FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1395

FusionGeneSummary for AKR1C3_AKR1E2

check button Fusion gene summary
Fusion gene informationFusion gene name: AKR1C3_AKR1E2
Fusion gene ID: 1395
HgeneTgene
Gene symbol

AKR1C3

AKR1E2

Gene ID

8644

83592

Gene namealdo-keto reductase family 1 member C3aldo-keto reductase family 1 member E2
SynonymsDD3|DDX|HA1753|HAKRB|HAKRe|HSD17B5|PGFS|hluPGFSAKR1CL2|AKRDC1|LoopADR|TAKR|hTSP|htAKR
Cytomap

10p15.1

10p15.1

Type of geneprotein-codingprotein-coding
Descriptionaldo-keto reductase family 1 member C33-alpha hydroxysteroid dehydrogenase, type II3-alpha-HSD type II, brainchlordecone reductase homolog HAKRbdihydrodiol dehydrogenase 3dihydrodiol dehydrogenase Xindanol dehydrogenaseprostaglandin F synthasetest1,5-anhydro-D-fructose reductaseAF reductasealdo-keto reductase family 1 member C-like protein 2aldo-keto reductase family 1, member C-like 2aldo-keto reductase loopADRtestis aldo-keto reductasetestis-specific protein
Modification date2018052720180523
UniProtAcc

P42330

Q96JD6

Ensembl transtripts involved in fusion geneENST00000470862, ENST00000605149, 
ENST00000439082, ENST00000380554, 
ENST00000298375, ENST00000525281, 
ENST00000532248, ENST00000334019, 
ENST00000345253, 
Fusion gene scores* DoF score2 X 3 X 2=125 X 2 X 5=50
# samples 36
** MAII scorelog2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(6/50*10)=0.263034405833794
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: AKR1C3 [Title/Abstract] AND AKR1E2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneAKR1C3

GO:0000060

protein import into nucleus, translocation

21787718

HgeneAKR1C3

GO:0007186

G-protein coupled receptor signaling pathway

18508192

HgeneAKR1C3

GO:0008284

positive regulation of cell proliferation

18508192|20036328

HgeneAKR1C3

GO:0010942

positive regulation of cell death

21787718

HgeneAKR1C3

GO:0016488

farnesol catabolic process

21187079

HgeneAKR1C3

GO:0034614

cellular response to reactive oxygen species

21787718

HgeneAKR1C3

GO:0042448

progesterone metabolic process

21232532

HgeneAKR1C3

GO:0042574

retinal metabolic process

21851338

HgeneAKR1C3

GO:0048385

regulation of retinoic acid receptor signaling pathway

21851338

HgeneAKR1C3

GO:0051897

positive regulation of protein kinase B signaling

18508192

HgeneAKR1C3

GO:0055114

oxidation-reduction process

16983398|19442656|21232532

HgeneAKR1C3

GO:0071276

cellular response to cadmium ion

21787718

HgeneAKR1C3

GO:0071277

cellular response to calcium ion

22170488

HgeneAKR1C3

GO:0071379

cellular response to prostaglandin stimulus

22170488

HgeneAKR1C3

GO:0071384

cellular response to corticosteroid stimulus

19336506

HgeneAKR1C3

GO:0071395

cellular response to jasmonic acid stimulus

19487289

HgeneAKR1C3

GO:0071799

cellular response to prostaglandin D stimulus

18508192

HgeneAKR1C3

GO:1900053

negative regulation of retinoic acid biosynthetic process

21851338

HgeneAKR1C3

GO:2000353

positive regulation of endothelial cell apoptotic process

19442656

HgeneAKR1C3

GO:2000379

positive regulation of reactive oxygen species metabolic process

19442656

TgeneAKR1E2

GO:0055114

oxidation-reduction process

15118078


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-66-2759-01AAKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
TCGALDLUSCTCGA-68-A59J-01AAKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000470862ENST00000298375AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
intron-3UTRENST00000470862ENST00000525281AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
intron-3UTRENST00000470862ENST00000532248AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
intron-3UTRENST00000470862ENST00000334019AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
intron-3UTRENST00000470862ENST00000345253AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
In-frameENST00000605149ENST00000298375AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
5CDS-3UTRENST00000605149ENST00000525281AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
5CDS-3UTRENST00000605149ENST00000532248AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
5CDS-3UTRENST00000605149ENST00000334019AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
5CDS-3UTRENST00000605149ENST00000345253AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
In-frameENST00000439082ENST00000298375AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
5CDS-3UTRENST00000439082ENST00000525281AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
5CDS-3UTRENST00000439082ENST00000532248AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
5CDS-3UTRENST00000439082ENST00000334019AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
5CDS-3UTRENST00000439082ENST00000345253AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
In-frameENST00000380554ENST00000298375AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
5CDS-3UTRENST00000380554ENST00000525281AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
5CDS-3UTRENST00000380554ENST00000532248AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
5CDS-3UTRENST00000380554ENST00000334019AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
5CDS-3UTRENST00000380554ENST00000345253AKR1C3chr10

5144842

+AKR1E2chr10

4877867

+
intron-3CDSENST00000470862ENST00000298375AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
intron-3UTRENST00000470862ENST00000525281AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
intron-3UTRENST00000470862ENST00000532248AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
intron-3UTRENST00000470862ENST00000334019AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
intron-3UTRENST00000470862ENST00000345253AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
In-frameENST00000605149ENST00000298375AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
5CDS-3UTRENST00000605149ENST00000525281AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
5CDS-3UTRENST00000605149ENST00000532248AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
5CDS-3UTRENST00000605149ENST00000334019AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
5CDS-3UTRENST00000605149ENST00000345253AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
In-frameENST00000439082ENST00000298375AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
5CDS-3UTRENST00000439082ENST00000525281AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
5CDS-3UTRENST00000439082ENST00000532248AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
5CDS-3UTRENST00000439082ENST00000334019AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
5CDS-3UTRENST00000439082ENST00000345253AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
In-frameENST00000380554ENST00000298375AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
5CDS-3UTRENST00000380554ENST00000525281AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
5CDS-3UTRENST00000380554ENST00000532248AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
5CDS-3UTRENST00000380554ENST00000334019AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+
5CDS-3UTRENST00000380554ENST00000345253AKR1C3chr10

5139742

+AKR1E2chr10

4872867

+

Top

FusionProtFeatures for AKR1C3_AKR1E2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AKR1C3

P42330

AKR1E2

Q96JD6

Catalyzes the NADPH-dependent reduction of 1,5-anhydro-D-fructose (AF) to 1,5-anhydro-D-glucitol (By similarity). Has lowNADPH-dependent reductase activity towards 9,10-phenanthrenequinone (in vitro) (PubMed:12604216, PubMed:15118078).{ECO:0000250|UniProtKB:Q9DCT1, ECO:0000269|PubMed:12604216,ECO:0000269|PubMed:15118078}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for AKR1C3_AKR1E2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AKR1C3_ENST00000605149_chr10_5144842_+_AKR1E2_ENST00000298375_chr10_4877867_+_472aa
MQISQVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDTVDL
TLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPTFNRSKLL
DFCKSKDIVLVATSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQPPHPEWIMSCS
ELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPTLTQKNLISF
CQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRN

