FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13927

FusionGeneSummary for FRS2_AHCYL2

check button Fusion gene summary
Fusion gene informationFusion gene name: FRS2_AHCYL2
Fusion gene ID: 13927
HgeneTgene
Gene symbol

FRS2

AHCYL2

Gene ID

10818

23382

Gene namefibroblast growth factor receptor substrate 2adenosylhomocysteinase like 2
SynonymsFRS1A|FRS2A|FRS2alpha|SNT|SNT-1|SNT1ADOHCYASE3|IRBIT2
Cytomap

12q15

7q32.1

Type of geneprotein-codingprotein-coding
Descriptionfibroblast growth factor receptor substrate 2FGFR signalling adaptorFGFR substrate 2FGFR-signaling adaptor SNTsuc1-associated neurotrophic factor target 1adenosylhomocysteinase 3IP(3)Rs binding protein released with IP(3) 2S-adenosyl-L-homocysteine hydrolase 3S-adenosylhomocysteine hydrolase-like 2long-IRBITputative adenosylhomocysteinase 3
Modification date2018052220180523
UniProtAcc

Q8WU20

Q96HN2

Ensembl transtripts involved in fusion geneENST00000299293, ENST00000549921, 
ENST00000550389, ENST00000397997, 
ENST00000325006, ENST00000446544, 
ENST00000531335, ENST00000474594, 
ENST00000446212, ENST00000490911, 
ENST00000472554, 
Fusion gene scores* DoF score56 X 9 X 12=60487 X 5 X 5=175
# samples 477
** MAII scorelog2(47/6048*10)=-3.68572547765607
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/175*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FRS2 [Title/Abstract] AND AHCYL2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A6BH-01AFRS2chr12

69967865

+AHCYL2chr7

129019482

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000299293ENST00000325006FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000299293ENST00000446544FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000299293ENST00000531335FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000299293ENST00000474594FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000299293ENST00000446212FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000299293ENST00000490911FRS2chr12

69967865

+AHCYL2chr7

129019482

+
5CDS-intronENST00000299293ENST00000472554FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000549921ENST00000325006FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000549921ENST00000446544FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000549921ENST00000531335FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000549921ENST00000474594FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000549921ENST00000446212FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000549921ENST00000490911FRS2chr12

69967865

+AHCYL2chr7

129019482

+
5CDS-intronENST00000549921ENST00000472554FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000550389ENST00000325006FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000550389ENST00000446544FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000550389ENST00000531335FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000550389ENST00000474594FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000550389ENST00000446212FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000550389ENST00000490911FRS2chr12

69967865

+AHCYL2chr7

129019482

+
5CDS-intronENST00000550389ENST00000472554FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000397997ENST00000325006FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000397997ENST00000446544FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000397997ENST00000531335FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000397997ENST00000474594FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000397997ENST00000446212FRS2chr12

69967865

+AHCYL2chr7

129019482

+
In-frameENST00000397997ENST00000490911FRS2chr12

69967865

+AHCYL2chr7

129019482

+
5CDS-intronENST00000397997ENST00000472554FRS2chr12

69967865

+AHCYL2chr7

129019482

+

Top

FusionProtFeatures for FRS2_AHCYL2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FRS2

Q8WU20

AHCYL2

Q96HN2

Adapter protein that links activated FGR and NGFreceptors to downstream signaling pathways. Plays an importantrole in the activation of MAP kinases and in the phosphorylationof PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, in response to ligand-mediated activation of FGFR1.Modulates signaling via SHC1 by competing for a common bindingsite on NTRK1. {ECO:0000269|PubMed:12974390,ECO:0000269|PubMed:21765395}. May regulate the electrogenic sodium/bicarbonatecotransporter SLC4A4 activity and Mg(2+)-sensitivity. On thecontrary of its homolog AHCYL1, does not regulate ITPR1sensitivity to inositol 1,4,5-trisphosphate (PubMed:19220705).{ECO:0000250|UniProtKB:A6QLP2, ECO:0000269|PubMed:19220705}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAHCYL2chr12:69967865chr7:129019482ENST00000325006+017336_338121612Nucleotide bindingNAD
TgeneAHCYL2chr12:69967865chr7:129019482ENST00000325006+017401_406121612Nucleotide bindingNAD
TgeneAHCYL2chr12:69967865chr7:129019482ENST00000325006+017478_479121612Nucleotide bindingNAD
TgeneAHCYL2chr12:69967865chr7:129019482ENST00000446544+017336_338121611Nucleotide bindingNAD
TgeneAHCYL2chr12:69967865chr7:129019482ENST00000446544+017401_406121611Nucleotide bindingNAD
TgeneAHCYL2chr12:69967865chr7:129019482ENST00000446544+017478_479121611Nucleotide bindingNAD
TgeneAHCYL2chr12:69967865chr7:129019482ENST00000474594+017336_33819509Nucleotide bindingNAD
TgeneAHCYL2chr12:69967865chr7:129019482ENST00000474594+017401_40619509Nucleotide bindingNAD
TgeneAHCYL2chr12:69967865chr7:129019482ENST00000474594+017478_47919509Nucleotide bindingNAD
TgeneAHCYL2chr12:69967865chr7:129019482ENST00000490911+017336_33819509Nucleotide bindingNAD
TgeneAHCYL2chr12:69967865chr7:129019482ENST00000490911+017401_40619509Nucleotide bindingNAD
TgeneAHCYL2chr12:69967865chr7:129019482ENST00000490911+017478_47919509Nucleotide bindingNAD

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFRS2chr12:69967865chr7:129019482ENST00000299293+11013_115-170509DomainIRS-type PTB
HgeneFRS2chr12:69967865chr7:129019482ENST00000397997+1813_115-101509DomainIRS-type PTB
HgeneFRS2chr12:69967865chr7:129019482ENST00000549921+1913_115-139509DomainIRS-type PTB
HgeneFRS2chr12:69967865chr7:129019482ENST00000550389+1713_115-82509DomainIRS-type PTB


Top

FusionGeneSequence for FRS2_AHCYL2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000325006_chr7_129019482_+_2608aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRQIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTD
SSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCR
WAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLY
QLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD
GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLL

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000446544_chr7_129019482_+_2607aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTDS
SDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRW
AACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQ
LSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDG
FRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLN

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000531335_chr7_129019482_+_2607aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTDS
SDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRW
AACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQ
LSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDG
FRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLN

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000474594_chr7_129019482_+_2607aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTDS
SDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRW
AACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQ
LSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDG
FRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLN

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000446212_chr7_129019482_+_2608aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRQIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTD
SSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCR
WAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLY
QLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD
GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLL

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000490911_chr7_129019482_+_2607aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTDS
SDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRW
AACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQ
LSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDG
FRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLN

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000325006_chr7_129019482_+_1003aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKQIQFADQKQEFNKRPTKIGRRSLSRSIS
QSSTDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQT
AVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKI
KGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVY
VTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIW
PDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLN

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000446544_chr7_129019482_+_1002aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKIQFADQKQEFNKRPTKIGRRSLSRSISQ
SSTDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTA
VLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIK
GIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYV
TEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWP
DGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNK

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000531335_chr7_129019482_+_1002aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKIQFADQKQEFNKRPTKIGRRSLSRSISQ
SSTDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTA
VLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIK
GIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYV
TEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWP
DGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNK

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000474594_chr7_129019482_+_1002aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKIQFADQKQEFNKRPTKIGRRSLSRSISQ
SSTDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTA
VLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIK
GIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYV
TEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWP
DGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNK

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000446212_chr7_129019482_+_1003aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKQIQFADQKQEFNKRPTKIGRRSLSRSIS
QSSTDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQT
AVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKI
KGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVY
VTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIW
PDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLN

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000490911_chr7_129019482_+_1002aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKIQFADQKQEFNKRPTKIGRRSLSRSISQ
SSTDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTA
VLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIK
GIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYV
TEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWP
DGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNK

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000325006_chr7_129019482_+_2609aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIQIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYT
DSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQC
RWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRL
YQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACM
DGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRL

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000446544_chr7_129019482_+_2608aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTD
SSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCR
WAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLY
QLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD
GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLL

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000531335_chr7_129019482_+_2608aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTD
SSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCR
WAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLY
QLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD
GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLL

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000474594_chr7_129019482_+_2608aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTD
SSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCR
WAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLY
QLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD
GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLL

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000446212_chr7_129019482_+_2609aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIQIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYT
DSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQC
RWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRL
YQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACM
DGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRL

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000490911_chr7_129019482_+_2608aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTD
SSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCR
WAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLY
QLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD
GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLL

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000325006_chr7_129019482_+_2608aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRQIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTD
SSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCR
WAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLY
QLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD
GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLL

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000446544_chr7_129019482_+_2607aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTDS
SDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRW
AACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQ
LSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDG
FRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLN

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000531335_chr7_129019482_+_2607aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTDS
SDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRW
AACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQ
LSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDG
FRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLN

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000474594_chr7_129019482_+_2607aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTDS
SDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRW
AACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQ
LSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDG
FRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLN

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000446212_chr7_129019482_+_2608aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRQIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTD
SSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCR
WAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLY
QLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD
GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLL

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000490911_chr7_129019482_+_2607aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFK
CARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQ
LGRDQVSGSGANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPMXAWKALCCLHLCEVFKNEDASASFSFLNTNSF
YRLIKFFSEYFMCIFNXRELMXSRYSLKNTNFIIYYSLYSSIPVFTVPIXNESXSKXHAGXFLSIFWTXRIPFMSKSWLAFKTFYKASXQ
CTLLTGNYRLXKXCSXIQCSQYVASSMXHEESFISLINGFLTXAKTYVKETEVPHLLLHQSAPLPSVLLESGLCPXVCFAVGALKGRKET
RFSIYSSHDVIXRACPDILKLXXAQESVSGHFTQKHLKIXTTISXKFFSYRLLTTHCFLEAFVPLGFHLSSVFFFGVWDVLFCCLMSFSI
XNVXVCIXFXNWIMCSLLFSLHFCQIMVLKVHLELTVSLXQGCPCPVFIYKLFTFQVDKNILQFXICLCPXVISLANXEKKEATFNMQSS
LKVYRVVSVGTLPQHFSSNSPSYTLQLYSAHSSVPQLCCPFTCSWIFDYPSISMKYXYCCQHSRYSGSLVAVRLYHNLGFKMNXSLYKLK
SLHMSNSWKIKDVPISXTLENTREGRVEKVRXPCKIFYYFLXIXGSLRLXSGSTRYNXGXFSMKKFXSYWHPTYSVTESXDNDGLGEQXS
GIIIKKINYXRCLYRFSAIFSVFTINQYQCILSFYVHSRIFFSPFCSPVNLVLIKVLTVLLKESSGIGVQFPXCRFHFXYIVPLILSSEX
IANCAKFMXXFLXCGIRIMMEPLHIFFXNSQSRQNINLQMQGLIYLFILEVGYFILSFRHPFHCFPRILISFYFFXITPIXSLQFMLXIL
CALKRKMGPICLLRIXFXVLXEYXENIYNWCXFLDIFXKSLVFLFNKRXFRILLVLCSSLVMGIKLCPRRMYLLLGAFXNEILIFYXHII
VAIYLRFSEADLILDNSVGRPCDPSFWFWKYNHCXCFPSKXNTVLSIQIITASIPCXGWKLILVLLVFFLSVFYFPVSSSSKNENMVPSL
PPGRLANISFYLLLLWSDEICTLLFKIQQKAFHFSVYPEYIISGTXENLPSNLCFYRYXCXPSPAFNVINRTSQASVYLLPLPKTVAQHI
KMYLNNVLLKMGQGPYVFIISQQCAAIFLPQGKGFNRXKSTSQFPRAIPNLXCPNVLCNVXCVCINTYILEIDIPSETSFTSNXCIGISF
IFLMCEVYGTNYLFLDVCQIXIKALVRNYRMXRKCFWLEKLTYFMTYHSILCPNQHPIYLSCSLHPCSPSLLPHFWYNTVLLXHHYNCSS
MAIGQLXHGNRLVXVVQXSPVCHICISNAKYTFYKGQTLCYVLFSLHCIILXDYCMSXFALXMFFSYVKAXIXQLCIKVAYXIFNFFFYK
KLSNSGTTIAKLYMKYEFYPHGXFLLXTFHISLIKRHKXYCTMHTLYLNAVSDQHFKFWFAFLILAKRNHCXLKXNLVVYVTTXFSLYPF
PPFVLYFSLSVPTSYILXHGNKIXLLHXGRVWLFGGSGDGTIALXLSFAYDCFLPYKPCHQAXKVFSYMMXTCFXGQVXMCFLSLIFVMT
TNFFYLWRSQSSLQSNVYXLEYLEXASNXIXFKGXATHFXILIYCRVLVYCPTNYVKYGLILDDFGFCNALLLSFXHKYPXXGTQVDTGS
XADHTLTXSIHEKLLYXIKSDWSSFHAHFPLIAESRLQXNPNKTFGRIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTDS
SDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRW
AACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQ
LSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDG
FRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000325006_chr7_129019482_+_7824nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGCAGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAA
CGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGAT
AGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCA
GAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTG
GCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGA
TGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAG
TCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTT
ACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTAC
CAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGC
CGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGG
AAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGAT
GGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAG
CACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAA
CTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTG
AACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCT
GAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCAC

