGAGAGAGCGAGAGAGAAATCCGGTTAAAATCAGAGTCGGAGGGAGGTTTA
ACCACAGATCGGTTCCGATCGGATTATTCCTTAAAGGGGACGCGCCATTGTCAAGAGAACGGAGCCAGGGGCCCGAGGGCGGGGACCGGC
GGCGCTGGAGGAGCGAGGCAGCTGTACTAGGACTGGGAACGGCCTAGAACATTCCATATTCTGCTTCACACACGGTGACTCACTCACTAC
TGCTTTGTACCAGTGTGCCCACTCGAGTGCCTGTAAAGTACAAGCTCCAGATCAAAAAAGCTTCTAGATGGATCCTTTCCAAACTTGGTG
TCTTTTCTACAAACTCTGTGCCTCAACAACCATTTCTAAGTGAGCTGAAGCCATTTATTGGTATCTTGGATGGTTAACATCTAAATGCTT
AATTCCTGAAACCACTCAAGAGTCATAGGATTAGATGATCCAAGTCACCAAGAAATTACTGTCTCAAGTGATACGCTTCAGCGCCAGTCA
GCAAAGTAAATAAATACTGTGCTTCTTCCAACTTTCATTCCACTTGGGGAAAAAAAAATATCATCATGTCAAACATTACGATTGACCCAG
ATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAGAAAATTGAAGTTGTAATGGCCGAAC
CCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATAAGCTCTATGAGCTCAGTAGCAGAGC
ACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGATGAATCTTATGAATATAGGCCTCGGT
CTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGACTTAGCAGTAGACTTCATTTTTTGTT
TAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAAGTTCTAAACTTAGCTTTTAAGCACT
TTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATATGCAGAGGTGATAGGGGTTCTTGCCC
AATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAACAAAGCCCACATGTGGTACAAAGTG
TCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAAGCATCATTTCAATTTATGCAGGAAT
GTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTGGAGATTCTTATCCCTGTAGCTGCTG
CTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACTTTTGAACTGAGCTCGAGAAAGAAGC
ATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTAAATAACTGGCATATTTTCCTACAGA
ACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTATAGATTATTGTGGGTTTATGTAATTA
GAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTTCCAAAAGGCTCACGAAGTGTGGTTC
CTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGATTTTGCAATGAAAGAAATAATATTTG
ATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGTCTCAGAGTCTTCCTTGTAATAGCAG
ACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGAAATACTCTTCGTGTAAAGAAAATAT
TTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAAGTAAGAAAAGCATTAGATAGCATCC
TCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAGGAGCCTGAAGACATGATTACGGGGG
AAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGACGGTATGAGCAGAACTGACCTGATTG
AATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTGCAGGCACTAATGCTTGATTTTCCAG
ATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCATCCCACACTTCTTGATAATGCCGTAA
AGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGACACTCAGCATGGTGTAGCTAATGGAG
CTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTTGCGCTTGTCATTCTCTGTAGCAGTC
GACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTGGAAATACCTAAGGGTGATGATGAAT
TAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGGGCTGATCAGACTACTTTGCTCTATT
GCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTTGATGTGATTAGTCCATCACATATAT
GGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAGCAAGAAAATCTTCCTAAACACTGCT
CTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTCGATATAAATAGCCCCATCAATGCTA
AGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTTTGCTGCAGTGCAGCAACATCGTCAT
CTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGCGGCTATAGCATTGATTCTAAAATTA
TTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATGGAAATCACAGAATCCCTTGTTCTAG
GTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAAGAAGCACTCGAAAGAAGGCCAGAGA
ATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTGGCAGATGCTGGTGTCATTAGTCACA
GAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGA
CCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCC
GCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAAC
CCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAG
TTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCC
GCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCT
TGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGC
AAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCT
ATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGAT
TAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGAC

>In-frame_FRYL_ENST00000537810_chr4_48572844_-_CORIN_ENST00000273857_chr4_47628538_-_6255nt
GAAGACCTCGCAGCACAGCCGGGCGCCCGTCGGGCTCTGGGAGAGAGCGAGAGAGAAATCCGGTTAAAATCAGAGTCGGAGGGAGGTTTA
ACCACAGATCGGTTCCGATCGGATTATTCCTTAAAGGGGACGCGCCATTGTCAAGAGAACGGAGCCAGGGGCCCGAGGGCGGGGACCGGC
GGCGCTGGAGGAGCGAGGCAGCTGTACTAGGACTGGGAACGGCCTAGAACATTCCATATTCTGCTTCACACACGGTGACTCACTCACTAC
TGCTTTGTACCAGTGTGCCCACTCGAGTGCCTGTAAAGTACAAGCTCCAGATCAAAAAAGCTTCTAGATGGATCCTTTCCAAACTTGGTG
TCTTTTCTACAAACTCTGTGCCTCAACAACCATTTCTAAGTGAGCTGAAGCCATTTATTGGTATCTTGGATGGTTAACATCTAAATGCTT
AATTCCTGAAACCACTCAAGAGTCATAGGATTAGATGATCCAAGTCACCAAGAAATTACTGTCTCAAGTGATACGCTTCAGCGCCAGTCA
GCAAAGTAAATAAATACTGTGCTTCTTCCAACTTTCATTCCACTTGGGGAAAAAAAAATATCATCATGTCAAACATTACGATTGACCCAG
ATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAGAAAATTGAAGTTGTAATGGCCGAAC
CCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATAAGCTCTATGAGCTCAGTAGCAGAGC
ACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGATGAATCTTATGAATATAGGCCTCGGT
CTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGACTTAGCAGTAGACTTCATTTTTTGTT
TAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAAGTTCTAAACTTAGCTTTTAAGCACT
TTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATATGCAGAGGTGATAGGGGTTCTTGCCC
AATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAACAAAGCCCACATGTGGTACAAAGTG
TCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAAGCATCATTTCAATTTATGCAGGAAT
GTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTGGAGATTCTTATCCCTGTAGCTGCTG
CTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACTTTTGAACTGAGCTCGAGAAAGAAGC
ATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTAAATAACTGGCATATTTTCCTACAGA
ACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTATAGATTATTGTGGGTTTATGTAATTA
GAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTTCCAAAAGGCTCACGAAGTGTGGTTC
CTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGATTTTGCAATGAAAGAAATAATATTTG
ATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGTCTCAGAGTCTTCCTTGTAATAGCAG
ACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGAAATACTCTTCGTGTAAAGAAAATAT
TTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAAGTAAGAAAAGCATTAGATAGCATCC
TCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAGGAGCCTGAAGACATGATTACGGGGG
AAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGACGGTATGAGCAGAACTGACCTGATTG
AATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTGCAGGCACTAATGCTTGATTTTCCAG
ATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCATCCCACACTTCTTGATAATGCCGTAA
AGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGACACTCAGCATGGTGTAGCTAATGGAG
CTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTTGCGCTTGTCATTCTCTGTAGCAGTC
GACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTGGAAATACCTAAGGGTGATGATGAAT
TAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGGGCTGATCAGACTACTTTGCTCTATT
GCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTTGATGTGATTAGTCCATCACATATAT
GGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAGCAAGAAAATCTTCCTAAACACTGCT
CTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTCGATATAAATAGCCCCATCAATGCTA
AGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTTTGCTGCAGTGCAGCAACATCGTCAT
CTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGCGGCTATAGCATTGATTCTAAAATTA
TTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATGGAAATCACAGAATCCCTTGTTCTAG
GTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAAGAAGCACTCGAAAGAAGGCCAGAGA
ATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTGGCAGATGCTGGTGTCATTAGTCACA
GAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGA
CCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCC
GCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAAC
CCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAG
TTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCC
GCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCT
TGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGC
AAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCT
ATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGAT
TAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGAC
AGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGAC
TGTGAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTGCACTGCAAATTTGCATGTTTGTTTT
GGACTAATTTTTTTCAATTTATTTTTTCACCTTCATTTTTCTCTTATTTCAAGTTCAATGAAAGACTTTACAAAAGCAAACAAAGCAGAC
TTTGTCCTTTTGCCAGGCCTAACCATGACTGCAGCACAAAATTATCGACTCTGGCGAGATTTAAAATCAGGTGCTACAGTAACAGGTTAT
GGAATGGTCTCTTTTATCCTATCACAAAAAAAGACATAGATATTTAGGCTGATTAATTATCTCTACCAGTTTTTGTTTCTCAAGCTCAGT
GCATAGTGGTAAATTTCAGTGTTAACATTGGAGACTTGCTTTTCTTTTTCTTTTTTTATACCCCACAATTCTTTTTTATTACACTTCGAA
TTTTAGGGTACACGAGCACAACGTGCAGGTTAGTTACATATGTATACATGTGCCATGTTGGTGTGCTGAACCCAGTAACTCGTCATTTGA
TTTATTAAAAGCCAAGATAATTTACATGTTTAAAGTATTTACTATTACCCCCTTCTAATGTTTGCATAATTCTGAGAACTGATAAAAGAC
AGCAATAAAAGACCAGTGTCATCCATTTAGGTAGCAAGACATATTGAATGCAAAGTTCTTTAGATATCAATATTAACACTTGACATTATT
GGACCCCCCATTCTGGATGTATATCAAGATCATAATTTTATAGAAGAGTCTCTATAGAACTGTCCTCATAGCTGGGTTTGTTCAGGATAT
ATGAGTTGGCTGATTGAGACTGCAACAACTACATCTATATTTATGGGCAATATTTTGTTTTACTTATGTGGCAAAGAACTGGATATTAAA
CTTTGCAAAAGAGAATTTAGATGAGAGATGCAATTTTTTAAAAAGAAAATTAATTTGCATCCCTCGTTTAATTAAATTTATTTTTCAGTT
TTCTTGCGTTCATCCATACCAACAAAGTCATAAAGAGCATATTTTAGAGCACAGTAAGACTTTGCATGGAGTAAAACATTTTGTAATTTT
CCTCAAAAGATGTTTAATATCTGGTTTCTTCTCATTGGTAATTAAAATTTTAGAAATGATTTTTAGCTCTAGGCCACTTTACGCAACTCA
ATTTCTGAAGCAATTAGTGGTAAAAAGTATTTTTCCCCACTAAAAAACTTTAAAACACAAATCTTCATATATACTTAATTTAATTAGTCA
GGCATCCATTTTGCCTTTTAAACAACTAGGATTCCCTACTAACCTCCACCAGCAACCTGGACTGCCTCAGCATTCCAAATAGATACTACC
TGCAATTTTATACATGTATTTTTGTATCTTTTCTGTGTGTAAACATAGTTGAAATTCAAAAAGTTGTAGCAATTTCTATACTATTCATCT
CCTGTCCTTCAGTTTGTATAAACCTAAGGAGAGTGTGAAATCCAGCAACTGAATTGTGGTCACGATTGTATGAAAGTTCAAGAACATATG
TCAGTTTTGTTACAGTTGTAGCTACATACTCAATGTATCAACTTTTAGCCTGCTCAACTTAGGCTCAGTGAAATATATATATTATACTTA

>In-frame_FRYL_ENST00000537810_chr4_48572844_-_CORIN_ENST00000508498_chr4_47628538_-_4771nt
GAAGACCTCGCAGCACAGCCGGGCGCCCGTCGGGCTCTGGGAGAGAGCGAGAGAGAAATCCGGTTAAAATCAGAGTCGGAGGGAGGTTTA
ACCACAGATCGGTTCCGATCGGATTATTCCTTAAAGGGGACGCGCCATTGTCAAGAGAACGGAGCCAGGGGCCCGAGGGCGGGGACCGGC
GGCGCTGGAGGAGCGAGGCAGCTGTACTAGGACTGGGAACGGCCTAGAACATTCCATATTCTGCTTCACACACGGTGACTCACTCACTAC