>In-frame_AKR1C3_ENST00000439082_chr10_5144842_+_AKR1E2_ENST00000298375_chr10_4877867_+_376aa
MSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPTFNRSKLLDFCKSK
DIVLVATSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQPPHPEWIMSCSELSFCL
SHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPTLTQKNLISFCQSRDV
SVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMF

>In-frame_AKR1C3_ENST00000380554_chr10_5144842_+_AKR1E2_ENST00000298375_chr10_4877867_+_495aa
MDSKHQCVKLNDGHFMPVLGFGTTAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFH
RPELVRPALENSLKKAQLDTVDLTLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPTFNRSKLLDFCKSKDIVLVATSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAK
SYNEQRIRQNVQPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGL
RFKPLTNQIECHPTLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKE

>In-frame_AKR1C3_ENST00000605149_chr10_5139742_+_AKR1E2_ENST00000298375_chr10_4872867_+_408aa
MQISQVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDTVDL
TLIHSPMSLKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKL
NTLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNK
PGLRFKPLTNQIECHPTLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSH

>In-frame_AKR1C3_ENST00000439082_chr10_5139742_+_AKR1E2_ENST00000298375_chr10_4872867_+_312aa
MSLKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNTLDLY
LIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFK
PLTNQIECHPTLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQ

>In-frame_AKR1C3_ENST00000380554_chr10_5139742_+_AKR1E2_ENST00000298375_chr10_4872867_+_431aa
MDSKHQCVKLNDGHFMPVLGFGTTAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFH
RPELVRPALENSLKKAQLDTVDLTLIHSPMSLKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKL
WCTCHKKSLVETACRKSLKALKLNTLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVI
TGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPTLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AKR1C3_ENST00000605149_chr10_5144842_+_AKR1E2_ENST00000298375_chr10_4877867_+_1416nt
ATGCAAATATCACAGGTTCCGAGAAGTAAAGCTTTGGAGGTCACAAAATTAGCAATAGAAGCTGGGTTCCGCCATATAGATTCTGCTCAT
TTATACAATAATGAGGAGCAGGTTGGACTGGCCATCCGAAGCAAGATTGCAGATGGCAGTGTGAAGAGAGAAGACATATTCTACACTTCA
AAGCTTTGGTCCACTTTTCATCGACCAGAGTTGGTCCGACCAGCCTTGGAAAACTCACTGAAGAAAGCTCAATTGGACTATGTTGACCTC
TATCTTATTCATTCTCCAATGTCTCTAAAGCCAGGTGAGGAACTTTCACCAACAGATGAAAATGGAAAAGTAATATTTGACATAGTGGAT
CTCTGTACCACCTGGGAGGCCATGGAGAAGTGTAAGGATGCAGGATTGGCCAAGTCCATTGGGGTGTCAAACTTCAACCGCAGGCAGCTG
GAGATGATCCTCAACAAGCCAGGACTCAAGTACAAGCCTGTCTGCAACCAGGTAGAATGTCATCCGTATTTCAACCGGAGTAAATTGCTA
GATTTCTGCAAGTCGAAAGATATTGTTCTGGTTGCCTATAGTGCTCTGGGATCTCAACGAGACAAACGATGGGTGGACCCGAACTCCCCG
GTGCTCTTGGAGGACCCAGTCCTTTGTGCCTTGGCAAAAAAGCACAAGCGAACCCCAGCCCTGATTGCCCTGCGCTACCAGCTGCAGCGT
GGGGTTGTGGTCCTGGCCAAGAGCTACAATGAGCAGCGCATCAGACAGAACGTGCAGCCTCCTCATCCAGAATGGATCATGAGCTGCAGT
GAACTTTCCTTCTGCCTCTCACATCCTCGAGTGCAGGACTTGCCTCTGGACGAGAGCAACATGGTTATTCCCAGTGACACGGACTTCCTG
GACACGTGGGAGGCCATGGAGGACCTGGTGATCACCGGGCTGGTGAAGAACATCGGGGTGTCAAACTTCAACCATGAACAGCTTGAGAGG
CTTTTGAATAAGCCTGGGTTGAGGTTCAAGCCACTAACCAACCAGATTGAGTGCCACCCATATCTTACTCAGAAGAATCTGATCAGTTTT
TGCCAATCCAGAGATGTGTCCGTGACTGCTTACCGTCCTCTTGGTGGCTCGTGTGAGGGGGTTGACCTGATAGACAACCCTGTGATCAAG
AGGATTGCAAAGGAGCACGGCAAGTCTCCTGCTCAGATTTTGATCCGATTTCAAATCCAGAGGAATGTGATAGTGATCCCCGGATCTATC
ACCCCAAGTCACATTAAAGAGAATATCCAGGTGTTTGATTTTGAATTAACACAGCACGATATGGATAACATCCTCAGCCTAAACAGGAAT

>In-frame_AKR1C3_ENST00000439082_chr10_5144842_+_AKR1E2_ENST00000298375_chr10_4877867_+_1128nt
ATGTCTCTAAAGCCAGGTGAGGAACTTTCACCAACAGATGAAAATGGAAAAGTAATATTTGACATAGTGGATCTCTGTACCACCTGGGAG
GCCATGGAGAAGTGTAAGGATGCAGGATTGGCCAAGTCCATTGGGGTGTCAAACTTCAACCGCAGGCAGCTGGAGATGATCCTCAACAAG
CCAGGACTCAAGTACAAGCCTGTCTGCAACCAGGTAGAATGTCATCCGTATTTCAACCGGAGTAAATTGCTAGATTTCTGCAAGTCGAAA
GATATTGTTCTGGTTGCCTATAGTGCTCTGGGATCTCAACGAGACAAACGATGGGTGGACCCGAACTCCCCGGTGCTCTTGGAGGACCCA
GTCCTTTGTGCCTTGGCAAAAAAGCACAAGCGAACCCCAGCCCTGATTGCCCTGCGCTACCAGCTGCAGCGTGGGGTTGTGGTCCTGGCC
AAGAGCTACAATGAGCAGCGCATCAGACAGAACGTGCAGCCTCCTCATCCAGAATGGATCATGAGCTGCAGTGAACTTTCCTTCTGCCTC
TCACATCCTCGAGTGCAGGACTTGCCTCTGGACGAGAGCAACATGGTTATTCCCAGTGACACGGACTTCCTGGACACGTGGGAGGCCATG
GAGGACCTGGTGATCACCGGGCTGGTGAAGAACATCGGGGTGTCAAACTTCAACCATGAACAGCTTGAGAGGCTTTTGAATAAGCCTGGG
TTGAGGTTCAAGCCACTAACCAACCAGATTGAGTGCCACCCATATCTTACTCAGAAGAATCTGATCAGTTTTTGCCAATCCAGAGATGTG
TCCGTGACTGCTTACCGTCCTCTTGGTGGCTCGTGTGAGGGGGTTGACCTGATAGACAACCCTGTGATCAAGAGGATTGCAAAGGAGCAC
GGCAAGTCTCCTGCTCAGATTTTGATCCGATTTCAAATCCAGAGGAATGTGATAGTGATCCCCGGATCTATCACCCCAAGTCACATTAAA
GAGAATATCCAGGTGTTTGATTTTGAATTAACACAGCACGATATGGATAACATCCTCAGCCTAAACAGGAATCTCCGACTGGCCATGTTC