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000446544_chr7_129019482_+_7821nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGT
CCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGC
TCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAG
TTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCT
GGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGG
GCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCA
GAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACC
CACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAA
CTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGT
GAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAA
GGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGA
TTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCAC
TTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTG
ACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAAC
CTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAG
GGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTG

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000531335_chr7_129019482_+_7821nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGT
CCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGC
TCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAG
TTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCT
GGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGG
GCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCA
GAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACC
CACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAA
CTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGT
GAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAA
GGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGA
TTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCAC
TTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTG
ACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAAC
CTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAG
GGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTG

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000474594_chr7_129019482_+_7821nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGT
CCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGC
TCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAG
TTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCT
GGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGG
GCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCA
GAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACC
CACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAA
CTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGT
GAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAA
GGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGA
TTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCAC
TTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTG
ACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAAC
CTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAG
GGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTG

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000446212_chr7_129019482_+_7824nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGCAGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAA
CGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGAT
AGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCA
GAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTG
GCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGA
TGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAG
TCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTT
ACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTAC
CAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGC
CGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGG
AAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGAT
GGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAG
CACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAA
CTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTG
AACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCT
GAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCAC

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000490911_chr7_129019482_+_7821nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGT
CCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGC
TCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAG
TTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCT
GGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGG
GCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCA
GAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACC
CACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAA
CTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGT
GAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAA
GGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGA
TTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCAC
TTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTG
ACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAAC
CTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAG
GGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTG

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000325006_chr7_129019482_+_3009nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAACAGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCT
CAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAAC
TCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCT
GCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACT
GCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCT
GCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTG
GAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATC
AAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTC
AATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATG
TTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTAT
GTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGAC
ATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGA
CATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGG
CCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACT
GCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATG
GATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAAC

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000446544_chr7_129019482_+_3006nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAG
TCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCT
AAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCA
TTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCT
GTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCT
CTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAG
GGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAG
GGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAAT
GACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTT
GGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTA
ACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATT
GTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACAT
TCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCT
GATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCT
ACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGAT
GAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAG

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000531335_chr7_129019482_+_3006nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAG
TCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCT
AAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCA
TTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCT
GTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCT
CTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAG
GGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAG
GGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAAT
GACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTT
GGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTA
ACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATT
GTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACAT
TCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCT
GATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCT
ACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGAT
GAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAG

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000474594_chr7_129019482_+_3006nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAG
TCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCT
AAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCA
TTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCT
GTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCT
CTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAG
GGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAG
GGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAAT
GACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTT
GGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTA
ACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATT
GTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACAT
TCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCT
GATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCT
ACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGAT
GAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAG

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000446212_chr7_129019482_+_3009nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAACAGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCT
CAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAAC
TCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCT
GCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACT
GCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCT
GCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTG
GAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATC
AAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTC
AATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATG
TTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTAT
GTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGAC
ATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGA
CATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGG
CCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACT
GCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATG
GATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAAC

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000490911_chr7_129019482_+_3006nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAG
TCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCT
AAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCA
TTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCT
GTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCT
CTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAG
GGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAG
GGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAAT
GACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTT
GGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTA
ACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATT
GTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACAT
TCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCT
GATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCT
ACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGAT
GAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAG

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000325006_chr7_129019482_+_7827nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATACAGATCCAGTTTGCTGACCAGAAGCAAGAATTCAAC
AAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACA
GATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAG
GCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCT
TTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGC
CGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGA
GAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGAT
CTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTG
TACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGT
TGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTG
GGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATG
GATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGA
GAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCA
GAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTG
CTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCT
CCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCC

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000446544_chr7_129019482_+_7824nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAA
CGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGAT
AGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCA
GAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTG
GCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGA
TGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAG
TCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTT
ACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTAC
CAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGC
CGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGG
AAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGAT
GGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAG
CACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAA
CTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTG
AACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCT
GAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCAC

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000531335_chr7_129019482_+_7824nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAA
CGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGAT
AGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCA
GAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTG
GCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGA
TGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAG
TCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTT
ACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTAC
CAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGC
CGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGG
AAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGAT
GGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAG
CACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAA
CTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTG
AACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCT
GAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCAC

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000474594_chr7_129019482_+_7824nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAA
CGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGAT
AGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCA
GAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTG
GCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGA
TGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAG
TCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTT
ACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTAC
CAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGC
CGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGG
AAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGAT
GGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAG
CACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAA
CTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTG
AACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCT
GAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCAC

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000446212_chr7_129019482_+_7827nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATACAGATCCAGTTTGCTGACCAGAAGCAAGAATTCAAC
AAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACA
GATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAG
GCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCT
TTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGC
CGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGA
GAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGAT
CTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTG
TACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGT
TGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTG
GGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATG
GATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGA
GAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCA
GAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTG
CTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCT
CCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCC

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000490911_chr7_129019482_+_7824nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAA
CGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGAT
AGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCA
GAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTG
GCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGA
TGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAG
TCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTT
ACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTAC
CAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGC
CGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGG
AAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGAT
GGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAG
CACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAA
CTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTG
AACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCT
GAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCAC

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000325006_chr7_129019482_+_7824nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGCAGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAA
CGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGAT
AGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCA
GAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTG
GCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGA
TGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAG
TCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTT
ACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTAC
CAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGC
CGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGG
AAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGAT
GGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAG
CACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAA
CTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTG
AACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCT
GAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCAC

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000446544_chr7_129019482_+_7821nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGT
CCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGC
TCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAG
TTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCT
GGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGG
GCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCA
GAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACC
CACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAA
CTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGT
GAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAA
GGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGA
TTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCAC
TTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTG
ACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAAC
CTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAG
GGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTG

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000531335_chr7_129019482_+_7821nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGT
CCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGC
TCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAG
TTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCT
GGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGG
GCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCA
GAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACC
CACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAA
CTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGT
GAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAA
GGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGA
TTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCAC
TTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTG
ACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAAC
CTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAG
GGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTG

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000474594_chr7_129019482_+_7821nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGT
CCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGC
TCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAG
TTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCT
GGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGG
GCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCA
GAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACC
CACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAA
CTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGT
GAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAA
GGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGA
TTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCAC
TTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTG
ACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAAC
CTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAG
GGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTG

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000446212_chr7_129019482_+_7824nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGCAGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAA
CGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGAT
AGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCA
GAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTG
GCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGA
TGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAG
TCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTT
ACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTAC
CAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGC
CGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGG
AAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGAT
GGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAG
CACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAA
CTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTG
AACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCT
GAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCAC

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000490911_chr7_129019482_+_7821nt
ATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGG
AATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTC
TGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAG
TGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGA
AATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATAT
CCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAA
GAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACA
AGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCT
CAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAA
CTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCT
GTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACC
TCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAA
GCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCAT
AACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTT
AACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCT
CAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCT
GCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCC
TGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTT
TATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACT
AATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGT
TGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAA
TGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAG
GAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAG
TCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACA
AGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGT
CACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAG
GCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATT
TAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAG
GTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAAC
ATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCC
CTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCC
CACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGC
CAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAG
AGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTT
AGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAA
TTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGT
GGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGT
ATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTC
TTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAA
ATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGC
CAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCAT
CCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTA
TGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGG
TGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTA
GTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATT
GTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAA
TATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAA
CTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTC
CCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAA
GCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGT
TGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATA
AAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCT
CAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTG
TAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTC
ATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGA
ATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTT
TCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCT
ATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAA
TATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCA
TTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAA
AAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCAT
ATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTT
GCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTC
CCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGA
GTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCAT
CAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACA
ACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATT
TAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTA
ATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGC
TGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCC
CTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGT
CCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGC
TCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAG
TTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCT
GGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGG
GCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCA
GAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACC
CACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAA
CTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGT
GAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAA
GGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGA
TTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCAC
TTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTG
ACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAAC
CTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAG
GGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000325006_chr7_129019482_+_11626nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGAAATGACCATTAAGAAGTAGATGCCCAGATGCAAAAGTGATGAAACAGTCCA
TTTGTCATAAAGTAAGATGCAGCTGTGGCATGTCAACCAGCTTGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGAG
ATTTTCTTCTTTCTACCATCATCAAGATCAAGCAGGCAAGTTTACTTGCTGTCATCTTCTGCAAGGTTAAATCAGCAAACAAAGAAAACA
TGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCACACATGGTCTTCTGAA
GAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGAT
GATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCAC
TACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCC
TTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTA
GAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAAT
GGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTA
GGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAAC
CGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGG
GATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTG
GAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCA
CCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACC
AGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTT
TGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCA
ATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACA
GTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGAC
AACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGA
ACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATG
TGAGCCTGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAAC
TCCTTTTATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAG
AACACTAATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACAT
GCTGGTTGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCT
TGACAATGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAA
CATGAGGAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTA
CACCAGTCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAG
GAGACAAGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTC
TCAGGTCACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTT
CTGGAGGCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTT
TCAATTTAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTT
TTGAAGGTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGAT
AAAAACATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAA
AGTTCCCTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTAC
TCTGCCCACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATAT
TGTTGCCAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAA
CTGAAGAGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAA
AAGGTTAGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAA
GGTTAATTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAA
TAGAGTGGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATAT
CAGTGTATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACT
GTTCTCTTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCT
GAGTAAATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGA
AACAGCCAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTC
CGTCATCCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAA
ATACTATGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATAC
AACTGGTGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGT
AGTTTAGTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCAT
ATAATTGTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTT
TGGAAATATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGT
TGGAAACTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCT
TCCCTCCCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAG
CAAAAAGCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATAC
TAATGTTGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAG
CATATAAAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTT
TTGCCTCAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGC
AATGTGTAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATC
TCATTCATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAAT
TACAGAATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATC
TATCTTTCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGC
AGTTCTATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAAT
GCAAAATATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAA
TTTGCATTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTT
TATAAAAAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACA
TTCCATATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTT
TGGTTTGCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTAT
CCCTTCCCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGA
GGCCGAGTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCA
TGTCATCAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTC
ATGACAACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAAT
TGAATTTAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATAT
GGTTTAATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACT
GGAAGCTGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCAC
TTTCCCCTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGCAGATCCAGTTTGCTGACCAGAAGCAAGAATTC
AACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATAT
ACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAA
CAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAG
CCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAG
TGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAG
GGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGG
GATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGG
CTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTAC
TGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAG
GTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGT
ATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACC
AGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACA
CCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGC
CTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAAT
GCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGAT
GCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAA
GTTCCTGTAACTCAAACCAGAATTTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTC
TCCAATCAAAGCTGCCTGCCGTGCTCACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGTAGTGTTGGCCCAG
AGTGTGGTTACTGCCCTGAGGGCCATGAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCCCAGTGCATCATTT
GCATCATTCCCCATTGACTGAATCCTCAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGATTCCATACTCCCTA
TTCCCTGGAGTTTTCTGGAATAAATTTTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGGAATTAACATGGCC
AGTGTTTCACACAAGATTGGGTTCCCAATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAAGGAGTGTTATTTA
TGGCTTTGCCAAGCTACATCAAGAACTCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTTCTTCTCCTTGAAT
ATTTATGTCCATTTTAACACTTCCTGGTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGTCAGACATTTGTTC
TGCTGTCTTTCTAATCCAGCCAACGTCTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTTGTCATTTGATTGG
ATAGTTTCCAAGGAAGCCCCTCCAGATTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAAACTTCCTGCTATT
GCCTAAAGCTACGTCTGAAACTGAGTAGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGGGACAGGTCTTTCA
GACTCACAGCTTGATACCCTAACAAAGCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCTGAGGGATACAGAG
ATGAAATTGTAAACTGTATCCAGATTATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGGCCATTGCCATGGA
TGAAACCGAGATCTGCAGTCTGATCTGTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGATGATTCTGTATTTC
AGAGTCAGTTTCTTGAGTAACTCCAGTGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTCCCACCCAAAAATT
GGATTCCTTTTGGAGACTGATCTGTTGGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGACTGGCCCTAGGAAA
CTTGAATTAAATAAGCCTCTTCCCCTTACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCTATGCTGGTCTGCC
TCAAAGTCTCAAGACCAAGGTGACTCAAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCTCTTCTTCTACCTC
TACCCTCTCCAACTTCTCCTGGTCTTCACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGGGAAGTGGAACTTT
GGTAAATGACTGTTTGCCTCATTTAATAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCTCAGCAAGTACTGG
TTATATTCTTTTTTTGTAAGGAAGATCATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACCTAGTCCTGATTTT
TGTATTAATTGGTTCCCTTTAGCAAGGGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGCAGATAGATGGTCT
CTAGCCTATTGTATTCTTAGACCAAAAATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTATGTGCTGGTACTTA
AAGAGTACATTCTGCCTTGCTGTAGTGAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAGGTTGCCAGTGTTG
CTGCCCATGATGAGTTATTTGCCTCTGAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAAGAAAGAACCACAA
GCCTCCCAAGTATTTGGGTTCTATCTTAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATGTGTCTTCTTTCCT
CCAACCTCTTACCTTAGATGCATCCTGGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCTCCAGTCTGTGAGG
ATACATAACATTTTCTCTACAATGAATCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGACAGGGTTTCACTA
TGTTGCCCAGGCTGGTCTCAAACTCCTGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAGGTGTGTGCTACCG
TGCCTGGCACTTTTTTGCCTTCTTAATGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTATCTACTCTACCTTC
CCTCTGCTCTCCTCCCTCCCTATCCTACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTTTTATGCTGCTTCG
CTTTTCTCTAAACAGATCTGATATTGCTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGAATCAAAATGCATT
GTTGCATTAAGCTTTTTCAATAAAGGAAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGTTCTAAACTCTATA
TATACATATATATATATATATCTATATATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACACTTCTAAAGATCA
CCATTTCTGAGAAGTTCTTGGAAATCTTTATGTCTAAGTGATTGTATTAGATCAGCAATAATGACTATGTAATCTCAAAAAACAAATAAA

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000446544_chr7_129019482_+_11623nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGAAATGACCATTAAGAAGTAGATGCCCAGATGCAAAAGTGATGAAACAGTCCA
TTTGTCATAAAGTAAGATGCAGCTGTGGCATGTCAACCAGCTTGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGAG
ATTTTCTTCTTTCTACCATCATCAAGATCAAGCAGGCAAGTTTACTTGCTGTCATCTTCTGCAAGGTTAAATCAGCAAACAAAGAAAACA
TGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCACACATGGTCTTCTGAA
GAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGAT
GATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCAC
TACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCC
TTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTA
GAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAAT
GGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTA
GGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAAC
CGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGG
GATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTG
GAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCA
CCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACC
AGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTT
TGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCA
ATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACA
GTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGAC
AACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGA
ACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATG
TGAGCCTGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAAC
TCCTTTTATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAG
AACACTAATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACAT
GCTGGTTGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCT
TGACAATGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAA
CATGAGGAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTA
CACCAGTCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAG
GAGACAAGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTC
TCAGGTCACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTT
CTGGAGGCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTT
TCAATTTAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTT
TTGAAGGTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGAT
AAAAACATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAA
AGTTCCCTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTAC
TCTGCCCACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATAT
TGTTGCCAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAA
CTGAAGAGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAA
AAGGTTAGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAA
GGTTAATTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAA
TAGAGTGGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATAT
CAGTGTATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACT
GTTCTCTTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCT
GAGTAAATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGA
AACAGCCAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTC
CGTCATCCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAA
ATACTATGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATAC
AACTGGTGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGT
AGTTTAGTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCAT
ATAATTGTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTT
TGGAAATATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGT
TGGAAACTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCT
TCCCTCCCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAG
CAAAAAGCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATAC
TAATGTTGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAG
CATATAAAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTT
TTGCCTCAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGC
AATGTGTAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATC
TCATTCATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAAT
TACAGAATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATC
TATCTTTCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGC
AGTTCTATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAAT
GCAAAATATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAA
TTTGCATTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTT
TATAAAAAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACA
TTCCATATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTT
TGGTTTGCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTAT
CCCTTCCCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGA
GGCCGAGTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCA
TGTCATCAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTC
ATGACAACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAAT
TGAATTTAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATAT
GGTTTAATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACT
GGAAGCTGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCAC
TTTCCCCTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCAGAAGCAAGAATTCAAC
AAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACA
GATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAG
GCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCT
TTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGC
CGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGA
GAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGAT
CTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTG
TACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGT
TGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTG
GGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATG
GATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGA
GAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCA
GAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTG
CTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCT
CCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCC
CACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTT
CCTGTAACTCAAACCAGAATTTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCC
AATCAAAGCTGCCTGCCGTGCTCACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGTAGTGTTGGCCCAGAGT
GTGGTTACTGCCCTGAGGGCCATGAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCCCAGTGCATCATTTGCA
TCATTCCCCATTGACTGAATCCTCAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGATTCCATACTCCCTATTC
CCTGGAGTTTTCTGGAATAAATTTTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGGAATTAACATGGCCAGT
GTTTCACACAAGATTGGGTTCCCAATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAAGGAGTGTTATTTATGG
CTTTGCCAAGCTACATCAAGAACTCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTTCTTCTCCTTGAATATT
TATGTCCATTTTAACACTTCCTGGTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGTCAGACATTTGTTCTGC
TGTCTTTCTAATCCAGCCAACGTCTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTTGTCATTTGATTGGATA
GTTTCCAAGGAAGCCCCTCCAGATTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAAACTTCCTGCTATTGCC
TAAAGCTACGTCTGAAACTGAGTAGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGGGACAGGTCTTTCAGAC
TCACAGCTTGATACCCTAACAAAGCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCTGAGGGATACAGAGATG
AAATTGTAAACTGTATCCAGATTATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGGCCATTGCCATGGATGA
AACCGAGATCTGCAGTCTGATCTGTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGATGATTCTGTATTTCAGA
GTCAGTTTCTTGAGTAACTCCAGTGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTCCCACCCAAAAATTGGA
TTCCTTTTGGAGACTGATCTGTTGGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGACTGGCCCTAGGAAACTT
GAATTAAATAAGCCTCTTCCCCTTACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCTATGCTGGTCTGCCTCA
AAGTCTCAAGACCAAGGTGACTCAAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCTCTTCTTCTACCTCTAC
CCTCTCCAACTTCTCCTGGTCTTCACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGGGAAGTGGAACTTTGGT
AAATGACTGTTTGCCTCATTTAATAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCTCAGCAAGTACTGGTTA
TATTCTTTTTTTGTAAGGAAGATCATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACCTAGTCCTGATTTTTGT
ATTAATTGGTTCCCTTTAGCAAGGGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGCAGATAGATGGTCTCTA
GCCTATTGTATTCTTAGACCAAAAATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTATGTGCTGGTACTTAAAG
AGTACATTCTGCCTTGCTGTAGTGAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAGGTTGCCAGTGTTGCTG
CCCATGATGAGTTATTTGCCTCTGAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAAGAAAGAACCACAAGCC
TCCCAAGTATTTGGGTTCTATCTTAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATGTGTCTTCTTTCCTCCA
ACCTCTTACCTTAGATGCATCCTGGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCTCCAGTCTGTGAGGATA
CATAACATTTTCTCTACAATGAATCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGACAGGGTTTCACTATGT
TGCCCAGGCTGGTCTCAAACTCCTGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAGGTGTGTGCTACCGTGC
CTGGCACTTTTTTGCCTTCTTAATGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTATCTACTCTACCTTCCCT
CTGCTCTCCTCCCTCCCTATCCTACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTTTTATGCTGCTTCGCTT
TTCTCTAAACAGATCTGATATTGCTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGAATCAAAATGCATTGTT
GCATTAAGCTTTTTCAATAAAGGAAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGTTCTAAACTCTATATAT
ACATATATATATATATATCTATATATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACACTTCTAAAGATCACCA
TTTCTGAGAAGTTCTTGGAAATCTTTATGTCTAAGTGATTGTATTAGATCAGCAATAATGACTATGTAATCTCAAAAAACAAATAAAATA