TGCTTTGTACCAGTGTGCCCACTCGAGTGCCTGTAAAGTACAAGCTCCAGATCAAAAAAGCTTCTAGATGGATCCTTTCCAAACTTGGTG
TCTTTTCTACAAACTCTGTGCCTCAACAACCATTTCTAAGTGAGCTGAAGCCATTTATTGGTATCTTGGATGGTTAACATCTAAATGCTT
AATTCCTGAAACCACTCAAGAGTCATAGGATTAGATGATCCAAGTCACCAAGAAATTACTGTCTCAAGTGATACGCTTCAGCGCCAGTCA
GCAAAGTAAATAAATACTGTGCTTCTTCCAACTTTCATTCCACTTGGGGAAAAAAAAATATCATCATGTCAAACATTACGATTGACCCAG
ATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAGAAAATTGAAGTTGTAATGGCCGAAC
CCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATAAGCTCTATGAGCTCAGTAGCAGAGC
ACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGATGAATCTTATGAATATAGGCCTCGGT
CTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGACTTAGCAGTAGACTTCATTTTTTGTT
TAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAAGTTCTAAACTTAGCTTTTAAGCACT
TTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATATGCAGAGGTGATAGGGGTTCTTGCCC
AATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAACAAAGCCCACATGTGGTACAAAGTG
TCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAAGCATCATTTCAATTTATGCAGGAAT
GTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTGGAGATTCTTATCCCTGTAGCTGCTG
CTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACTTTTGAACTGAGCTCGAGAAAGAAGC
ATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTAAATAACTGGCATATTTTCCTACAGA
ACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTATAGATTATTGTGGGTTTATGTAATTA
GAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTTCCAAAAGGCTCACGAAGTGTGGTTC
CTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGATTTTGCAATGAAAGAAATAATATTTG
ATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGTCTCAGAGTCTTCCTTGTAATAGCAG
ACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGAAATACTCTTCGTGTAAAGAAAATAT
TTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAAGTAAGAAAAGCATTAGATAGCATCC
TCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAGGAGCCTGAAGACATGATTACGGGGG
AAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGACGGTATGAGCAGAACTGACCTGATTG
AATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTGCAGGCACTAATGCTTGATTTTCCAG
ATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCATCCCACACTTCTTGATAATGCCGTAA
AGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGACACTCAGCATGGTGTAGCTAATGGAG
CTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTTGCGCTTGTCATTCTCTGTAGCAGTC
GACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTGGAAATACCTAAGGGTGATGATGAAT
TAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGGGCTGATCAGACTACTTTGCTCTATT
GCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTTGATGTGATTAGTCCATCACATATAT
GGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAGCAAGAAAATCTTCCTAAACACTGCT
CTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTCGATATAAATAGCCCCATCAATGCTA
AGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTTTGCTGCAGTGCAGCAACATCGTCAT
CTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGCGGCTATAGCATTGATTCTAAAATTA
TTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATGGAAATCACAGAATCCCTTGTTCTAG
GTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAAGAAGCACTCGAAAGAAGGCCAGAGA
ATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTGGCAGATGCTGGTGTCATTAGTCACA
GAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGA
CCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCC
GCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAAC
CCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAG
TTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCC
GCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCT
TGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGC
AAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCT
ATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGAT
TAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGAC
AGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGAC
TGTGAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTGCACTGCAAATTTGCATGTTTGTTTT
GGACTAATTTTTTTCAATTTATTTTTTCACCTTCATTTTTCTCTTATTTCAAGTTCAATGAAAGACTTTACAAAAGCAAACAAAGCAGAC

>In-frame_FRYL_ENST00000537810_chr4_48572844_-_CORIN_ENST00000502252_chr4_47628538_-_4593nt
GAAGACCTCGCAGCACAGCCGGGCGCCCGTCGGGCTCTGGGAGAGAGCGAGAGAGAAATCCGGTTAAAATCAGAGTCGGAGGGAGGTTTA
ACCACAGATCGGTTCCGATCGGATTATTCCTTAAAGGGGACGCGCCATTGTCAAGAGAACGGAGCCAGGGGCCCGAGGGCGGGGACCGGC
GGCGCTGGAGGAGCGAGGCAGCTGTACTAGGACTGGGAACGGCCTAGAACATTCCATATTCTGCTTCACACACGGTGACTCACTCACTAC
TGCTTTGTACCAGTGTGCCCACTCGAGTGCCTGTAAAGTACAAGCTCCAGATCAAAAAAGCTTCTAGATGGATCCTTTCCAAACTTGGTG
TCTTTTCTACAAACTCTGTGCCTCAACAACCATTTCTAAGTGAGCTGAAGCCATTTATTGGTATCTTGGATGGTTAACATCTAAATGCTT
AATTCCTGAAACCACTCAAGAGTCATAGGATTAGATGATCCAAGTCACCAAGAAATTACTGTCTCAAGTGATACGCTTCAGCGCCAGTCA
GCAAAGTAAATAAATACTGTGCTTCTTCCAACTTTCATTCCACTTGGGGAAAAAAAAATATCATCATGTCAAACATTACGATTGACCCAG
ATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAGAAAATTGAAGTTGTAATGGCCGAAC
CCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATAAGCTCTATGAGCTCAGTAGCAGAGC
ACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGATGAATCTTATGAATATAGGCCTCGGT
CTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGACTTAGCAGTAGACTTCATTTTTTGTT
TAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAAGTTCTAAACTTAGCTTTTAAGCACT
TTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATATGCAGAGGTGATAGGGGTTCTTGCCC
AATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAACAAAGCCCACATGTGGTACAAAGTG
TCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAAGCATCATTTCAATTTATGCAGGAAT
GTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTGGAGATTCTTATCCCTGTAGCTGCTG
CTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACTTTTGAACTGAGCTCGAGAAAGAAGC
ATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTAAATAACTGGCATATTTTCCTACAGA
ACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTATAGATTATTGTGGGTTTATGTAATTA
GAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTTCCAAAAGGCTCACGAAGTGTGGTTC
CTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGATTTTGCAATGAAAGAAATAATATTTG
ATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGTCTCAGAGTCTTCCTTGTAATAGCAG
ACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGAAATACTCTTCGTGTAAAGAAAATAT
TTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAAGTAAGAAAAGCATTAGATAGCATCC
TCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAGGAGCCTGAAGACATGATTACGGGGG
AAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGACGGTATGAGCAGAACTGACCTGATTG
AATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTGCAGGCACTAATGCTTGATTTTCCAG
ATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCATCCCACACTTCTTGATAATGCCGTAA
AGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGACACTCAGCATGGTGTAGCTAATGGAG
CTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTTGCGCTTGTCATTCTCTGTAGCAGTC
GACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTGGAAATACCTAAGGGTGATGATGAAT
TAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGGGCTGATCAGACTACTTTGCTCTATT
GCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTTGATGTGATTAGTCCATCACATATAT
GGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAGCAAGAAAATCTTCCTAAACACTGCT
CTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTCGATATAAATAGCCCCATCAATGCTA
AGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTTTGCTGCAGTGCAGCAACATCGTCAT
CTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGCGGCTATAGCATTGATTCTAAAATTA
TTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATGGAAATCACAGAATCCCTTGTTCTAG
GTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAAGAAGCACTCGAAAGAAGGCCAGAGA
ATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTGGCAGATGCTGGTGTCATTAGTCACA
GAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGA
CCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCC
GCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAAC
CCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAG
TTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCC
GCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCT
TGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGC
AAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCT
ATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGAT
TAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGAC
AGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGAC

>In-frame_FRYL_ENST00000537810_chr4_48572844_-_CORIN_ENST00000505909_chr4_47628538_-_4532nt
GAAGACCTCGCAGCACAGCCGGGCGCCCGTCGGGCTCTGGGAGAGAGCGAGAGAGAAATCCGGTTAAAATCAGAGTCGGAGGGAGGTTTA
ACCACAGATCGGTTCCGATCGGATTATTCCTTAAAGGGGACGCGCCATTGTCAAGAGAACGGAGCCAGGGGCCCGAGGGCGGGGACCGGC
GGCGCTGGAGGAGCGAGGCAGCTGTACTAGGACTGGGAACGGCCTAGAACATTCCATATTCTGCTTCACACACGGTGACTCACTCACTAC
TGCTTTGTACCAGTGTGCCCACTCGAGTGCCTGTAAAGTACAAGCTCCAGATCAAAAAAGCTTCTAGATGGATCCTTTCCAAACTTGGTG
TCTTTTCTACAAACTCTGTGCCTCAACAACCATTTCTAAGTGAGCTGAAGCCATTTATTGGTATCTTGGATGGTTAACATCTAAATGCTT
AATTCCTGAAACCACTCAAGAGTCATAGGATTAGATGATCCAAGTCACCAAGAAATTACTGTCTCAAGTGATACGCTTCAGCGCCAGTCA
GCAAAGTAAATAAATACTGTGCTTCTTCCAACTTTCATTCCACTTGGGGAAAAAAAAATATCATCATGTCAAACATTACGATTGACCCAG
ATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTGTTCAAGCTGAAAAGAAAATTGAAGTTGTAATGGCCGAAC
CCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGTTTGATCAGTTGATAAGCTCTATGAGCTCAGTAGCAGAGC
ACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAAATGGAACGGAAGATGAATCTTATGAATATAGGCCTCGGT
CTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTCTTGAAAGGAGGGACTTAGCAGTAGACTTCATTTTTTGTT
TAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATCCCTTAGTTCATGAAGTTCTAAACTTAGCTTTTAAGCACT
TTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTATTGCTGATTTATATGCAGAGGTGATAGGGGTTCTTGCCC
AATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAACTGCGACAAAAGGAACAAAGCCCACATGTGGTACAAAGTG
TCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTGTAGAAGATTTTGAAGCATCATTTCAATTTATGCAGGAAT
GTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTGCTGGTTTATTTGTGGAGATTCTTATCCCTGTAGCTGCTG
CTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGCTTTATCAGACTACTTTTGAACTGAGCTCGAGAAAGAAGC
ATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGAAACAATTTTTTTTAAATAACTGGCATATTTTCCTACAGA
ACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCACTGGAATCTTTGTATAGATTATTGTGGGTTTATGTAATTA
GAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAGTGTCAGCACTTTTTCCAAAAGGCTCACGAAGTGTGGTTC
CTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTCAGGAACGCTTGGATTTTGCAATGAAAGAAATAATATTTG
ATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGAGAATGAACATAGGTCTCAGAGTCTTCCTTGTAATAGCAG
ACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTATTCTTCCCTCAGGAAATACTCTTCGTGTAAAGAAAATAT
TTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAGTTTACTATCCTCAAGTAAGAAAAGCATTAGATAGCATCC
TCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGCAGATGTCTAATAAGGAGCCTGAAGACATGATTACGGGGG
AAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAAGGTTGATTCCTGACGGTATGAGCAGAACTGACCTGATTG
AATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGGCTTTCAATACTCTGCAGGCACTAATGCTTGATTTTCCAG
ATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAGTGACTGATGTCCATCCCACACTTCTTGATAATGCCGTAA
AGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATAATAAAAACCAGGACACTCAGCATGGTGTAGCTAATGGAG
CTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATGTGGTTGAAGGCTTTGCGCTTGTCATTCTCTGTAGCAGTC
GACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTTTATTTGCACTTCTGGAAATACCTAAGGGTGATGATGAAT
TAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCATACATCTCACTGGGGCTGATCAGACTACTTTGCTCTATT
GCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTATTAGCCACCAGTTTGATGTGATTAGTCCATCACATATAT
GGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCTCCAGTTTTTTAAAGCAAGAAAATCTTCCTAAACACTGCT
CTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGTTGTCCCCTCAGGTCGATATAAATAGCCCCATCAATGCTA
AGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAAACTATCTGATCCTTTGCTGCAGTGCAGCAACATCGTCAT
CTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGTCTACCCCAGATAGCGGCTATAGCATTGATTCTAAAATTA
TTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGCGTTCTGAGAGCATGGAAATCACAGAATCCCTTGTTCTAG
GTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTACATCCCATAATTAAAGAAGCACTCGAAAGAAGGCCAGAGA
ATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAATATTTGAACTGCTGGCAGATGCTGGTGTCATTAGTCACA
GAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGA
CCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCC
GCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAAC
CCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAG
TTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCC
GCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCT
TGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGC
AAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCT
ATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGAT
TAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGAC

>In-frame_FRYL_ENST00000507711_chr4_48572844_-_CORIN_ENST00000273857_chr4_47628538_-_6204nt
AGAGAAATCCGGTTAAAATCAGAGTCGGAGGGAGGTTTAACCACAGATCGGTTCCGATCGGATTATTCCTTAAAGGGGACGCGCCATTGT
CAAGAGAACGGAGCCAGGGGCCCGAGGGCGGGGACCGGCGGCGCTGGAGGAGCGAGGCAGCTGTACTAGGACTGGGAACGGCCTAGAACA
TTCCATATTCTGCTTCACACACGGTGACTCACTCACTACTGCTTTGTACCAGTGTGCCCACTCGAGTGCCTGTAAAGTACAAGCTCCAGA
TCAAAAAAGCTTCTAGATGGATCCTTTCCAAACTTGGTGTCTTTTCTACAAACTCTGTGCCTCAACAACCATTTCTAAGTGAGCTGAAGC
CATTTATTGGTATCTTGGATGGTTAACATCTAAATGCTTAATTCCTGAAACCACTCAAGAGTCATAGGATTAGATGATCCAAGTCACCAA
GAAATTACTGTCTCAAGTGATACGCTTCAGCGCCAGTCAGCAAAGTAAATAAATACTGTGCTTCTTCCAACTTTCATTCCACTTGGGGAA
AAAAAAATATCATCATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTG
TTCAAGCTGAAAAGAAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGT
TTGATCAGTTGATAAGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAA
ATGGAACGGAAGATGAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTC
TTGAAAGGAGGGACTTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATC
CCTTAGTTCATGAAGTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTA
TTGCTGATTTATATGCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAAC
TGCGACAAAAGGAACAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTG
TAGAAGATTTTGAAGCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTG
CTGGTTTATTTGTGGAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGC
TTTATCAGACTACTTTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGA
AACAATTTTTTTTAAATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCAC
TGGAATCTTTGTATAGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAG
TGTCAGCACTTTTTCCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTC
AGGAACGCTTGGATTTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGA
GAATGAACATAGGTCTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTA
TTCTTCCCTCAGGAAATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAG
TTTACTATCCTCAAGTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGC
AGATGTCTAATAAGGAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAA
GGTTGATTCCTGACGGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGG
CTTTCAATACTCTGCAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAG
TGACTGATGTCCATCCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATA
ATAAAAACCAGGACACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATG
TGGTTGAAGGCTTTGCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTT
TATTTGCACTTCTGGAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCA
TACATCTCACTGGGGCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTA
TTAGCCACCAGTTTGATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCT
CCAGTTTTTTAAAGCAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGT
TGTCCCCTCAGGTCGATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAA
ACTATCTGATCCTTTGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGT
CTACCCCAGATAGCGGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGC
GTTCTGAGAGCATGGAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTAC
ATCCCATAATTAAAGAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAA
TATTTGAACTGCTGGCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGT
GGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTA
AAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCC
CTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGA
CAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCA
TGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTG
AAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAG
GCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTG
ACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTG
TTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTT
ATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGA
CTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGACTGTGAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGA
AATGCTCAATCGTGCACTGCAAATTTGCATGTTTGTTTTGGACTAATTTTTTTCAATTTATTTTTTCACCTTCATTTTTCTCTTATTTCA
AGTTCAATGAAAGACTTTACAAAAGCAAACAAAGCAGACTTTGTCCTTTTGCCAGGCCTAACCATGACTGCAGCACAAAATTATCGACTC
TGGCGAGATTTAAAATCAGGTGCTACAGTAACAGGTTATGGAATGGTCTCTTTTATCCTATCACAAAAAAAGACATAGATATTTAGGCTG
ATTAATTATCTCTACCAGTTTTTGTTTCTCAAGCTCAGTGCATAGTGGTAAATTTCAGTGTTAACATTGGAGACTTGCTTTTCTTTTTCT
TTTTTTATACCCCACAATTCTTTTTTATTACACTTCGAATTTTAGGGTACACGAGCACAACGTGCAGGTTAGTTACATATGTATACATGT
GCCATGTTGGTGTGCTGAACCCAGTAACTCGTCATTTGATTTATTAAAAGCCAAGATAATTTACATGTTTAAAGTATTTACTATTACCCC
CTTCTAATGTTTGCATAATTCTGAGAACTGATAAAAGACAGCAATAAAAGACCAGTGTCATCCATTTAGGTAGCAAGACATATTGAATGC
AAAGTTCTTTAGATATCAATATTAACACTTGACATTATTGGACCCCCCATTCTGGATGTATATCAAGATCATAATTTTATAGAAGAGTCT
CTATAGAACTGTCCTCATAGCTGGGTTTGTTCAGGATATATGAGTTGGCTGATTGAGACTGCAACAACTACATCTATATTTATGGGCAAT
ATTTTGTTTTACTTATGTGGCAAAGAACTGGATATTAAACTTTGCAAAAGAGAATTTAGATGAGAGATGCAATTTTTTAAAAAGAAAATT
AATTTGCATCCCTCGTTTAATTAAATTTATTTTTCAGTTTTCTTGCGTTCATCCATACCAACAAAGTCATAAAGAGCATATTTTAGAGCA
CAGTAAGACTTTGCATGGAGTAAAACATTTTGTAATTTTCCTCAAAAGATGTTTAATATCTGGTTTCTTCTCATTGGTAATTAAAATTTT
AGAAATGATTTTTAGCTCTAGGCCACTTTACGCAACTCAATTTCTGAAGCAATTAGTGGTAAAAAGTATTTTTCCCCACTAAAAAACTTT
AAAACACAAATCTTCATATATACTTAATTTAATTAGTCAGGCATCCATTTTGCCTTTTAAACAACTAGGATTCCCTACTAACCTCCACCA
GCAACCTGGACTGCCTCAGCATTCCAAATAGATACTACCTGCAATTTTATACATGTATTTTTGTATCTTTTCTGTGTGTAAACATAGTTG
AAATTCAAAAAGTTGTAGCAATTTCTATACTATTCATCTCCTGTCCTTCAGTTTGTATAAACCTAAGGAGAGTGTGAAATCCAGCAACTG
AATTGTGGTCACGATTGTATGAAAGTTCAAGAACATATGTCAGTTTTGTTACAGTTGTAGCTACATACTCAATGTATCAACTTTTAGCCT

>In-frame_FRYL_ENST00000507711_chr4_48572844_-_CORIN_ENST00000508498_chr4_47628538_-_4720nt
AGAGAAATCCGGTTAAAATCAGAGTCGGAGGGAGGTTTAACCACAGATCGGTTCCGATCGGATTATTCCTTAAAGGGGACGCGCCATTGT
CAAGAGAACGGAGCCAGGGGCCCGAGGGCGGGGACCGGCGGCGCTGGAGGAGCGAGGCAGCTGTACTAGGACTGGGAACGGCCTAGAACA
TTCCATATTCTGCTTCACACACGGTGACTCACTCACTACTGCTTTGTACCAGTGTGCCCACTCGAGTGCCTGTAAAGTACAAGCTCCAGA
TCAAAAAAGCTTCTAGATGGATCCTTTCCAAACTTGGTGTCTTTTCTACAAACTCTGTGCCTCAACAACCATTTCTAAGTGAGCTGAAGC
CATTTATTGGTATCTTGGATGGTTAACATCTAAATGCTTAATTCCTGAAACCACTCAAGAGTCATAGGATTAGATGATCCAAGTCACCAA
GAAATTACTGTCTCAAGTGATACGCTTCAGCGCCAGTCAGCAAAGTAAATAAATACTGTGCTTCTTCCAACTTTCATTCCACTTGGGGAA
AAAAAAATATCATCATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTG
TTCAAGCTGAAAAGAAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGT
TTGATCAGTTGATAAGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAA
ATGGAACGGAAGATGAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTC
TTGAAAGGAGGGACTTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATC
CCTTAGTTCATGAAGTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTA
TTGCTGATTTATATGCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAAC
TGCGACAAAAGGAACAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTG
TAGAAGATTTTGAAGCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTG
CTGGTTTATTTGTGGAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGC
TTTATCAGACTACTTTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGA
AACAATTTTTTTTAAATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCAC
TGGAATCTTTGTATAGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAG
TGTCAGCACTTTTTCCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTC
AGGAACGCTTGGATTTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGA
GAATGAACATAGGTCTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTA
TTCTTCCCTCAGGAAATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAG
TTTACTATCCTCAAGTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGC
AGATGTCTAATAAGGAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAA
GGTTGATTCCTGACGGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGG
CTTTCAATACTCTGCAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAG
TGACTGATGTCCATCCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATA
ATAAAAACCAGGACACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATG
TGGTTGAAGGCTTTGCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTT
TATTTGCACTTCTGGAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCA
TACATCTCACTGGGGCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTA
TTAGCCACCAGTTTGATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCT
CCAGTTTTTTAAAGCAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGT
TGTCCCCTCAGGTCGATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAA
ACTATCTGATCCTTTGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGT
CTACCCCAGATAGCGGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGC
GTTCTGAGAGCATGGAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTAC
ATCCCATAATTAAAGAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAA
TATTTGAACTGCTGGCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGT
GGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTA
AAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCC
CTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGA
CAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCA
TGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTG
AAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAG
GCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTG
ACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTG
TTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTT
ATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGA
CTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGACTGTGAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGA
AATGCTCAATCGTGCACTGCAAATTTGCATGTTTGTTTTGGACTAATTTTTTTCAATTTATTTTTTCACCTTCATTTTTCTCTTATTTCA

>In-frame_FRYL_ENST00000507711_chr4_48572844_-_CORIN_ENST00000502252_chr4_47628538_-_4542nt
AGAGAAATCCGGTTAAAATCAGAGTCGGAGGGAGGTTTAACCACAGATCGGTTCCGATCGGATTATTCCTTAAAGGGGACGCGCCATTGT
CAAGAGAACGGAGCCAGGGGCCCGAGGGCGGGGACCGGCGGCGCTGGAGGAGCGAGGCAGCTGTACTAGGACTGGGAACGGCCTAGAACA
TTCCATATTCTGCTTCACACACGGTGACTCACTCACTACTGCTTTGTACCAGTGTGCCCACTCGAGTGCCTGTAAAGTACAAGCTCCAGA
TCAAAAAAGCTTCTAGATGGATCCTTTCCAAACTTGGTGTCTTTTCTACAAACTCTGTGCCTCAACAACCATTTCTAAGTGAGCTGAAGC
CATTTATTGGTATCTTGGATGGTTAACATCTAAATGCTTAATTCCTGAAACCACTCAAGAGTCATAGGATTAGATGATCCAAGTCACCAA
GAAATTACTGTCTCAAGTGATACGCTTCAGCGCCAGTCAGCAAAGTAAATAAATACTGTGCTTCTTCCAACTTTCATTCCACTTGGGGAA
AAAAAAATATCATCATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTG
TTCAAGCTGAAAAGAAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGT
TTGATCAGTTGATAAGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAA
ATGGAACGGAAGATGAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTC
TTGAAAGGAGGGACTTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATC
CCTTAGTTCATGAAGTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTA
TTGCTGATTTATATGCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAAC
TGCGACAAAAGGAACAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTG
TAGAAGATTTTGAAGCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTG
CTGGTTTATTTGTGGAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGC
TTTATCAGACTACTTTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGA
AACAATTTTTTTTAAATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCAC
TGGAATCTTTGTATAGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAG
TGTCAGCACTTTTTCCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTC
AGGAACGCTTGGATTTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGA
GAATGAACATAGGTCTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTA
TTCTTCCCTCAGGAAATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAG
TTTACTATCCTCAAGTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGC
AGATGTCTAATAAGGAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAA
GGTTGATTCCTGACGGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGG
CTTTCAATACTCTGCAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAG
TGACTGATGTCCATCCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATA
ATAAAAACCAGGACACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATG
TGGTTGAAGGCTTTGCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTT
TATTTGCACTTCTGGAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCA
TACATCTCACTGGGGCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTA
TTAGCCACCAGTTTGATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCT
CCAGTTTTTTAAAGCAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGT
TGTCCCCTCAGGTCGATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAA
ACTATCTGATCCTTTGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGT
CTACCCCAGATAGCGGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGC
GTTCTGAGAGCATGGAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTAC
ATCCCATAATTAAAGAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAA
TATTTGAACTGCTGGCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGT
GGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTA
AAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCC
CTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGA
CAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCA
TGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTG
AAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAG
GCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTG
ACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTG
TTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTT
ATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGA

>In-frame_FRYL_ENST00000507711_chr4_48572844_-_CORIN_ENST00000505909_chr4_47628538_-_4481nt
AGAGAAATCCGGTTAAAATCAGAGTCGGAGGGAGGTTTAACCACAGATCGGTTCCGATCGGATTATTCCTTAAAGGGGACGCGCCATTGT
CAAGAGAACGGAGCCAGGGGCCCGAGGGCGGGGACCGGCGGCGCTGGAGGAGCGAGGCAGCTGTACTAGGACTGGGAACGGCCTAGAACA
TTCCATATTCTGCTTCACACACGGTGACTCACTCACTACTGCTTTGTACCAGTGTGCCCACTCGAGTGCCTGTAAAGTACAAGCTCCAGA
TCAAAAAAGCTTCTAGATGGATCCTTTCCAAACTTGGTGTCTTTTCTACAAACTCTGTGCCTCAACAACCATTTCTAAGTGAGCTGAAGC
CATTTATTGGTATCTTGGATGGTTAACATCTAAATGCTTAATTCCTGAAACCACTCAAGAGTCATAGGATTAGATGATCCAAGTCACCAA
GAAATTACTGTCTCAAGTGATACGCTTCAGCGCCAGTCAGCAAAGTAAATAAATACTGTGCTTCTTCCAACTTTCATTCCACTTGGGGAA
AAAAAAATATCATCATGTCAAACATTACGATTGACCCAGATGTCAAACCTGGTGAATATGTCATCAAGAGCCTCTTTGCAGAATTTGCTG
TTCAAGCTGAAAAGAAAATTGAAGTTGTAATGGCCGAACCCTTGGAGAAGCTATTGTCCAGATCTCTTCAGAGGGGTGAAGATCTTCAGT
TTGATCAGTTGATAAGCTCTATGAGCTCAGTAGCAGAGCACTGTCTCCCTTCCTTACTTCGCACCTTGTTTGACTGGTACAGACGCCAAA
ATGGAACGGAAGATGAATCTTATGAATATAGGCCTCGGTCTAGCACAAAGTCTAAGGGGGATGAACAGCAACGTGAAAGAGATTATCTTC
TTGAAAGGAGGGACTTAGCAGTAGACTTCATTTTTTGTTTAGTTTTAGTTGAAGTTCTAAAGCAGATTCCTGTTCATCCTGTACCCGATC
CCTTAGTTCATGAAGTTCTAAACTTAGCTTTTAAGCACTTTAAACATAAGGAAGGATATTCAGGAACCAACACTGGGAATGTGCATATTA
TTGCTGATTTATATGCAGAGGTGATAGGGGTTCTTGCCCAATCAAAGTTTCAGGCTGTAAGGAAGAAGTTTGTGACAGAATTAAAAGAAC
TGCGACAAAAGGAACAAAGCCCACATGTGGTACAAAGTGTCATCAGCTTAATAATGGGAATGAAATTTTTTCGAGTAAAAATGTATCCTG
TAGAAGATTTTGAAGCATCATTTCAATTTATGCAGGAATGTGCTCAGTATTTCTTAGAAGTGAAAGATAAAGATATAAAACATGCACTTG
CTGGTTTATTTGTGGAGATTCTTATCCCTGTAGCTGCTGCTGTTAAAAATGAAGTGAATGTTCCCTGTTTGAAAAATTTTGTGGAGATGC
TTTATCAGACTACTTTTGAACTGAGCTCGAGAAAGAAGCATTCATTGGCTTTATATCCACTAATTACCTGCCTTTTATGTGTCAGTCAGA
AACAATTTTTTTTAAATAACTGGCATATTTTCCTACAGAACTGTTTGTCACATTTAAAGAATAAAGATCCGAAAATGTCTCGAGTTGCAC
TGGAATCTTTGTATAGATTATTGTGGGTTTATGTAATTAGAATAAAATGTGAAAGCAACACTGTAACTCAAAGTCGTCTTATGAGCATAG
TGTCAGCACTTTTTCCAAAAGGCTCACGAAGTGTGGTTCCTCGTGACACACCTCTCAATATATTTGTGAAGATTATTCAGTTCATTGCTC
AGGAACGCTTGGATTTTGCAATGAAAGAAATAATATTTGATCTTCTCAGTGTTGGAAAATCTACTAAAACTTTCACCATTAATCCAGAGA
GAATGAACATAGGTCTCAGAGTCTTCCTTGTAATAGCAGACAGTTTGCAGCAGAAAGATGGTGAACCACCCATGCCAACAACAGGAGTTA
TTCTTCCCTCAGGAAATACTCTTCGTGTAAAGAAAATATTTCTCAATAAAACCTTGACAGATGAAGAAGCAAAAGTCATAGGAATGTCAG
TTTACTATCCTCAAGTAAGAAAAGCATTAGATAGCATCCTCAGACATTTGGACAAAGAAGTTGGGAGACCAATGTGTATGACCAGTGTGC
AGATGTCTAATAAGGAGCCTGAAGACATGATTACGGGGGAAAGAAAACCCAAGATTGATTTGTTTAGAACTTGTATTGCTGCGATTCCAA
GGTTGATTCCTGACGGTATGAGCAGAACTGACCTGATTGAATTGTTAGCAAGGCTCACAATTCATATGGATGAAGAACTGCGTGCTCTGG
CTTTCAATACTCTGCAGGCACTAATGCTTGATTTTCCAGATTGGCGGGAGGATGTTCTTTCAGGATTTGTTTATTTTATTGTTCGTGAAG
TGACTGATGTCCATCCCACACTTCTTGATAATGCCGTAAAGATGTTGGTACAATTAATAAATCAGTGGAAACAAGCAGCCCAAATGCATA
ATAAAAACCAGGACACTCAGCATGGTGTAGCTAATGGAGCTTCTCATCCCCCTCCTCTGGAAAGGAGCCCATATTCCAATGTATTCCATG
TGGTTGAAGGCTTTGCGCTTGTCATTCTCTGTAGCAGTCGACCTGCCACTAGGAGACTAGCCGTCAGTGTCCTTAGAGAAATACGGGCTT
TATTTGCACTTCTGGAAATACCTAAGGGTGATGATGAATTAGCCATAGATGTGATGGACAGGCTAAGCCCATCCATTCTTGAGAGCTTCA
TACATCTCACTGGGGCTGATCAGACTACTTTGCTCTATTGCCCTAGCTCGATAGATTTACAAACTTTAGCAGAATGGAACTCTTCTCCTA
TTAGCCACCAGTTTGATGTGATTAGTCCATCACATATATGGATATTTGCACATGTGACCCAAGGCCAAGACCCATGGATTATAAGTCTCT
CCAGTTTTTTAAAGCAAGAAAATCTTCCTAAACACTGCTCTACAGCTGTGAGCTATGCTTGGATGTTTGCATACACAAGACTTCAGTTGT
TGTCCCCTCAGGTCGATATAAATAGCCCCATCAATGCTAAGAAAGTAAATACCACCACAAGCAGTGACTCATACATTGGCCTGTGGAGAA
ACTATCTGATCCTTTGCTGCAGTGCAGCAACATCGTCATCTTCCACATCTGCAGGTTCTGTGAGATGTTCTCCTCCTGAGACGCTGGCGT
CTACCCCAGATAGCGGCTATAGCATTGATTCTAAAATTATTGGCATCCCATCCCCTTCATCCTTGTTTAAGCACATAGTTCCAATGATGC
GTTCTGAGAGCATGGAAATCACAGAATCCCTTGTTCTAGGTCTTGGCAGGACCAACCCAGGAGCTTTTAGGGAACTAATAGAGGAATTAC
ATCCCATAATTAAAGAAGCACTCGAAAGAAGGCCAGAGAATATGAAACGGCGCAGGCGTCGAGACATTTTACGAGTACAACTGGTACGAA
TATTTGAACTGCTGGCAGATGCTGGTGTCATTAGTCACAGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGT
GGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTA
AAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCC
CTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGA
CAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCA
TGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTG
AAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAG
GCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTG
ACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTG
TTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTT


Top

FusionGenePPI for FRYL_CORIN


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FRYLHOMER3, YWHAG, BAK1, YWHAB, DISC1, SIRT7, GRK5, NOTCH1, MMS19, PELI2, SLMAP, ABCF1, KIAA0930, MARK2, POLH, YWHAH, TACC3, PDZK1, FRY, HOMER1, FLNC, RNF138, FAM78BCORIN


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FRYL_CORIN


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FRYL_CORIN


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCORINC3281288PREECLAMPSIA/ECLAMPSIA 51UNIPROT