>In-frame_AKR1C3_ENST00000380554_chr10_5144842_+_AKR1E2_ENST00000298375_chr10_4877867_+_1485nt
ATGGATTCCAAACACCAGTGTGTAAAGCTAAATGATGGCCACTTCATGCCTGTATTGGGATTTGGCACCTATGCACCTCCAGAGGTTCCG
AGAAGTAAAGCTTTGGAGGTCACAAAATTAGCAATAGAAGCTGGGTTCCGCCATATAGATTCTGCTCATTTATACAATAATGAGGAGCAG
GTTGGACTGGCCATCCGAAGCAAGATTGCAGATGGCAGTGTGAAGAGAGAAGACATATTCTACACTTCAAAGCTTTGGTCCACTTTTCAT
CGACCAGAGTTGGTCCGACCAGCCTTGGAAAACTCACTGAAGAAAGCTCAATTGGACTATGTTGACCTCTATCTTATTCATTCTCCAATG
TCTCTAAAGCCAGGTGAGGAACTTTCACCAACAGATGAAAATGGAAAAGTAATATTTGACATAGTGGATCTCTGTACCACCTGGGAGGCC
ATGGAGAAGTGTAAGGATGCAGGATTGGCCAAGTCCATTGGGGTGTCAAACTTCAACCGCAGGCAGCTGGAGATGATCCTCAACAAGCCA
GGACTCAAGTACAAGCCTGTCTGCAACCAGGTAGAATGTCATCCGTATTTCAACCGGAGTAAATTGCTAGATTTCTGCAAGTCGAAAGAT
ATTGTTCTGGTTGCCTATAGTGCTCTGGGATCTCAACGAGACAAACGATGGGTGGACCCGAACTCCCCGGTGCTCTTGGAGGACCCAGTC
CTTTGTGCCTTGGCAAAAAAGCACAAGCGAACCCCAGCCCTGATTGCCCTGCGCTACCAGCTGCAGCGTGGGGTTGTGGTCCTGGCCAAG
AGCTACAATGAGCAGCGCATCAGACAGAACGTGCAGCCTCCTCATCCAGAATGGATCATGAGCTGCAGTGAACTTTCCTTCTGCCTCTCA
CATCCTCGAGTGCAGGACTTGCCTCTGGACGAGAGCAACATGGTTATTCCCAGTGACACGGACTTCCTGGACACGTGGGAGGCCATGGAG
GACCTGGTGATCACCGGGCTGGTGAAGAACATCGGGGTGTCAAACTTCAACCATGAACAGCTTGAGAGGCTTTTGAATAAGCCTGGGTTG
AGGTTCAAGCCACTAACCAACCAGATTGAGTGCCACCCATATCTTACTCAGAAGAATCTGATCAGTTTTTGCCAATCCAGAGATGTGTCC
GTGACTGCTTACCGTCCTCTTGGTGGCTCGTGTGAGGGGGTTGACCTGATAGACAACCCTGTGATCAAGAGGATTGCAAAGGAGCACGGC
AAGTCTCCTGCTCAGATTTTGATCCGATTTCAAATCCAGAGGAATGTGATAGTGATCCCCGGATCTATCACCCCAAGTCACATTAAAGAG
AATATCCAGGTGTTTGATTTTGAATTAACACAGCACGATATGGATAACATCCTCAGCCTAAACAGGAATCTCCGACTGGCCATGTTCCCC

>In-frame_AKR1C3_ENST00000605149_chr10_5139742_+_AKR1E2_ENST00000298375_chr10_4872867_+_1224nt
ATGCAAATATCACAGGTTCCGAGAAGTAAAGCTTTGGAGGTCACAAAATTAGCAATAGAAGCTGGGTTCCGCCATATAGATTCTGCTCAT
TTATACAATAATGAGGAGCAGGTTGGACTGGCCATCCGAAGCAAGATTGCAGATGGCAGTGTGAAGAGAGAAGACATATTCTACACTTCA
AAGCTTTGGTCCACTTTTCATCGACCAGAGTTGGTCCGACCAGCCTTGGAAAACTCACTGAAGAAAGCTCAATTGGACTATGTTGACCTC
TATCTTATTCATTCTCCAATGTCTCTAAAGGCTTCTCCAGGGAAAGTGACCGAGGCAGTGAAAGAGGCCATTGACGCAGGGTACCGGCAC
TTCGACTGTGCTTACTTTTACCACAATGAGAGGGAGGTTGGAGCAGGGATCCGTTGCAAGATCAAGGAAGGCGCTGTAAGACGGGAGGAT
CTGTTCATTGCCACTAAGCTGTGGTGCACCTGCCATAAGAAGTCCTTGGTGGAAACAGCATGCAGAAAGAGTCTCAAGGCCTTGAAGCTG
AACTATTTGGACCTCTACCTCATACACTGGCCCATGGGTTTCAAGCCTCCTCATCCAGAATGGATCATGAGCTGCAGTGAACTTTCCTTC
TGCCTCTCACATCCTCGAGTGCAGGACTTGCCTCTGGACGAGAGCAACATGGTTATTCCCAGTGACACGGACTTCCTGGACACGTGGGAG
GCCATGGAGGACCTGGTGATCACCGGGCTGGTGAAGAACATCGGGGTGTCAAACTTCAACCATGAACAGCTTGAGAGGCTTTTGAATAAG
CCTGGGTTGAGGTTCAAGCCACTAACCAACCAGATTGAGTGCCACCCATATCTTACTCAGAAGAATCTGATCAGTTTTTGCCAATCCAGA
GATGTGTCCGTGACTGCTTACCGTCCTCTTGGTGGCTCGTGTGAGGGGGTTGACCTGATAGACAACCCTGTGATCAAGAGGATTGCAAAG
GAGCACGGCAAGTCTCCTGCTCAGATTTTGATCCGATTTCAAATCCAGAGGAATGTGATAGTGATCCCCGGATCTATCACCCCAAGTCAC
ATTAAAGAGAATATCCAGGTGTTTGATTTTGAATTAACACAGCACGATATGGATAACATCCTCAGCCTAAACAGGAATCTCCGACTGGCC