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000531335_chr7_129019482_+_11622nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGAAATGACCATTAAGAAGTAGATGCCCAGATGCAAAAGTGATGAAACAGTCCA
TTTGTCATAAAGTAAGATGCAGCTGTGGCATGTCAACCAGCTTGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGAG
ATTTTCTTCTTTCTACCATCATCAAGATCAAGCAGGCAAGTTTACTTGCTGTCATCTTCTGCAAGGTTAAATCAGCAAACAAAGAAAACA
TGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCACACATGGTCTTCTGAA
GAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGAT
GATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCAC
TACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCC
TTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTA
GAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAAT
GGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTA
GGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAAC
CGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGG
GATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTG
GAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCA
CCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACC
AGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTT
TGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCA
ATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACA
GTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGAC
AACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGA
ACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATG
TGAGCCTGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAAC
TCCTTTTATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAG
AACACTAATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACAT
GCTGGTTGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCT
TGACAATGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAA
CATGAGGAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTA
CACCAGTCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAG
GAGACAAGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTC
TCAGGTCACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTT
CTGGAGGCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTT
TCAATTTAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTT
TTGAAGGTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGAT
AAAAACATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAA
AGTTCCCTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTAC
TCTGCCCACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATAT
TGTTGCCAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAA
CTGAAGAGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAA
AAGGTTAGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAA
GGTTAATTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAA
TAGAGTGGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATAT
CAGTGTATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACT
GTTCTCTTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCT
GAGTAAATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGA
AACAGCCAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTC
CGTCATCCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAA
ATACTATGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATAC
AACTGGTGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGT
AGTTTAGTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCAT
ATAATTGTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTT
TGGAAATATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGT
TGGAAACTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCT
TCCCTCCCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAG
CAAAAAGCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATAC
TAATGTTGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAG
CATATAAAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTT
TTGCCTCAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGC
AATGTGTAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATC
TCATTCATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAAT
TACAGAATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATC
TATCTTTCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGC
AGTTCTATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAAT
GCAAAATATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAA
TTTGCATTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTT
TATAAAAAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACA
TTCCATATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTT
TGGTTTGCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTAT
CCCTTCCCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGA
GGCCGAGTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCA
TGTCATCAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTC
ATGACAACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAAT
TGAATTTAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATAT
GGTTTAATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACT
GGAAGCTGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCAC
TTTCCCCTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCAGAAGCAAGAATTCAAC
AAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACA
GATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAG
GCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCT
TTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGC
CGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGA
GAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGAT
CTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTG
TACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGT
TGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTG
GGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATG
GATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGA
GAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCA
GAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTG
CTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCT
CCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCC
CACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTT
CCTGTAACTCAAACCAGAATTTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCC
AATCAAAGCTGCCTGCCGTGCTCACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGTAGTGTTGGCCCAGAGT
GTGGTTACTGCCCTGAGGGCCATGAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCCCAGTGCATCATTTGCA
TCATTCCCCATTGACTGAATCCTCAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGATTCCATACTCCCTATTC
CCTGGAGTTTTCTGGAATAAATTTTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGGAATTAACATGGCCAGT
GTTTCACACAAGATTGGGTTCCCAATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAAGGAGTGTTATTTATGG
CTTTGCCAAGCTACATCAAGAACTCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTTCTTCTCCTTGAATATT
TATGTCCATTTTAACACTTCCTGGTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGTCAGACATTTGTTCTGC
TGTCTTTCTAATCCAGCCAACGTCTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTTGTCATTTGATTGGATA
GTTTCCAAGGAAGCCCCTCCAGATTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAAACTTCCTGCTATTGCC
TAAAGCTACGTCTGAAACTGAGTAGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGGGACAGGTCTTTCAGAC
TCACAGCTTGATACCCTAACAAAGCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCTGAGGGATACAGAGATG
AAATTGTAAACTGTATCCAGATTATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGGCCATTGCCATGGATGA
AACCGAGATCTGCAGTCTGATCTGTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGATGATTCTGTATTTCAGA
GTCAGTTTCTTGAGTAACTCCAGTGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTCCCACCCAAAAATTGGA
TTCCTTTTGGAGACTGATCTGTTGGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGACTGGCCCTAGGAAACTT
GAATTAAATAAGCCTCTTCCCCTTACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCTATGCTGGTCTGCCTCA
AAGTCTCAAGACCAAGGTGACTCAAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCTCTTCTTCTACCTCTAC
CCTCTCCAACTTCTCCTGGTCTTCACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGGGAAGTGGAACTTTGGT
AAATGACTGTTTGCCTCATTTAATAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCTCAGCAAGTACTGGTTA
TATTCTTTTTTTGTAAGGAAGATCATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACCTAGTCCTGATTTTTGT
ATTAATTGGTTCCCTTTAGCAAGGGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGCAGATAGATGGTCTCTA
GCCTATTGTATTCTTAGACCAAAAATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTATGTGCTGGTACTTAAAG
AGTACATTCTGCCTTGCTGTAGTGAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAGGTTGCCAGTGTTGCTG
CCCATGATGAGTTATTTGCCTCTGAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAAGAAAGAACCACAAGCC
TCCCAAGTATTTGGGTTCTATCTTAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATGTGTCTTCTTTCCTCCA
ACCTCTTACCTTAGATGCATCCTGGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCTCCAGTCTGTGAGGATA
CATAACATTTTCTCTACAATGAATCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGACAGGGTTTCACTATGT
TGCCCAGGCTGGTCTCAAACTCCTGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAGGTGTGTGCTACCGTGC
CTGGCACTTTTTTGCCTTCTTAATGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTATCTACTCTACCTTCCCT
CTGCTCTCCTCCCTCCCTATCCTACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTTTTATGCTGCTTCGCTT
TTCTCTAAACAGATCTGATATTGCTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGAATCAAAATGCATTGTT
GCATTAAGCTTTTTCAATAAAGGAAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGTTCTAAACTCTATATAT
ACATATATATATATATATCTATATATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACACTTCTAAAGATCACCA
TTTCTGAGAAGTTCTTGGAAATCTTTATGTCTAAGTGATTGTATTAGATCAGCAATAATGACTATGTAATCTCAAAAAACAAATAAAATA

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000474594_chr7_129019482_+_8623nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGAAATGACCATTAAGAAGTAGATGCCCAGATGCAAAAGTGATGAAACAGTCCA
TTTGTCATAAAGTAAGATGCAGCTGTGGCATGTCAACCAGCTTGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGAG
ATTTTCTTCTTTCTACCATCATCAAGATCAAGCAGGCAAGTTTACTTGCTGTCATCTTCTGCAAGGTTAAATCAGCAAACAAAGAAAACA
TGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCACACATGGTCTTCTGAA
GAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGAT
GATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCAC
TACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCC
TTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTA
GAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAAT
GGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTA
GGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAAC
CGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGG
GATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTG
GAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCA
CCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACC
AGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTT
TGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCA
ATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACA
GTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGAC
AACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGA
ACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATG
TGAGCCTGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAAC
TCCTTTTATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAG
AACACTAATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACAT
GCTGGTTGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCT
TGACAATGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAA
CATGAGGAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTA
CACCAGTCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAG
GAGACAAGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTC
TCAGGTCACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTT
CTGGAGGCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTT
TCAATTTAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTT
TTGAAGGTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGAT
AAAAACATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAA
AGTTCCCTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTAC
TCTGCCCACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATAT
TGTTGCCAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAA
CTGAAGAGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAA
AAGGTTAGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAA
GGTTAATTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAA
TAGAGTGGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATAT
CAGTGTATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACT
GTTCTCTTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCT
GAGTAAATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGA
AACAGCCAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTC
CGTCATCCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAA
ATACTATGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATAC
AACTGGTGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGT
AGTTTAGTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCAT
ATAATTGTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTT
TGGAAATATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGT
TGGAAACTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCT
TCCCTCCCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAG
CAAAAAGCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATAC
TAATGTTGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAG
CATATAAAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTT
TTGCCTCAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGC
AATGTGTAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATC
TCATTCATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAAT
TACAGAATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATC
TATCTTTCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGC
AGTTCTATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAAT
GCAAAATATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAA
TTTGCATTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTT
TATAAAAAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACA
TTCCATATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTT
TGGTTTGCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTAT
CCCTTCCCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGA
GGCCGAGTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCA
TGTCATCAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTC
ATGACAACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAAT
TGAATTTAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATAT
GGTTTAATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACT
GGAAGCTGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCAC
TTTCCCCTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCAGAAGCAAGAATTCAAC
AAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACA
GATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAG
GCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCT
TTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGC
CGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGA
GAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGAT
CTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTG
TACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGT
TGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTG
GGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATG
GATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGA
GAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCA
GAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTG
CTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCT
CCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCC
CACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTT
CCTGTAACTCAAACCAGAATTTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCC

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000446212_chr7_129019482_+_11625nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGAAATGACCATTAAGAAGTAGATGCCCAGATGCAAAAGTGATGAAACAGTCCA
TTTGTCATAAAGTAAGATGCAGCTGTGGCATGTCAACCAGCTTGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGAG
ATTTTCTTCTTTCTACCATCATCAAGATCAAGCAGGCAAGTTTACTTGCTGTCATCTTCTGCAAGGTTAAATCAGCAAACAAAGAAAACA
TGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCACACATGGTCTTCTGAA
GAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGAT
GATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCAC
TACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCC
TTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTA
GAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAAT
GGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTA
GGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAAC
CGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGG
GATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTG
GAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCA
CCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACC
AGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTT
TGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCA
ATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACA
GTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGAC
AACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGA
ACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATG
TGAGCCTGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAAC
TCCTTTTATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAG
AACACTAATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACAT
GCTGGTTGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCT
TGACAATGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAA
CATGAGGAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTA
CACCAGTCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAG
GAGACAAGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTC
TCAGGTCACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTT
CTGGAGGCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTT
TCAATTTAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTT
TTGAAGGTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGAT
AAAAACATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAA
AGTTCCCTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTAC
TCTGCCCACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATAT
TGTTGCCAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAA
CTGAAGAGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAA
AAGGTTAGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAA
GGTTAATTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAA
TAGAGTGGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATAT
CAGTGTATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACT
GTTCTCTTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCT
GAGTAAATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGA
AACAGCCAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTC
CGTCATCCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAA
ATACTATGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATAC
AACTGGTGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGT
AGTTTAGTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCAT
ATAATTGTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTT
TGGAAATATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGT
TGGAAACTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCT
TCCCTCCCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAG
CAAAAAGCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATAC
TAATGTTGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAG
CATATAAAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTT
TTGCCTCAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGC
AATGTGTAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATC
TCATTCATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAAT
TACAGAATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATC
TATCTTTCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGC
AGTTCTATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAAT
GCAAAATATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAA
TTTGCATTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTT
TATAAAAAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACA
TTCCATATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTT
TGGTTTGCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTAT
CCCTTCCCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGA
GGCCGAGTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCA
TGTCATCAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTC
ATGACAACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAAT
TGAATTTAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATAT
GGTTTAATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACT
GGAAGCTGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCAC
TTTCCCCTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGCAGATCCAGTTTGCTGACCAGAAGCAAGAATTC
AACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATAT
ACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAA
CAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAG
CCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAG
TGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAG
GGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGG
GATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGG
CTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTAC
TGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAG
GTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGT
ATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACC
AGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACA
CCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGC
CTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAAT
GCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGAT
GCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAA
GTTCCTGTAACTCAAACCAGAATTTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTC
TCCAATCAAAGCTGCCTGCCGTGCTCACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGTAGTGTTGGCCCAG
AGTGTGGTTACTGCCCTGAGGGCCATGAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCCCAGTGCATCATTT
GCATCATTCCCCATTGACTGAATCCTCAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGATTCCATACTCCCTA
TTCCCTGGAGTTTTCTGGAATAAATTTTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGGAATTAACATGGCC
AGTGTTTCACACAAGATTGGGTTCCCAATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAAGGAGTGTTATTTA
TGGCTTTGCCAAGCTACATCAAGAACTCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTTCTTCTCCTTGAAT
ATTTATGTCCATTTTAACACTTCCTGGTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGTCAGACATTTGTTC
TGCTGTCTTTCTAATCCAGCCAACGTCTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTTGTCATTTGATTGG
ATAGTTTCCAAGGAAGCCCCTCCAGATTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAAACTTCCTGCTATT
GCCTAAAGCTACGTCTGAAACTGAGTAGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGGGACAGGTCTTTCA
GACTCACAGCTTGATACCCTAACAAAGCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCTGAGGGATACAGAG
ATGAAATTGTAAACTGTATCCAGATTATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGGCCATTGCCATGGA
TGAAACCGAGATCTGCAGTCTGATCTGTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGATGATTCTGTATTTC
AGAGTCAGTTTCTTGAGTAACTCCAGTGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTCCCACCCAAAAATT
GGATTCCTTTTGGAGACTGATCTGTTGGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGACTGGCCCTAGGAAA
CTTGAATTAAATAAGCCTCTTCCCCTTACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCTATGCTGGTCTGCC
TCAAAGTCTCAAGACCAAGGTGACTCAAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCTCTTCTTCTACCTC
TACCCTCTCCAACTTCTCCTGGTCTTCACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGGGAAGTGGAACTTT
GGTAAATGACTGTTTGCCTCATTTAATAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCTCAGCAAGTACTGG
TTATATTCTTTTTTTGTAAGGAAGATCATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACCTAGTCCTGATTTT
TGTATTAATTGGTTCCCTTTAGCAAGGGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGCAGATAGATGGTCT
CTAGCCTATTGTATTCTTAGACCAAAAATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTATGTGCTGGTACTTA
AAGAGTACATTCTGCCTTGCTGTAGTGAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAGGTTGCCAGTGTTG
CTGCCCATGATGAGTTATTTGCCTCTGAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAAGAAAGAACCACAA
GCCTCCCAAGTATTTGGGTTCTATCTTAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATGTGTCTTCTTTCCT
CCAACCTCTTACCTTAGATGCATCCTGGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCTCCAGTCTGTGAGG
ATACATAACATTTTCTCTACAATGAATCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGACAGGGTTTCACTA
TGTTGCCCAGGCTGGTCTCAAACTCCTGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAGGTGTGTGCTACCG
TGCCTGGCACTTTTTTGCCTTCTTAATGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTATCTACTCTACCTTC
CCTCTGCTCTCCTCCCTCCCTATCCTACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTTTTATGCTGCTTCG
CTTTTCTCTAAACAGATCTGATATTGCTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGAATCAAAATGCATT
GTTGCATTAAGCTTTTTCAATAAAGGAAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGTTCTAAACTCTATA
TATACATATATATATATATATCTATATATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACACTTCTAAAGATCA
CCATTTCTGAGAAGTTCTTGGAAATCTTTATGTCTAAGTGATTGTATTAGATCAGCAATAATGACTATGTAATCTCAAAAAACAAATAAA

>In-frame_FRS2_ENST00000299293_chr12_69967865_+_AHCYL2_ENST00000490911_chr7_129019482_+_8587nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGAAATGACCATTAAGAAGTAGATGCCCAGATGCAAAAGTGATGAAACAGTCCA
TTTGTCATAAAGTAAGATGCAGCTGTGGCATGTCAACCAGCTTGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGAG
ATTTTCTTCTTTCTACCATCATCAAGATCAAGCAGGCAAGTTTACTTGCTGTCATCTTCTGCAAGGTTAAATCAGCAAACAAAGAAAACA
TGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCACACATGGTCTTCTGAA
GAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGAT
GATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCAC
TACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCC
TTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTA
GAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAAT
GGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTA
GGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAAC
CGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGG
GATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTG
GAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCA
CCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACC
AGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTT
TGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCA
ATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACA
GTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGAC
AACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGA
ACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATG
TGAGCCTGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAAC
TCCTTTTATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAG
AACACTAATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACAT
GCTGGTTGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCT
TGACAATGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAA
CATGAGGAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTA
CACCAGTCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAG
GAGACAAGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTC
TCAGGTCACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTT
CTGGAGGCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTT
TCAATTTAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTT
TTGAAGGTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGAT
AAAAACATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAA
AGTTCCCTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTAC
TCTGCCCACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATAT
TGTTGCCAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAA
CTGAAGAGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAA
AAGGTTAGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAA
GGTTAATTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAA
TAGAGTGGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATAT
CAGTGTATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACT
GTTCTCTTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCT
GAGTAAATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGA
AACAGCCAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTC
CGTCATCCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAA
ATACTATGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATAC
AACTGGTGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGT
AGTTTAGTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCAT
ATAATTGTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTT
TGGAAATATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGT
TGGAAACTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCT
TCCCTCCCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAG
CAAAAAGCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATAC
TAATGTTGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAG
CATATAAAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTT
TTGCCTCAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGC
AATGTGTAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATC
TCATTCATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAAT
TACAGAATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATC
TATCTTTCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGC
AGTTCTATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAAT
GCAAAATATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAA
TTTGCATTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTT
TATAAAAAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACA
TTCCATATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTT
TGGTTTGCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTAT
CCCTTCCCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGA
GGCCGAGTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCA
TGTCATCAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTC
ATGACAACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAAT
TGAATTTAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATAT
GGTTTAATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACT
GGAAGCTGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCAC
TTTCCCCTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCAGAAGCAAGAATTCAAC
AAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACA
GATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAG
GCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCT
TTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGC
CGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGA
GAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGAT
CTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTG
TACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGT
TGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTG
GGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATG
GATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGA
GAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCA
GAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTG
CTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCT
CCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCC
CACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTT
CCTGTAACTCAAACCAGAATTTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCC

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000325006_chr7_129019482_+_6743nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGAAATGACCATTAAGAAGTAGATGCCCAGATGCAAAAGTGATGAAACAGTCCA
TTTGTCATAAAGTAAGATGCAGCTGTGGCATGTCAACCAGCTTGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGTT
AAATCAGCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCT
AGTGCACACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTT
TAAGGTCATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAA
ACGTGACTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCA
AACTGGACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAA
TGTGGTGGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATT
TGCTGCTCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGG
AAGTGCTCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGG
TGTGCAAGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGA
ACCAAGTAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCA
GTTAATGGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGA
CAGTGATGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAG
GAGAGGTCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAA
TCTACCATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGG
CTACCATAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAG
GCGTCGGGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTT
GGAAGGTGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTA
TGCCGTGATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACA
CAATAGTACTGATCTGCCCATGTGAGCCTGGAAACAGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGG
ACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGAC
ATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGA
AATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGT
GGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACAT
CTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTG
GTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAA
AAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGG
GAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGA
TGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGC
CCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAA
ATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAA
GAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGT
GAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCAC
AGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCA
GGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGA
TGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAAT
TTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTG
CTCACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGTAGTGTTGGCCCAGAGTGTGGTTACTGCCCTGAGGGC
CATGAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCCCAGTGCATCATTTGCATCATTCCCCATTGACTGAAT
CCTCAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGATTCCATACTCCCTATTCCCTGGAGTTTTCTGGAATAA
ATTTTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGGAATTAACATGGCCAGTGTTTCACACAAGATTGGGTT
CCCAATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAAGGAGTGTTATTTATGGCTTTGCCAAGCTACATCAAG
AACTCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTTCTTCTCCTTGAATATTTATGTCCATTTTAACACTTC
CTGGTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGTCAGACATTTGTTCTGCTGTCTTTCTAATCCAGCCAA
CGTCTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTTGTCATTTGATTGGATAGTTTCCAAGGAAGCCCCTCC
AGATTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAAACTTCCTGCTATTGCCTAAAGCTACGTCTGAAACTG
AGTAGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGGGACAGGTCTTTCAGACTCACAGCTTGATACCCTAAC
AAAGCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCTGAGGGATACAGAGATGAAATTGTAAACTGTATCCAG
ATTATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGGCCATTGCCATGGATGAAACCGAGATCTGCAGTCTGA
TCTGTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGATGATTCTGTATTTCAGAGTCAGTTTCTTGAGTAACTC
CAGTGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTCCCACCCAAAAATTGGATTCCTTTTGGAGACTGATCT
GTTGGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGACTGGCCCTAGGAAACTTGAATTAAATAAGCCTCTTCC
CCTTACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCTATGCTGGTCTGCCTCAAAGTCTCAAGACCAAGGTGA
CTCAAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCTCTTCTTCTACCTCTACCCTCTCCAACTTCTCCTGGT
CTTCACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGGGAAGTGGAACTTTGGTAAATGACTGTTTGCCTCATT
TAATAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCTCAGCAAGTACTGGTTATATTCTTTTTTTGTAAGGAA
GATCATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACCTAGTCCTGATTTTTGTATTAATTGGTTCCCTTTAGC
AAGGGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGCAGATAGATGGTCTCTAGCCTATTGTATTCTTAGACC
AAAAATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTATGTGCTGGTACTTAAAGAGTACATTCTGCCTTGCTGT
AGTGAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAGGTTGCCAGTGTTGCTGCCCATGATGAGTTATTTGCC
TCTGAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAAGAAAGAACCACAAGCCTCCCAAGTATTTGGGTTCTA
TCTTAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATGTGTCTTCTTTCCTCCAACCTCTTACCTTAGATGCAT
CCTGGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCTCCAGTCTGTGAGGATACATAACATTTTCTCTACAAT
GAATCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGACAGGGTTTCACTATGTTGCCCAGGCTGGTCTCAAAC
TCCTGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAGGTGTGTGCTACCGTGCCTGGCACTTTTTTGCCTTCT
TAATGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTATCTACTCTACCTTCCCTCTGCTCTCCTCCCTCCCTAT
CCTACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTTTTATGCTGCTTCGCTTTTCTCTAAACAGATCTGATA
TTGCTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGAATCAAAATGCATTGTTGCATTAAGCTTTTTCAATAA
AGGAAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGTTCTAAACTCTATATATACATATATATATATATATCT
ATATATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACACTTCTAAAGATCACCATTTCTGAGAAGTTCTTGGAA

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000446544_chr7_129019482_+_6740nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGAAATGACCATTAAGAAGTAGATGCCCAGATGCAAAAGTGATGAAACAGTCCA
TTTGTCATAAAGTAAGATGCAGCTGTGGCATGTCAACCAGCTTGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGTT
AAATCAGCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCT
AGTGCACACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTT
TAAGGTCATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAA
ACGTGACTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCA
AACTGGACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAA
TGTGGTGGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATT
TGCTGCTCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGG
AAGTGCTCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGG
TGTGCAAGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGA
ACCAAGTAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCA
GTTAATGGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGA
CAGTGATGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAG
GAGAGGTCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAA
TCTACCATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGG
CTACCATAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAG
GCGTCGGGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTT
GGAAGGTGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTA
TGCCGTGATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACA
CAATAGTACTGATCTGCCCATGTGAGCCTGGAAAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACG
TCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATC
GCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAAT
TGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGG
TTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTA
TTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTG
GTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAA
GTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAA
GCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGG
ACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCT
GAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATT
AAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAA
TAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAG
ATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGT
GCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGA
TGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGA
ACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTT
TAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGCTC
ACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGTAGTGTTGGCCCAGAGTGTGGTTACTGCCCTGAGGGCCAT
GAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCCCAGTGCATCATTTGCATCATTCCCCATTGACTGAATCCT
CAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGATTCCATACTCCCTATTCCCTGGAGTTTTCTGGAATAAATT
TTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGGAATTAACATGGCCAGTGTTTCACACAAGATTGGGTTCCC
AATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAAGGAGTGTTATTTATGGCTTTGCCAAGCTACATCAAGAAC
TCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTTCTTCTCCTTGAATATTTATGTCCATTTTAACACTTCCTG
GTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGTCAGACATTTGTTCTGCTGTCTTTCTAATCCAGCCAACGT
CTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTTGTCATTTGATTGGATAGTTTCCAAGGAAGCCCCTCCAGA
TTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAAACTTCCTGCTATTGCCTAAAGCTACGTCTGAAACTGAGT
AGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGGGACAGGTCTTTCAGACTCACAGCTTGATACCCTAACAAA
GCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCTGAGGGATACAGAGATGAAATTGTAAACTGTATCCAGATT
ATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGGCCATTGCCATGGATGAAACCGAGATCTGCAGTCTGATCT
GTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGATGATTCTGTATTTCAGAGTCAGTTTCTTGAGTAACTCCAG
TGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTCCCACCCAAAAATTGGATTCCTTTTGGAGACTGATCTGTT
GGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGACTGGCCCTAGGAAACTTGAATTAAATAAGCCTCTTCCCCT
TACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCTATGCTGGTCTGCCTCAAAGTCTCAAGACCAAGGTGACTC
AAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCTCTTCTTCTACCTCTACCCTCTCCAACTTCTCCTGGTCTT
CACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGGGAAGTGGAACTTTGGTAAATGACTGTTTGCCTCATTTAA
TAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCTCAGCAAGTACTGGTTATATTCTTTTTTTGTAAGGAAGAT
CATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACCTAGTCCTGATTTTTGTATTAATTGGTTCCCTTTAGCAAG
GGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGCAGATAGATGGTCTCTAGCCTATTGTATTCTTAGACCAAA
AATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTATGTGCTGGTACTTAAAGAGTACATTCTGCCTTGCTGTAGT
GAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAGGTTGCCAGTGTTGCTGCCCATGATGAGTTATTTGCCTCT
GAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAAGAAAGAACCACAAGCCTCCCAAGTATTTGGGTTCTATCT
TAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATGTGTCTTCTTTCCTCCAACCTCTTACCTTAGATGCATCCT
GGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCTCCAGTCTGTGAGGATACATAACATTTTCTCTACAATGAA
TCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGACAGGGTTTCACTATGTTGCCCAGGCTGGTCTCAAACTCC
TGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAGGTGTGTGCTACCGTGCCTGGCACTTTTTTGCCTTCTTAA
TGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTATCTACTCTACCTTCCCTCTGCTCTCCTCCCTCCCTATCCT
ACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTTTTATGCTGCTTCGCTTTTCTCTAAACAGATCTGATATTG
CTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGAATCAAAATGCATTGTTGCATTAAGCTTTTTCAATAAAGG
AAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGTTCTAAACTCTATATATACATATATATATATATATCTATA
TATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACACTTCTAAAGATCACCATTTCTGAGAAGTTCTTGGAAATC

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000531335_chr7_129019482_+_6739nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGAAATGACCATTAAGAAGTAGATGCCCAGATGCAAAAGTGATGAAACAGTCCA
TTTGTCATAAAGTAAGATGCAGCTGTGGCATGTCAACCAGCTTGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGTT
AAATCAGCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCT
AGTGCACACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTT
TAAGGTCATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAA
ACGTGACTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCA
AACTGGACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAA
TGTGGTGGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATT
TGCTGCTCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGG
AAGTGCTCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGG
TGTGCAAGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGA
ACCAAGTAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCA
GTTAATGGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGA
CAGTGATGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAG
GAGAGGTCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAA
TCTACCATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGG
CTACCATAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAG
GCGTCGGGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTT
GGAAGGTGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTA
TGCCGTGATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACA
CAATAGTACTGATCTGCCCATGTGAGCCTGGAAAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACG
TCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATC
GCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAAT
TGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGG
TTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTA
TTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTG
GTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAA
GTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAA
GCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGG
ACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCT
GAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATT
AAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAA
TAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAG
ATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGT
GCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGA
TGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGA
ACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTT
TAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGCTC
ACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGTAGTGTTGGCCCAGAGTGTGGTTACTGCCCTGAGGGCCAT
GAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCCCAGTGCATCATTTGCATCATTCCCCATTGACTGAATCCT
CAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGATTCCATACTCCCTATTCCCTGGAGTTTTCTGGAATAAATT
TTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGGAATTAACATGGCCAGTGTTTCACACAAGATTGGGTTCCC
AATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAAGGAGTGTTATTTATGGCTTTGCCAAGCTACATCAAGAAC
TCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTTCTTCTCCTTGAATATTTATGTCCATTTTAACACTTCCTG
GTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGTCAGACATTTGTTCTGCTGTCTTTCTAATCCAGCCAACGT
CTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTTGTCATTTGATTGGATAGTTTCCAAGGAAGCCCCTCCAGA
TTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAAACTTCCTGCTATTGCCTAAAGCTACGTCTGAAACTGAGT
AGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGGGACAGGTCTTTCAGACTCACAGCTTGATACCCTAACAAA
GCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCTGAGGGATACAGAGATGAAATTGTAAACTGTATCCAGATT
ATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGGCCATTGCCATGGATGAAACCGAGATCTGCAGTCTGATCT
GTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGATGATTCTGTATTTCAGAGTCAGTTTCTTGAGTAACTCCAG
TGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTCCCACCCAAAAATTGGATTCCTTTTGGAGACTGATCTGTT
GGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGACTGGCCCTAGGAAACTTGAATTAAATAAGCCTCTTCCCCT
TACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCTATGCTGGTCTGCCTCAAAGTCTCAAGACCAAGGTGACTC
AAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCTCTTCTTCTACCTCTACCCTCTCCAACTTCTCCTGGTCTT
CACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGGGAAGTGGAACTTTGGTAAATGACTGTTTGCCTCATTTAA
TAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCTCAGCAAGTACTGGTTATATTCTTTTTTTGTAAGGAAGAT
CATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACCTAGTCCTGATTTTTGTATTAATTGGTTCCCTTTAGCAAG
GGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGCAGATAGATGGTCTCTAGCCTATTGTATTCTTAGACCAAA
AATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTATGTGCTGGTACTTAAAGAGTACATTCTGCCTTGCTGTAGT
GAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAGGTTGCCAGTGTTGCTGCCCATGATGAGTTATTTGCCTCT
GAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAAGAAAGAACCACAAGCCTCCCAAGTATTTGGGTTCTATCT
TAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATGTGTCTTCTTTCCTCCAACCTCTTACCTTAGATGCATCCT
GGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCTCCAGTCTGTGAGGATACATAACATTTTCTCTACAATGAA
TCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGACAGGGTTTCACTATGTTGCCCAGGCTGGTCTCAAACTCC
TGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAGGTGTGTGCTACCGTGCCTGGCACTTTTTTGCCTTCTTAA
TGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTATCTACTCTACCTTCCCTCTGCTCTCCTCCCTCCCTATCCT
ACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTTTTATGCTGCTTCGCTTTTCTCTAAACAGATCTGATATTG
CTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGAATCAAAATGCATTGTTGCATTAAGCTTTTTCAATAAAGG
AAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGTTCTAAACTCTATATATACATATATATATATATATCTATA
TATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACACTTCTAAAGATCACCATTTCTGAGAAGTTCTTGGAAATC

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000474594_chr7_129019482_+_3740nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGAAATGACCATTAAGAAGTAGATGCCCAGATGCAAAAGTGATGAAACAGTCCA
TTTGTCATAAAGTAAGATGCAGCTGTGGCATGTCAACCAGCTTGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGTT
AAATCAGCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCT
AGTGCACACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTT
TAAGGTCATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAA
ACGTGACTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCA
AACTGGACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAA
TGTGGTGGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATT
TGCTGCTCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGG
AAGTGCTCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGG
TGTGCAAGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGA
ACCAAGTAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCA
GTTAATGGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGA
CAGTGATGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAG
GAGAGGTCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAA
TCTACCATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGG
CTACCATAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAG
GCGTCGGGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTT
GGAAGGTGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTA
TGCCGTGATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACA
CAATAGTACTGATCTGCCCATGTGAGCCTGGAAAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACG
TCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATC
GCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAAT
TGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGG
TTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTA
TTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTG
GTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAA
GTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAA
GCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGG
ACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCT
GAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATT
AAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAA
TAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAG
ATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGT
GCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGA
TGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGA
ACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTT
TAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGCTC

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000446212_chr7_129019482_+_6742nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGAAATGACCATTAAGAAGTAGATGCCCAGATGCAAAAGTGATGAAACAGTCCA
TTTGTCATAAAGTAAGATGCAGCTGTGGCATGTCAACCAGCTTGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGTT
AAATCAGCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCT
AGTGCACACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTT
TAAGGTCATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAA
ACGTGACTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCA
AACTGGACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAA
TGTGGTGGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATT
TGCTGCTCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGG
AAGTGCTCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGG
TGTGCAAGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGA
ACCAAGTAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCA
GTTAATGGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGA
CAGTGATGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAG
GAGAGGTCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAA
TCTACCATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGG
CTACCATAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAG
GCGTCGGGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTT
GGAAGGTGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTA
TGCCGTGATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACA
CAATAGTACTGATCTGCCCATGTGAGCCTGGAAACAGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGG
ACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGAC
ATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGA
AATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGT
GGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACAT
CTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTG
GTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAA
AAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGG
GAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGA
TGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGC
CCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAA
ATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAA
GAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGT
GAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCAC
AGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCA
GGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGA
TGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAAT
TTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTG
CTCACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGTAGTGTTGGCCCAGAGTGTGGTTACTGCCCTGAGGGC
CATGAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCCCAGTGCATCATTTGCATCATTCCCCATTGACTGAAT
CCTCAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGATTCCATACTCCCTATTCCCTGGAGTTTTCTGGAATAA
ATTTTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGGAATTAACATGGCCAGTGTTTCACACAAGATTGGGTT
CCCAATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAAGGAGTGTTATTTATGGCTTTGCCAAGCTACATCAAG
AACTCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTTCTTCTCCTTGAATATTTATGTCCATTTTAACACTTC
CTGGTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGTCAGACATTTGTTCTGCTGTCTTTCTAATCCAGCCAA
CGTCTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTTGTCATTTGATTGGATAGTTTCCAAGGAAGCCCCTCC
AGATTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAAACTTCCTGCTATTGCCTAAAGCTACGTCTGAAACTG
AGTAGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGGGACAGGTCTTTCAGACTCACAGCTTGATACCCTAAC
AAAGCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCTGAGGGATACAGAGATGAAATTGTAAACTGTATCCAG
ATTATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGGCCATTGCCATGGATGAAACCGAGATCTGCAGTCTGA
TCTGTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGATGATTCTGTATTTCAGAGTCAGTTTCTTGAGTAACTC
CAGTGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTCCCACCCAAAAATTGGATTCCTTTTGGAGACTGATCT
GTTGGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGACTGGCCCTAGGAAACTTGAATTAAATAAGCCTCTTCC
CCTTACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCTATGCTGGTCTGCCTCAAAGTCTCAAGACCAAGGTGA
CTCAAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCTCTTCTTCTACCTCTACCCTCTCCAACTTCTCCTGGT
CTTCACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGGGAAGTGGAACTTTGGTAAATGACTGTTTGCCTCATT
TAATAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCTCAGCAAGTACTGGTTATATTCTTTTTTTGTAAGGAA
GATCATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACCTAGTCCTGATTTTTGTATTAATTGGTTCCCTTTAGC
AAGGGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGCAGATAGATGGTCTCTAGCCTATTGTATTCTTAGACC
AAAAATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTATGTGCTGGTACTTAAAGAGTACATTCTGCCTTGCTGT
AGTGAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAGGTTGCCAGTGTTGCTGCCCATGATGAGTTATTTGCC
TCTGAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAAGAAAGAACCACAAGCCTCCCAAGTATTTGGGTTCTA
TCTTAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATGTGTCTTCTTTCCTCCAACCTCTTACCTTAGATGCAT
CCTGGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCTCCAGTCTGTGAGGATACATAACATTTTCTCTACAAT
GAATCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGACAGGGTTTCACTATGTTGCCCAGGCTGGTCTCAAAC
TCCTGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAGGTGTGTGCTACCGTGCCTGGCACTTTTTTGCCTTCT
TAATGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTATCTACTCTACCTTCCCTCTGCTCTCCTCCCTCCCTAT
CCTACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTTTTATGCTGCTTCGCTTTTCTCTAAACAGATCTGATA
TTGCTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGAATCAAAATGCATTGTTGCATTAAGCTTTTTCAATAA
AGGAAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGTTCTAAACTCTATATATACATATATATATATATATCT
ATATATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACACTTCTAAAGATCACCATTTCTGAGAAGTTCTTGGAA

>In-frame_FRS2_ENST00000549921_chr12_69967865_+_AHCYL2_ENST00000490911_chr7_129019482_+_3704nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGAAATGACCATTAAGAAGTAGATGCCCAGATGCAAAAGTGATGAAACAGTCCA
TTTGTCATAAAGTAAGATGCAGCTGTGGCATGTCAACCAGCTTGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGTT
AAATCAGCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCT
AGTGCACACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTT
TAAGGTCATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAA
ACGTGACTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCA
AACTGGACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAA
TGTGGTGGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATT
TGCTGCTCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGG
AAGTGCTCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGG
TGTGCAAGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGA
ACCAAGTAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCA
GTTAATGGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGA
CAGTGATGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAG
GAGAGGTCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAA
TCTACCATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGG
CTACCATAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAG
GCGTCGGGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTT
GGAAGGTGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTA
TGCCGTGATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACA
CAATAGTACTGATCTGCCCATGTGAGCCTGGAAAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACG
TCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATC
GCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAAT
TGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGG
TTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTA
TTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTG
GTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAA
GTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAA
GCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGG
ACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCT
GAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATT
AAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAA
TAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAG
ATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGT
GCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGA
TGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGA
ACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTT
TAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGCTC

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000325006_chr7_129019482_+_11422nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGGTTAAATCAGCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCC
TGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCACACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGT
CCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATA
ATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTAT
GACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTA
TTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTG
GAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGA
GATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTT
GTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAG
GCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAA
GGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGT
GGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAA
AATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAAC
AACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGAT
GAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAAT
GTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCA
AGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACA
ACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAA
GCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCCTGGAAAGCATTGTGTTGTTTG
CACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTTTATAGACTGATAAAATTTTTT
TCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACTAATTTCATTATATACTACTCG
TTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGTTGATTTTTATCAATATTCTGG
ACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAATGTACATTGCTAACAGGTAAC
TATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAGGAATCCTTTATTTCATTAATT
AATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAGTCAGCTCCTTTGCCTTCAGTG
TTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACAAGATTTTCTATTTACTCATCT
CATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGTCACTTTACCCAAAAACATTTG
AAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAGGCATTTGTGCCATTAGGTTTC
CATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATTTAAAATGTTTGAGTTTGTATA
TAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAGGTTCATTTGGAACTTACTGTT
AGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAACATTCTCCAATTCTAAATTTGC
TTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCCCTCAAGGTGTACCGTGTTGTC
TCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCCCACTCTAGTGTTCCTCAGCTC
TGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGCCAGCATAGCAGGTACAGTGGA
AGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAGAGTCTCCATATGTCAAACTCT
TGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTTAGGTAACCTTGCAAAATATTT
TACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAATTTAGCATGAAAAAGTTTTAG
TCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGTGGGATCATTATAAAGAAAATA
AATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGTATTTTATCATTCTATGTGCAT
AGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTCTTAAAAGAGAGCAGTGGTATA
GGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAAATTGCTAATTGTGCCAAATTT
ATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGCCAGTCAAGGCAGAACATTAAT
CTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCATCCTTTTCATTGTTTCCCCCGG
ATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTATGTGCTTTAAAAAGGAAAATG
GGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGGTGTTAATTTCTAGATATTTTC
TAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTAGTAATGGGCATTAAGCTGTGT
CCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATTGTGGCCATATATCTCAGATTT
TCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAATATAATCATTGTTAATGTTTT
CCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAACTGATATTGGTATTACTTGTG
TTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTCCCTCCAGGAAGACTGGCAAAT
ATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAAGCTTTTCACTTCTCAGTATAT
CCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGTTGACCCTCTCCAGCGTTCAAT
GTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATAAAAATGTACCTCAATAATGTT
CTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCTCAAGGTAAAGGTTTTAACAGA
TGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTGTAGTGTGTGTGTATAAATACA
TATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTCATATTTCTGATGTGTGAGGTA
TATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGAATGTAAAGAAAATGTTTTTGG
CTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTTTCCTGTTCTTTACATCCCTGT
TCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCTATGGCAATTGGACAGTTATAG
CATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAATATACATTTTATAAAGGACAA
ACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCATTATAAATGTTTTTTTCCTAC
GTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAAAAATTGTCCAACAGTGGGACT
ACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCATATTTCTCTAATAAAAAGACAT
AAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTTGCATTTTTAATATTGGCAAAA
CGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTCCCACCCTTTGTTCTCTATTTC
TCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGAGTGTGGCTTTTTGGAGGAAGT
GGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCATCAGGCATGAAAAGTTTTCTCA
TATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACAACTAATTTTTTTTATCTTTGG
AGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATTTAGTTCAAGGGCTAAGCAACA
CATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTAATATTAGATGACTTTGGATTT
TGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGCTGAGCTGATCATACACTGACC
TGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCCCTTATTGCTGAAAGTAGATTG
CAATAAAACCCCAATAAAACGTTTGGTCGGATACAGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGA
CGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACA
TCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAA
ATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTG
GGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATC
TATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGG
TGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAA
AAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGG
AAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGAT
GGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCC
CTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAA
TTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAG
AATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTG
AGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACA
GTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAG
GATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGAT
GAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATT
TTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGC
TCACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGTAGTGTTGGCCCAGAGTGTGGTTACTGCCCTGAGGGCC
ATGAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCCCAGTGCATCATTTGCATCATTCCCCATTGACTGAATC
CTCAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGATTCCATACTCCCTATTCCCTGGAGTTTTCTGGAATAAA
TTTTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGGAATTAACATGGCCAGTGTTTCACACAAGATTGGGTTC
CCAATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAAGGAGTGTTATTTATGGCTTTGCCAAGCTACATCAAGA
ACTCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTTCTTCTCCTTGAATATTTATGTCCATTTTAACACTTCC
TGGTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGTCAGACATTTGTTCTGCTGTCTTTCTAATCCAGCCAAC
GTCTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTTGTCATTTGATTGGATAGTTTCCAAGGAAGCCCCTCCA
GATTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAAACTTCCTGCTATTGCCTAAAGCTACGTCTGAAACTGA
GTAGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGGGACAGGTCTTTCAGACTCACAGCTTGATACCCTAACA
AAGCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCTGAGGGATACAGAGATGAAATTGTAAACTGTATCCAGA
TTATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGGCCATTGCCATGGATGAAACCGAGATCTGCAGTCTGAT
CTGTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGATGATTCTGTATTTCAGAGTCAGTTTCTTGAGTAACTCC
AGTGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTCCCACCCAAAAATTGGATTCCTTTTGGAGACTGATCTG
TTGGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGACTGGCCCTAGGAAACTTGAATTAAATAAGCCTCTTCCC
CTTACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCTATGCTGGTCTGCCTCAAAGTCTCAAGACCAAGGTGAC
TCAAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCTCTTCTTCTACCTCTACCCTCTCCAACTTCTCCTGGTC
TTCACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGGGAAGTGGAACTTTGGTAAATGACTGTTTGCCTCATTT
AATAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCTCAGCAAGTACTGGTTATATTCTTTTTTTGTAAGGAAG
ATCATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACCTAGTCCTGATTTTTGTATTAATTGGTTCCCTTTAGCA
AGGGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGCAGATAGATGGTCTCTAGCCTATTGTATTCTTAGACCA
AAAATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTATGTGCTGGTACTTAAAGAGTACATTCTGCCTTGCTGTA
GTGAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAGGTTGCCAGTGTTGCTGCCCATGATGAGTTATTTGCCT
CTGAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAAGAAAGAACCACAAGCCTCCCAAGTATTTGGGTTCTAT
CTTAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATGTGTCTTCTTTCCTCCAACCTCTTACCTTAGATGCATC
CTGGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCTCCAGTCTGTGAGGATACATAACATTTTCTCTACAATG
AATCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGACAGGGTTTCACTATGTTGCCCAGGCTGGTCTCAAACT
CCTGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAGGTGTGTGCTACCGTGCCTGGCACTTTTTTGCCTTCTT
AATGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTATCTACTCTACCTTCCCTCTGCTCTCCTCCCTCCCTATC
CTACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTTTTATGCTGCTTCGCTTTTCTCTAAACAGATCTGATAT
TGCTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGAATCAAAATGCATTGTTGCATTAAGCTTTTTCAATAAA
GGAAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGTTCTAAACTCTATATATACATATATATATATATATCTA
TATATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACACTTCTAAAGATCACCATTTCTGAGAAGTTCTTGGAAA