>In-frame_AKR1C3_ENST00000439082_chr10_5139742_+_AKR1E2_ENST00000298375_chr10_4872867_+_936nt
ATGTCTCTAAAGGCTTCTCCAGGGAAAGTGACCGAGGCAGTGAAAGAGGCCATTGACGCAGGGTACCGGCACTTCGACTGTGCTTACTTT
TACCACAATGAGAGGGAGGTTGGAGCAGGGATCCGTTGCAAGATCAAGGAAGGCGCTGTAAGACGGGAGGATCTGTTCATTGCCACTAAG
CTGTGGTGCACCTGCCATAAGAAGTCCTTGGTGGAAACAGCATGCAGAAAGAGTCTCAAGGCCTTGAAGCTGAACTATTTGGACCTCTAC
CTCATACACTGGCCCATGGGTTTCAAGCCTCCTCATCCAGAATGGATCATGAGCTGCAGTGAACTTTCCTTCTGCCTCTCACATCCTCGA
GTGCAGGACTTGCCTCTGGACGAGAGCAACATGGTTATTCCCAGTGACACGGACTTCCTGGACACGTGGGAGGCCATGGAGGACCTGGTG
ATCACCGGGCTGGTGAAGAACATCGGGGTGTCAAACTTCAACCATGAACAGCTTGAGAGGCTTTTGAATAAGCCTGGGTTGAGGTTCAAG
CCACTAACCAACCAGATTGAGTGCCACCCATATCTTACTCAGAAGAATCTGATCAGTTTTTGCCAATCCAGAGATGTGTCCGTGACTGCT
TACCGTCCTCTTGGTGGCTCGTGTGAGGGGGTTGACCTGATAGACAACCCTGTGATCAAGAGGATTGCAAAGGAGCACGGCAAGTCTCCT
GCTCAGATTTTGATCCGATTTCAAATCCAGAGGAATGTGATAGTGATCCCCGGATCTATCACCCCAAGTCACATTAAAGAGAATATCCAG
GTGTTTGATTTTGAATTAACACAGCACGATATGGATAACATCCTCAGCCTAAACAGGAATCTCCGACTGGCCATGTTCCCCATAACTAAA

>In-frame_AKR1C3_ENST00000380554_chr10_5139742_+_AKR1E2_ENST00000298375_chr10_4872867_+_1293nt
ATGGATTCCAAACACCAGTGTGTAAAGCTAAATGATGGCCACTTCATGCCTGTATTGGGATTTGGCACCTATGCACCTCCAGAGGTTCCG
AGAAGTAAAGCTTTGGAGGTCACAAAATTAGCAATAGAAGCTGGGTTCCGCCATATAGATTCTGCTCATTTATACAATAATGAGGAGCAG
GTTGGACTGGCCATCCGAAGCAAGATTGCAGATGGCAGTGTGAAGAGAGAAGACATATTCTACACTTCAAAGCTTTGGTCCACTTTTCAT
CGACCAGAGTTGGTCCGACCAGCCTTGGAAAACTCACTGAAGAAAGCTCAATTGGACTATGTTGACCTCTATCTTATTCATTCTCCAATG
TCTCTAAAGGCTTCTCCAGGGAAAGTGACCGAGGCAGTGAAAGAGGCCATTGACGCAGGGTACCGGCACTTCGACTGTGCTTACTTTTAC
CACAATGAGAGGGAGGTTGGAGCAGGGATCCGTTGCAAGATCAAGGAAGGCGCTGTAAGACGGGAGGATCTGTTCATTGCCACTAAGCTG
TGGTGCACCTGCCATAAGAAGTCCTTGGTGGAAACAGCATGCAGAAAGAGTCTCAAGGCCTTGAAGCTGAACTATTTGGACCTCTACCTC
ATACACTGGCCCATGGGTTTCAAGCCTCCTCATCCAGAATGGATCATGAGCTGCAGTGAACTTTCCTTCTGCCTCTCACATCCTCGAGTG
CAGGACTTGCCTCTGGACGAGAGCAACATGGTTATTCCCAGTGACACGGACTTCCTGGACACGTGGGAGGCCATGGAGGACCTGGTGATC
ACCGGGCTGGTGAAGAACATCGGGGTGTCAAACTTCAACCATGAACAGCTTGAGAGGCTTTTGAATAAGCCTGGGTTGAGGTTCAAGCCA
CTAACCAACCAGATTGAGTGCCACCCATATCTTACTCAGAAGAATCTGATCAGTTTTTGCCAATCCAGAGATGTGTCCGTGACTGCTTAC
CGTCCTCTTGGTGGCTCGTGTGAGGGGGTTGACCTGATAGACAACCCTGTGATCAAGAGGATTGCAAAGGAGCACGGCAAGTCTCCTGCT
CAGATTTTGATCCGATTTCAAATCCAGAGGAATGTGATAGTGATCCCCGGATCTATCACCCCAAGTCACATTAAAGAGAATATCCAGGTG
TTTGATTTTGAATTAACACAGCACGATATGGATAACATCCTCAGCCTAAACAGGAATCTCCGACTGGCCATGTTCCCCATAACTAAAAAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_AKR1C3_ENST00000605149_chr10_5144842_+_AKR1E2_ENST00000298375_chr10_4877867_+_2273nt
TTTTTGCTGAACATTCCCCTTAGTAAAATGGCAGGATGGTTTGCTTGCCATTGAAACTAACCAAACATTTAATCCTTTTCCCTTTAGAGA
AAAAAGAAAAAAAAAGGTGCAGCTCACTGCCAGTGCCCATTTAGTTTTACATTAACATGTTCCTTGAGGTTGAAGCAAATCTGACCGATT
TTCAATGTAAAAATAACATATAAAAACTGTTCTCGGAGTTATTTCTAAACAGAACTAAGATCAGAATTCTTTGAATCATCAGAATCATCT
CTTTTGAAAAATCGATTCATCAAATGAATCTTCAGCCAACAACTGTTCAAGAAGGATGCAAATATCACAGGTTCCGAGAAGTAAAGCTTT
GGAGGTCACAAAATTAGCAATAGAAGCTGGGTTCCGCCATATAGATTCTGCTCATTTATACAATAATGAGGAGCAGGTTGGACTGGCCAT
CCGAAGCAAGATTGCAGATGGCAGTGTGAAGAGAGAAGACATATTCTACACTTCAAAGCTTTGGTCCACTTTTCATCGACCAGAGTTGGT
CCGACCAGCCTTGGAAAACTCACTGAAGAAAGCTCAATTGGACTATGTTGACCTCTATCTTATTCATTCTCCAATGTCTCTAAAGCCAGG
TGAGGAACTTTCACCAACAGATGAAAATGGAAAAGTAATATTTGACATAGTGGATCTCTGTACCACCTGGGAGGCCATGGAGAAGTGTAA
GGATGCAGGATTGGCCAAGTCCATTGGGGTGTCAAACTTCAACCGCAGGCAGCTGGAGATGATCCTCAACAAGCCAGGACTCAAGTACAA
GCCTGTCTGCAACCAGGTAGAATGTCATCCGTATTTCAACCGGAGTAAATTGCTAGATTTCTGCAAGTCGAAAGATATTGTTCTGGTTGC
CTATAGTGCTCTGGGATCTCAACGAGACAAACGATGGGTGGACCCGAACTCCCCGGTGCTCTTGGAGGACCCAGTCCTTTGTGCCTTGGC
AAAAAAGCACAAGCGAACCCCAGCCCTGATTGCCCTGCGCTACCAGCTGCAGCGTGGGGTTGTGGTCCTGGCCAAGAGCTACAATGAGCA
GCGCATCAGACAGAACGTGCAGCCTCCTCATCCAGAATGGATCATGAGCTGCAGTGAACTTTCCTTCTGCCTCTCACATCCTCGAGTGCA
GGACTTGCCTCTGGACGAGAGCAACATGGTTATTCCCAGTGACACGGACTTCCTGGACACGTGGGAGGCCATGGAGGACCTGGTGATCAC
CGGGCTGGTGAAGAACATCGGGGTGTCAAACTTCAACCATGAACAGCTTGAGAGGCTTTTGAATAAGCCTGGGTTGAGGTTCAAGCCACT
AACCAACCAGATTGAGTGCCACCCATATCTTACTCAGAAGAATCTGATCAGTTTTTGCCAATCCAGAGATGTGTCCGTGACTGCTTACCG
TCCTCTTGGTGGCTCGTGTGAGGGGGTTGACCTGATAGACAACCCTGTGATCAAGAGGATTGCAAAGGAGCACGGCAAGTCTCCTGCTCA
GATTTTGATCCGATTTCAAATCCAGAGGAATGTGATAGTGATCCCCGGATCTATCACCCCAAGTCACATTAAAGAGAATATCCAGGTGTT
TGATTTTGAATTAACACAGCACGATATGGATAACATCCTCAGCCTAAACAGGAATCTCCGACTGGCCATGTTCCCCATAACTAAAAATCA
CAAAGACTATCCTTTCCACATAGAATACTGAGGACGCTTCCCCTTCCTTGTTTCTGCTCAGCCCAGATGCACAGACACTATTGGCAATGT
TGACCCTCCTCTGTCATCACAGCGCCAGGGCAGCTGTGCCTGGGACAGGAGCCACACAGTCAGAGGGGGATGTAAGAGCCACCTTCTCTG
ACAAATCTGGAGAATTGAGTGTGTTCTAAGTGAAGGCAATGGGGTTTCTCCAAGACAGCCTGTGTGGCCTCTACTCTGAACAAATACACT
GATGAGTCATCAGTGAAATTTGCCTTCACATTTTAAGAAAACTTTATCTTATGGAGTTATTTAAGCCATCTACAGAGCTGAGGAAACAGT
GTAATGTGTCTCTGCCCCATTGCGCAGCTCCACCCATTGTGCCCCAGGCCAGCCCGCGTCACCTACACTTCCTTCTGTGCCCTGCCAGTG
ACCCCCAGGTTATTCTAAAGCAGAGTCCTTCCCTTCCCCCAGTGAGAAGGAAAATGGGATAAGTCTGGGACACTGTTTCAGTTCAATAAA

>In-frame_AKR1C3_ENST00000439082_chr10_5144842_+_AKR1E2_ENST00000298375_chr10_4877867_+_2130nt
AACATGTTCCTTGAGGTTGAAGCAAATCTGACCGATTTTCAATGTAAAAATAACATATAAAAACTGTTCTCGGAGTTATTTCTAAACAGA
ACTAAGATCAGAATTCTTTGAATCATCAGAATCATCTCTTTTGAAAAATCGATTCATCAAATGAATCTTCAGCCAACAACTGTTCAAGAA
GGATGCAAATATCACAGGTTCCGAGAAGTAAAGCTTTGGAGGTCACAAAATTAGCAATAGAAGCTGGGTTCCGCCATATAGATTCTGCTC
ATTTATACAATAATGAGGAGCAGGTTGGACTGGCCATCCGAAGCAAGATTGCAGATGGCAGTGTGAAGAGAGAAGACATATTCTACACTT
CAAAGCTTTGGTCCACTTTTCATCGACCAGAGTTGGTCCGACCAGCCTTGGAAAACTCACTGAAGAAAGCTCAATTGGACTATGTTGACC
TCTATCTTATTCATTCTCCAATGTCTCTAAAGCCAGGTGAGGAACTTTCACCAACAGATGAAAATGGAAAAGTAATATTTGACATAGTGG
ATCTCTGTACCACCTGGGAGGCCATGGAGAAGTGTAAGGATGCAGGATTGGCCAAGTCCATTGGGGTGTCAAACTTCAACCGCAGGCAGC
TGGAGATGATCCTCAACAAGCCAGGACTCAAGTACAAGCCTGTCTGCAACCAGGTAGAATGTCATCCGTATTTCAACCGGAGTAAATTGC
TAGATTTCTGCAAGTCGAAAGATATTGTTCTGGTTGCCTATAGTGCTCTGGGATCTCAACGAGACAAACGATGGGTGGACCCGAACTCCC
CGGTGCTCTTGGAGGACCCAGTCCTTTGTGCCTTGGCAAAAAAGCACAAGCGAACCCCAGCCCTGATTGCCCTGCGCTACCAGCTGCAGC
GTGGGGTTGTGGTCCTGGCCAAGAGCTACAATGAGCAGCGCATCAGACAGAACGTGCAGCCTCCTCATCCAGAATGGATCATGAGCTGCA
GTGAACTTTCCTTCTGCCTCTCACATCCTCGAGTGCAGGACTTGCCTCTGGACGAGAGCAACATGGTTATTCCCAGTGACACGGACTTCC
TGGACACGTGGGAGGCCATGGAGGACCTGGTGATCACCGGGCTGGTGAAGAACATCGGGGTGTCAAACTTCAACCATGAACAGCTTGAGA
GGCTTTTGAATAAGCCTGGGTTGAGGTTCAAGCCACTAACCAACCAGATTGAGTGCCACCCATATCTTACTCAGAAGAATCTGATCAGTT
TTTGCCAATCCAGAGATGTGTCCGTGACTGCTTACCGTCCTCTTGGTGGCTCGTGTGAGGGGGTTGACCTGATAGACAACCCTGTGATCA
AGAGGATTGCAAAGGAGCACGGCAAGTCTCCTGCTCAGATTTTGATCCGATTTCAAATCCAGAGGAATGTGATAGTGATCCCCGGATCTA
TCACCCCAAGTCACATTAAAGAGAATATCCAGGTGTTTGATTTTGAATTAACACAGCACGATATGGATAACATCCTCAGCCTAAACAGGA
ATCTCCGACTGGCCATGTTCCCCATAACTAAAAATCACAAAGACTATCCTTTCCACATAGAATACTGAGGACGCTTCCCCTTCCTTGTTT
CTGCTCAGCCCAGATGCACAGACACTATTGGCAATGTTGACCCTCCTCTGTCATCACAGCGCCAGGGCAGCTGTGCCTGGGACAGGAGCC
ACACAGTCAGAGGGGGATGTAAGAGCCACCTTCTCTGACAAATCTGGAGAATTGAGTGTGTTCTAAGTGAAGGCAATGGGGTTTCTCCAA
GACAGCCTGTGTGGCCTCTACTCTGAACAAATACACTGATGAGTCATCAGTGAAATTTGCCTTCACATTTTAAGAAAACTTTATCTTATG
GAGTTATTTAAGCCATCTACAGAGCTGAGGAAACAGTGTAATGTGTCTCTGCCCCATTGCGCAGCTCCACCCATTGTGCCCCAGGCCAGC
CCGCGTCACCTACACTTCCTTCTGTGCCCTGCCAGTGACCCCCAGGTTATTCTAAAGCAGAGTCCTTCCCTTCCCCCAGTGAGAAGGAAA

>In-frame_AKR1C3_ENST00000380554_chr10_5144842_+_AKR1E2_ENST00000298375_chr10_4877867_+_2669nt
CCCTCATCAGGATTACAGCTTTATCAGGACTGCATCTTCTTCAGAAATGAATATTTCTCTTACAACGCAAAGAAAGAAAAATCAAAATAA
ATTTTCTGATTGAAAATGTAAAAAGGCAAATATTTTTACAGTTTTAACTTTAATTTTTTATTGAGGACCAACTATTTGAAAAATTCTCAT
TAGTCATTCCTTTAAATTATGTGTATGTGAGAGAAAGACGTAAGATGGTTAATTATTTCAAATGATGCAGTATAAAGAAGGGGCATTATC
ACGGCAGAAACGAAAAAAGATATTTGTAGCTGGAGGTTTTTATAGTCTAACATATGGTTGCTATTTGTTCTACAAATCCTTTTGAATAAT
TTAATATAGAGATTTAGAATAGAAAATAATACTTTAGATAGAAATTAATGAGTTTATTATAACCATATATTATAATAATTTACTTAGGAA
TTCTCTTTGATAAGAAACAAATGAACTGAATGCAATTTTCTCCACAGACCATATAAGACTGCCTATGTACCTCCTCCTACATGCCATTGG
TTAACCATCAGTCAGTTTGCAGGGGTGGGGGGAGGGGTTTCCTGCCCATTGTTTTTGTAATCTCTGAGGAGAAGCAGCAGCAAACATTTG
CTAGTCAGACAAGTGACAGGGAATGGATTCCAAACACCAGTGTGTAAAGCTAAATGATGGCCACTTCATGCCTGTATTGGGATTTGGCAC
CTATGCACCTCCAGAGGTTCCGAGAAGTAAAGCTTTGGAGGTCACAAAATTAGCAATAGAAGCTGGGTTCCGCCATATAGATTCTGCTCA
TTTATACAATAATGAGGAGCAGGTTGGACTGGCCATCCGAAGCAAGATTGCAGATGGCAGTGTGAAGAGAGAAGACATATTCTACACTTC
AAAGCTTTGGTCCACTTTTCATCGACCAGAGTTGGTCCGACCAGCCTTGGAAAACTCACTGAAGAAAGCTCAATTGGACTATGTTGACCT
CTATCTTATTCATTCTCCAATGTCTCTAAAGCCAGGTGAGGAACTTTCACCAACAGATGAAAATGGAAAAGTAATATTTGACATAGTGGA
TCTCTGTACCACCTGGGAGGCCATGGAGAAGTGTAAGGATGCAGGATTGGCCAAGTCCATTGGGGTGTCAAACTTCAACCGCAGGCAGCT
GGAGATGATCCTCAACAAGCCAGGACTCAAGTACAAGCCTGTCTGCAACCAGGTAGAATGTCATCCGTATTTCAACCGGAGTAAATTGCT
AGATTTCTGCAAGTCGAAAGATATTGTTCTGGTTGCCTATAGTGCTCTGGGATCTCAACGAGACAAACGATGGGTGGACCCGAACTCCCC
GGTGCTCTTGGAGGACCCAGTCCTTTGTGCCTTGGCAAAAAAGCACAAGCGAACCCCAGCCCTGATTGCCCTGCGCTACCAGCTGCAGCG
TGGGGTTGTGGTCCTGGCCAAGAGCTACAATGAGCAGCGCATCAGACAGAACGTGCAGCCTCCTCATCCAGAATGGATCATGAGCTGCAG
TGAACTTTCCTTCTGCCTCTCACATCCTCGAGTGCAGGACTTGCCTCTGGACGAGAGCAACATGGTTATTCCCAGTGACACGGACTTCCT
GGACACGTGGGAGGCCATGGAGGACCTGGTGATCACCGGGCTGGTGAAGAACATCGGGGTGTCAAACTTCAACCATGAACAGCTTGAGAG
GCTTTTGAATAAGCCTGGGTTGAGGTTCAAGCCACTAACCAACCAGATTGAGTGCCACCCATATCTTACTCAGAAGAATCTGATCAGTTT
TTGCCAATCCAGAGATGTGTCCGTGACTGCTTACCGTCCTCTTGGTGGCTCGTGTGAGGGGGTTGACCTGATAGACAACCCTGTGATCAA
GAGGATTGCAAAGGAGCACGGCAAGTCTCCTGCTCAGATTTTGATCCGATTTCAAATCCAGAGGAATGTGATAGTGATCCCCGGATCTAT
CACCCCAAGTCACATTAAAGAGAATATCCAGGTGTTTGATTTTGAATTAACACAGCACGATATGGATAACATCCTCAGCCTAAACAGGAA
TCTCCGACTGGCCATGTTCCCCATAACTAAAAATCACAAAGACTATCCTTTCCACATAGAATACTGAGGACGCTTCCCCTTCCTTGTTTC
TGCTCAGCCCAGATGCACAGACACTATTGGCAATGTTGACCCTCCTCTGTCATCACAGCGCCAGGGCAGCTGTGCCTGGGACAGGAGCCA
CACAGTCAGAGGGGGATGTAAGAGCCACCTTCTCTGACAAATCTGGAGAATTGAGTGTGTTCTAAGTGAAGGCAATGGGGTTTCTCCAAG
ACAGCCTGTGTGGCCTCTACTCTGAACAAATACACTGATGAGTCATCAGTGAAATTTGCCTTCACATTTTAAGAAAACTTTATCTTATGG
AGTTATTTAAGCCATCTACAGAGCTGAGGAAACAGTGTAATGTGTCTCTGCCCCATTGCGCAGCTCCACCCATTGTGCCCCAGGCCAGCC
CGCGTCACCTACACTTCCTTCTGTGCCCTGCCAGTGACCCCCAGGTTATTCTAAAGCAGAGTCCTTCCCTTCCCCCAGTGAGAAGGAAAA

>In-frame_AKR1C3_ENST00000605149_chr10_5139742_+_AKR1E2_ENST00000298375_chr10_4872867_+_2081nt
TTTTTGCTGAACATTCCCCTTAGTAAAATGGCAGGATGGTTTGCTTGCCATTGAAACTAACCAAACATTTAATCCTTTTCCCTTTAGAGA
AAAAAGAAAAAAAAAGGTGCAGCTCACTGCCAGTGCCCATTTAGTTTTACATTAACATGTTCCTTGAGGTTGAAGCAAATCTGACCGATT
TTCAATGTAAAAATAACATATAAAAACTGTTCTCGGAGTTATTTCTAAACAGAACTAAGATCAGAATTCTTTGAATCATCAGAATCATCT
CTTTTGAAAAATCGATTCATCAAATGAATCTTCAGCCAACAACTGTTCAAGAAGGATGCAAATATCACAGGTTCCGAGAAGTAAAGCTTT
GGAGGTCACAAAATTAGCAATAGAAGCTGGGTTCCGCCATATAGATTCTGCTCATTTATACAATAATGAGGAGCAGGTTGGACTGGCCAT
CCGAAGCAAGATTGCAGATGGCAGTGTGAAGAGAGAAGACATATTCTACACTTCAAAGCTTTGGTCCACTTTTCATCGACCAGAGTTGGT
CCGACCAGCCTTGGAAAACTCACTGAAGAAAGCTCAATTGGACTATGTTGACCTCTATCTTATTCATTCTCCAATGTCTCTAAAGGCTTC
TCCAGGGAAAGTGACCGAGGCAGTGAAAGAGGCCATTGACGCAGGGTACCGGCACTTCGACTGTGCTTACTTTTACCACAATGAGAGGGA
GGTTGGAGCAGGGATCCGTTGCAAGATCAAGGAAGGCGCTGTAAGACGGGAGGATCTGTTCATTGCCACTAAGCTGTGGTGCACCTGCCA
TAAGAAGTCCTTGGTGGAAACAGCATGCAGAAAGAGTCTCAAGGCCTTGAAGCTGAACTATTTGGACCTCTACCTCATACACTGGCCCAT
GGGTTTCAAGCCTCCTCATCCAGAATGGATCATGAGCTGCAGTGAACTTTCCTTCTGCCTCTCACATCCTCGAGTGCAGGACTTGCCTCT
GGACGAGAGCAACATGGTTATTCCCAGTGACACGGACTTCCTGGACACGTGGGAGGCCATGGAGGACCTGGTGATCACCGGGCTGGTGAA
GAACATCGGGGTGTCAAACTTCAACCATGAACAGCTTGAGAGGCTTTTGAATAAGCCTGGGTTGAGGTTCAAGCCACTAACCAACCAGAT
TGAGTGCCACCCATATCTTACTCAGAAGAATCTGATCAGTTTTTGCCAATCCAGAGATGTGTCCGTGACTGCTTACCGTCCTCTTGGTGG
CTCGTGTGAGGGGGTTGACCTGATAGACAACCCTGTGATCAAGAGGATTGCAAAGGAGCACGGCAAGTCTCCTGCTCAGATTTTGATCCG
ATTTCAAATCCAGAGGAATGTGATAGTGATCCCCGGATCTATCACCCCAAGTCACATTAAAGAGAATATCCAGGTGTTTGATTTTGAATT
AACACAGCACGATATGGATAACATCCTCAGCCTAAACAGGAATCTCCGACTGGCCATGTTCCCCATAACTAAAAATCACAAAGACTATCC
TTTCCACATAGAATACTGAGGACGCTTCCCCTTCCTTGTTTCTGCTCAGCCCAGATGCACAGACACTATTGGCAATGTTGACCCTCCTCT
GTCATCACAGCGCCAGGGCAGCTGTGCCTGGGACAGGAGCCACACAGTCAGAGGGGGATGTAAGAGCCACCTTCTCTGACAAATCTGGAG
AATTGAGTGTGTTCTAAGTGAAGGCAATGGGGTTTCTCCAAGACAGCCTGTGTGGCCTCTACTCTGAACAAATACACTGATGAGTCATCA
GTGAAATTTGCCTTCACATTTTAAGAAAACTTTATCTTATGGAGTTATTTAAGCCATCTACAGAGCTGAGGAAACAGTGTAATGTGTCTC
TGCCCCATTGCGCAGCTCCACCCATTGTGCCCCAGGCCAGCCCGCGTCACCTACACTTCCTTCTGTGCCCTGCCAGTGACCCCCAGGTTA
TTCTAAAGCAGAGTCCTTCCCTTCCCCCAGTGAGAAGGAAAATGGGATAAGTCTGGGACACTGTTTCAGTTCAATAAAGAGGCTTTTTTC

>In-frame_AKR1C3_ENST00000439082_chr10_5139742_+_AKR1E2_ENST00000298375_chr10_4872867_+_1938nt
AACATGTTCCTTGAGGTTGAAGCAAATCTGACCGATTTTCAATGTAAAAATAACATATAAAAACTGTTCTCGGAGTTATTTCTAAACAGA
ACTAAGATCAGAATTCTTTGAATCATCAGAATCATCTCTTTTGAAAAATCGATTCATCAAATGAATCTTCAGCCAACAACTGTTCAAGAA
GGATGCAAATATCACAGGTTCCGAGAAGTAAAGCTTTGGAGGTCACAAAATTAGCAATAGAAGCTGGGTTCCGCCATATAGATTCTGCTC
ATTTATACAATAATGAGGAGCAGGTTGGACTGGCCATCCGAAGCAAGATTGCAGATGGCAGTGTGAAGAGAGAAGACATATTCTACACTT
CAAAGCTTTGGTCCACTTTTCATCGACCAGAGTTGGTCCGACCAGCCTTGGAAAACTCACTGAAGAAAGCTCAATTGGACTATGTTGACC
TCTATCTTATTCATTCTCCAATGTCTCTAAAGGCTTCTCCAGGGAAAGTGACCGAGGCAGTGAAAGAGGCCATTGACGCAGGGTACCGGC
ACTTCGACTGTGCTTACTTTTACCACAATGAGAGGGAGGTTGGAGCAGGGATCCGTTGCAAGATCAAGGAAGGCGCTGTAAGACGGGAGG
ATCTGTTCATTGCCACTAAGCTGTGGTGCACCTGCCATAAGAAGTCCTTGGTGGAAACAGCATGCAGAAAGAGTCTCAAGGCCTTGAAGC
TGAACTATTTGGACCTCTACCTCATACACTGGCCCATGGGTTTCAAGCCTCCTCATCCAGAATGGATCATGAGCTGCAGTGAACTTTCCT
TCTGCCTCTCACATCCTCGAGTGCAGGACTTGCCTCTGGACGAGAGCAACATGGTTATTCCCAGTGACACGGACTTCCTGGACACGTGGG
AGGCCATGGAGGACCTGGTGATCACCGGGCTGGTGAAGAACATCGGGGTGTCAAACTTCAACCATGAACAGCTTGAGAGGCTTTTGAATA
AGCCTGGGTTGAGGTTCAAGCCACTAACCAACCAGATTGAGTGCCACCCATATCTTACTCAGAAGAATCTGATCAGTTTTTGCCAATCCA
GAGATGTGTCCGTGACTGCTTACCGTCCTCTTGGTGGCTCGTGTGAGGGGGTTGACCTGATAGACAACCCTGTGATCAAGAGGATTGCAA
AGGAGCACGGCAAGTCTCCTGCTCAGATTTTGATCCGATTTCAAATCCAGAGGAATGTGATAGTGATCCCCGGATCTATCACCCCAAGTC
ACATTAAAGAGAATATCCAGGTGTTTGATTTTGAATTAACACAGCACGATATGGATAACATCCTCAGCCTAAACAGGAATCTCCGACTGG
CCATGTTCCCCATAACTAAAAATCACAAAGACTATCCTTTCCACATAGAATACTGAGGACGCTTCCCCTTCCTTGTTTCTGCTCAGCCCA
GATGCACAGACACTATTGGCAATGTTGACCCTCCTCTGTCATCACAGCGCCAGGGCAGCTGTGCCTGGGACAGGAGCCACACAGTCAGAG
GGGGATGTAAGAGCCACCTTCTCTGACAAATCTGGAGAATTGAGTGTGTTCTAAGTGAAGGCAATGGGGTTTCTCCAAGACAGCCTGTGT
GGCCTCTACTCTGAACAAATACACTGATGAGTCATCAGTGAAATTTGCCTTCACATTTTAAGAAAACTTTATCTTATGGAGTTATTTAAG
CCATCTACAGAGCTGAGGAAACAGTGTAATGTGTCTCTGCCCCATTGCGCAGCTCCACCCATTGTGCCCCAGGCCAGCCCGCGTCACCTA
CACTTCCTTCTGTGCCCTGCCAGTGACCCCCAGGTTATTCTAAAGCAGAGTCCTTCCCTTCCCCCAGTGAGAAGGAAAATGGGATAAGTC

>In-frame_AKR1C3_ENST00000380554_chr10_5139742_+_AKR1E2_ENST00000298375_chr10_4872867_+_2477nt
CCCTCATCAGGATTACAGCTTTATCAGGACTGCATCTTCTTCAGAAATGAATATTTCTCTTACAACGCAAAGAAAGAAAAATCAAAATAA
ATTTTCTGATTGAAAATGTAAAAAGGCAAATATTTTTACAGTTTTAACTTTAATTTTTTATTGAGGACCAACTATTTGAAAAATTCTCAT
TAGTCATTCCTTTAAATTATGTGTATGTGAGAGAAAGACGTAAGATGGTTAATTATTTCAAATGATGCAGTATAAAGAAGGGGCATTATC
ACGGCAGAAACGAAAAAAGATATTTGTAGCTGGAGGTTTTTATAGTCTAACATATGGTTGCTATTTGTTCTACAAATCCTTTTGAATAAT
TTAATATAGAGATTTAGAATAGAAAATAATACTTTAGATAGAAATTAATGAGTTTATTATAACCATATATTATAATAATTTACTTAGGAA
TTCTCTTTGATAAGAAACAAATGAACTGAATGCAATTTTCTCCACAGACCATATAAGACTGCCTATGTACCTCCTCCTACATGCCATTGG
TTAACCATCAGTCAGTTTGCAGGGGTGGGGGGAGGGGTTTCCTGCCCATTGTTTTTGTAATCTCTGAGGAGAAGCAGCAGCAAACATTTG
CTAGTCAGACAAGTGACAGGGAATGGATTCCAAACACCAGTGTGTAAAGCTAAATGATGGCCACTTCATGCCTGTATTGGGATTTGGCAC
CTATGCACCTCCAGAGGTTCCGAGAAGTAAAGCTTTGGAGGTCACAAAATTAGCAATAGAAGCTGGGTTCCGCCATATAGATTCTGCTCA
TTTATACAATAATGAGGAGCAGGTTGGACTGGCCATCCGAAGCAAGATTGCAGATGGCAGTGTGAAGAGAGAAGACATATTCTACACTTC
AAAGCTTTGGTCCACTTTTCATCGACCAGAGTTGGTCCGACCAGCCTTGGAAAACTCACTGAAGAAAGCTCAATTGGACTATGTTGACCT
CTATCTTATTCATTCTCCAATGTCTCTAAAGGCTTCTCCAGGGAAAGTGACCGAGGCAGTGAAAGAGGCCATTGACGCAGGGTACCGGCA
CTTCGACTGTGCTTACTTTTACCACAATGAGAGGGAGGTTGGAGCAGGGATCCGTTGCAAGATCAAGGAAGGCGCTGTAAGACGGGAGGA
TCTGTTCATTGCCACTAAGCTGTGGTGCACCTGCCATAAGAAGTCCTTGGTGGAAACAGCATGCAGAAAGAGTCTCAAGGCCTTGAAGCT
GAACTATTTGGACCTCTACCTCATACACTGGCCCATGGGTTTCAAGCCTCCTCATCCAGAATGGATCATGAGCTGCAGTGAACTTTCCTT
CTGCCTCTCACATCCTCGAGTGCAGGACTTGCCTCTGGACGAGAGCAACATGGTTATTCCCAGTGACACGGACTTCCTGGACACGTGGGA
GGCCATGGAGGACCTGGTGATCACCGGGCTGGTGAAGAACATCGGGGTGTCAAACTTCAACCATGAACAGCTTGAGAGGCTTTTGAATAA
GCCTGGGTTGAGGTTCAAGCCACTAACCAACCAGATTGAGTGCCACCCATATCTTACTCAGAAGAATCTGATCAGTTTTTGCCAATCCAG
AGATGTGTCCGTGACTGCTTACCGTCCTCTTGGTGGCTCGTGTGAGGGGGTTGACCTGATAGACAACCCTGTGATCAAGAGGATTGCAAA
GGAGCACGGCAAGTCTCCTGCTCAGATTTTGATCCGATTTCAAATCCAGAGGAATGTGATAGTGATCCCCGGATCTATCACCCCAAGTCA
CATTAAAGAGAATATCCAGGTGTTTGATTTTGAATTAACACAGCACGATATGGATAACATCCTCAGCCTAAACAGGAATCTCCGACTGGC
CATGTTCCCCATAACTAAAAATCACAAAGACTATCCTTTCCACATAGAATACTGAGGACGCTTCCCCTTCCTTGTTTCTGCTCAGCCCAG
ATGCACAGACACTATTGGCAATGTTGACCCTCCTCTGTCATCACAGCGCCAGGGCAGCTGTGCCTGGGACAGGAGCCACACAGTCAGAGG
GGGATGTAAGAGCCACCTTCTCTGACAAATCTGGAGAATTGAGTGTGTTCTAAGTGAAGGCAATGGGGTTTCTCCAAGACAGCCTGTGTG
GCCTCTACTCTGAACAAATACACTGATGAGTCATCAGTGAAATTTGCCTTCACATTTTAAGAAAACTTTATCTTATGGAGTTATTTAAGC
CATCTACAGAGCTGAGGAAACAGTGTAATGTGTCTCTGCCCCATTGCGCAGCTCCACCCATTGTGCCCCAGGCCAGCCCGCGTCACCTAC
ACTTCCTTCTGTGCCCTGCCAGTGACCCCCAGGTTATTCTAAAGCAGAGTCCTTCCCTTCCCCCAGTGAGAAGGAAAATGGGATAAGTCT


Top

FusionGenePPI for AKR1C3_AKR1E2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AKR1C3MAGEA11, UBE2W, ZHX1, LRIF1, AKR1C2, AKR1C4, AKR1C1, AKR1D1, SIAH2AKR1E2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AKR1C3_AKR1E2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneAKR1C3P42330DB00328IndomethacinAldo-keto reductase family 1 member C3small moleculeapproved|investigational
HgeneAKR1C3P42330DB00905BimatoprostAldo-keto reductase family 1 member C3small moleculeapproved|investigational

Top

RelatedDiseases for AKR1C3_AKR1E2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneAKR1C3C0032460Polycystic Ovary Syndrome3CTD_human
HgeneAKR1C3C0001973Alcoholic Intoxication, Chronic2PSYGENET
HgeneAKR1C3C0014175Endometriosis2CTD_human
HgeneAKR1C3C0033578Prostatic Neoplasms2CTD_human
HgeneAKR1C3C0005586Bipolar Disorder1PSYGENET
HgeneAKR1C3C0007621Neoplastic Cell Transformation1CTD_human
HgeneAKR1C3C0014170Endometrial Neoplasms1CTD_human
HgeneAKR1C3C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneAKR1C3C0027661Neoplasms, Hormone-Dependent1CTD_human
HgeneAKR1C3C0028754Obesity1CTD_human
HgeneAKR1C3C0036875Disorders of Sex Development1CTD_human
HgeneAKR1C3C0038356Stomach Neoplasms1CTD_human
HgeneAKR1C3C0338831Manic1PSYGENET
HgeneAKR1C3C0564408Manic mood1PSYGENET
HgeneAKR1C3C3658267Prostatic Neoplasms, Castration-Resistant1CTD_human