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000446544_chr7_129019482_+_11419nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGGTTAAATCAGCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCC
TGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCACACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGT
CCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATA
ATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTAT
GACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTA
TTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTG
GAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGA
GATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTT
GTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAG
GCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAA
GGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGT
GGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAA
AATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAAC
AACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGAT
GAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAAT
GTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCA
AGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACA
ACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAA
GCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCCTGGAAAGCATTGTGTTGTTTG
CACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTTTATAGACTGATAAAATTTTTT
TCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACTAATTTCATTATATACTACTCG
TTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGTTGATTTTTATCAATATTCTGG
ACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAATGTACATTGCTAACAGGTAAC
TATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAGGAATCCTTTATTTCATTAATT
AATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAGTCAGCTCCTTTGCCTTCAGTG
TTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACAAGATTTTCTATTTACTCATCT
CATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGTCACTTTACCCAAAAACATTTG
AAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAGGCATTTGTGCCATTAGGTTTC
CATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATTTAAAATGTTTGAGTTTGTATA
TAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAGGTTCATTTGGAACTTACTGTT
AGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAACATTCTCCAATTCTAAATTTGC
TTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCCCTCAAGGTGTACCGTGTTGTC
TCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCCCACTCTAGTGTTCCTCAGCTC
TGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGCCAGCATAGCAGGTACAGTGGA
AGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAGAGTCTCCATATGTCAAACTCT
TGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTTAGGTAACCTTGCAAAATATTT
TACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAATTTAGCATGAAAAAGTTTTAG
TCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGTGGGATCATTATAAAGAAAATA
AATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGTATTTTATCATTCTATGTGCAT
AGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTCTTAAAAGAGAGCAGTGGTATA
GGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAAATTGCTAATTGTGCCAAATTT
ATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGCCAGTCAAGGCAGAACATTAAT
CTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCATCCTTTTCATTGTTTCCCCCGG
ATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTATGTGCTTTAAAAAGGAAAATG
GGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGGTGTTAATTTCTAGATATTTTC
TAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTAGTAATGGGCATTAAGCTGTGT
CCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATTGTGGCCATATATCTCAGATTT
TCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAATATAATCATTGTTAATGTTTT
CCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAACTGATATTGGTATTACTTGTG
TTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTCCCTCCAGGAAGACTGGCAAAT
ATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAAGCTTTTCACTTCTCAGTATAT
CCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGTTGACCCTCTCCAGCGTTCAAT
GTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATAAAAATGTACCTCAATAATGTT
CTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCTCAAGGTAAAGGTTTTAACAGA
TGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTGTAGTGTGTGTGTATAAATACA
TATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTCATATTTCTGATGTGTGAGGTA
TATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGAATGTAAAGAAAATGTTTTTGG
CTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTTTCCTGTTCTTTACATCCCTGT
TCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCTATGGCAATTGGACAGTTATAG
CATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAATATACATTTTATAAAGGACAA
ACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCATTATAAATGTTTTTTTCCTAC
GTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAAAAATTGTCCAACAGTGGGACT
ACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCATATTTCTCTAATAAAAAGACAT
AAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTTGCATTTTTAATATTGGCAAAA
CGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTCCCACCCTTTGTTCTCTATTTC
TCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGAGTGTGGCTTTTTGGAGGAAGT
GGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCATCAGGCATGAAAAGTTTTCTCA
TATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACAACTAATTTTTTTTATCTTTGG
AGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATTTAGTTCAAGGGCTAAGCAACA
CATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTAATATTAGATGACTTTGGATTT
TGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGCTGAGCTGATCATACACTGACC
TGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCCCTTATTGCTGAAAGTAGATTG
CAATAAAACCCCAATAAAACGTTTGGTCGGATAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGT
CGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCG
CCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATT
GAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGT
TGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTAT
TCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGG
TGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAG
TATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAG
CTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGA
CTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTG
AAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTA
AATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAAT
AGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGA
TCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTG
CCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGAT
GTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAA
CAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTTT
AAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGCTCA
CCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGTAGTGTTGGCCCAGAGTGTGGTTACTGCCCTGAGGGCCATG
AAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCCCAGTGCATCATTTGCATCATTCCCCATTGACTGAATCCTC
AGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGATTCCATACTCCCTATTCCCTGGAGTTTTCTGGAATAAATTT
TCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGGAATTAACATGGCCAGTGTTTCACACAAGATTGGGTTCCCA
ATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAAGGAGTGTTATTTATGGCTTTGCCAAGCTACATCAAGAACT
CAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTTCTTCTCCTTGAATATTTATGTCCATTTTAACACTTCCTGG
TTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGTCAGACATTTGTTCTGCTGTCTTTCTAATCCAGCCAACGTC
TGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTTGTCATTTGATTGGATAGTTTCCAAGGAAGCCCCTCCAGAT
TGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAAACTTCCTGCTATTGCCTAAAGCTACGTCTGAAACTGAGTA
GGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGGGACAGGTCTTTCAGACTCACAGCTTGATACCCTAACAAAG
CAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCTGAGGGATACAGAGATGAAATTGTAAACTGTATCCAGATTA
TCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGGCCATTGCCATGGATGAAACCGAGATCTGCAGTCTGATCTG
TGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGATGATTCTGTATTTCAGAGTCAGTTTCTTGAGTAACTCCAGT
GCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTCCCACCCAAAAATTGGATTCCTTTTGGAGACTGATCTGTTG
GTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGACTGGCCCTAGGAAACTTGAATTAAATAAGCCTCTTCCCCTT
ACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCTATGCTGGTCTGCCTCAAAGTCTCAAGACCAAGGTGACTCA
AGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCTCTTCTTCTACCTCTACCCTCTCCAACTTCTCCTGGTCTTC
ACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGGGAAGTGGAACTTTGGTAAATGACTGTTTGCCTCATTTAAT
AGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCTCAGCAAGTACTGGTTATATTCTTTTTTTGTAAGGAAGATC
ATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACCTAGTCCTGATTTTTGTATTAATTGGTTCCCTTTAGCAAGG
GATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGCAGATAGATGGTCTCTAGCCTATTGTATTCTTAGACCAAAA
ATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTATGTGCTGGTACTTAAAGAGTACATTCTGCCTTGCTGTAGTG
AAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAGGTTGCCAGTGTTGCTGCCCATGATGAGTTATTTGCCTCTG
AGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAAGAAAGAACCACAAGCCTCCCAAGTATTTGGGTTCTATCTT
AGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATGTGTCTTCTTTCCTCCAACCTCTTACCTTAGATGCATCCTG
GTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCTCCAGTCTGTGAGGATACATAACATTTTCTCTACAATGAAT
CTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGACAGGGTTTCACTATGTTGCCCAGGCTGGTCTCAAACTCCT
GGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAGGTGTGTGCTACCGTGCCTGGCACTTTTTTGCCTTCTTAAT
GGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTATCTACTCTACCTTCCCTCTGCTCTCCTCCCTCCCTATCCTA
CTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTTTTATGCTGCTTCGCTTTTCTCTAAACAGATCTGATATTGC
TGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGAATCAAAATGCATTGTTGCATTAAGCTTTTTCAATAAAGGA
AAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGTTCTAAACTCTATATATACATATATATATATATATCTATAT
ATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACACTTCTAAAGATCACCATTTCTGAGAAGTTCTTGGAAATCT

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000531335_chr7_129019482_+_11418nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGGTTAAATCAGCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCC
TGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCACACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGT
CCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATA
ATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTAT
GACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTA
TTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTG
GAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGA
GATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTT
GTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAG
GCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAA
GGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGT
GGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAA
AATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAAC
AACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGAT
GAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAAT
GTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCA
AGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACA
ACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAA
GCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCCTGGAAAGCATTGTGTTGTTTG
CACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTTTATAGACTGATAAAATTTTTT
TCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACTAATTTCATTATATACTACTCG
TTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGTTGATTTTTATCAATATTCTGG
ACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAATGTACATTGCTAACAGGTAAC
TATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAGGAATCCTTTATTTCATTAATT
AATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAGTCAGCTCCTTTGCCTTCAGTG
TTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACAAGATTTTCTATTTACTCATCT
CATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGTCACTTTACCCAAAAACATTTG
AAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAGGCATTTGTGCCATTAGGTTTC
CATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATTTAAAATGTTTGAGTTTGTATA
TAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAGGTTCATTTGGAACTTACTGTT
AGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAACATTCTCCAATTCTAAATTTGC
TTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCCCTCAAGGTGTACCGTGTTGTC
TCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCCCACTCTAGTGTTCCTCAGCTC
TGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGCCAGCATAGCAGGTACAGTGGA
AGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAGAGTCTCCATATGTCAAACTCT
TGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTTAGGTAACCTTGCAAAATATTT
TACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAATTTAGCATGAAAAAGTTTTAG
TCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGTGGGATCATTATAAAGAAAATA
AATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGTATTTTATCATTCTATGTGCAT
AGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTCTTAAAAGAGAGCAGTGGTATA
GGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAAATTGCTAATTGTGCCAAATTT
ATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGCCAGTCAAGGCAGAACATTAAT
CTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCATCCTTTTCATTGTTTCCCCCGG
ATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTATGTGCTTTAAAAAGGAAAATG
GGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGGTGTTAATTTCTAGATATTTTC
TAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTAGTAATGGGCATTAAGCTGTGT
CCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATTGTGGCCATATATCTCAGATTT
TCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAATATAATCATTGTTAATGTTTT
CCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAACTGATATTGGTATTACTTGTG
TTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTCCCTCCAGGAAGACTGGCAAAT
ATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAAGCTTTTCACTTCTCAGTATAT
CCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGTTGACCCTCTCCAGCGTTCAAT
GTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATAAAAATGTACCTCAATAATGTT
CTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCTCAAGGTAAAGGTTTTAACAGA
TGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTGTAGTGTGTGTGTATAAATACA
TATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTCATATTTCTGATGTGTGAGGTA
TATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGAATGTAAAGAAAATGTTTTTGG
CTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTTTCCTGTTCTTTACATCCCTGT
TCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCTATGGCAATTGGACAGTTATAG
CATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAATATACATTTTATAAAGGACAA
ACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCATTATAAATGTTTTTTTCCTAC
GTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAAAAATTGTCCAACAGTGGGACT
ACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCATATTTCTCTAATAAAAAGACAT
AAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTTGCATTTTTAATATTGGCAAAA
CGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTCCCACCCTTTGTTCTCTATTTC
TCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGAGTGTGGCTTTTTGGAGGAAGT
GGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCATCAGGCATGAAAAGTTTTCTCA
TATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACAACTAATTTTTTTTATCTTTGG
AGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATTTAGTTCAAGGGCTAAGCAACA
CATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTAATATTAGATGACTTTGGATTT
TGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGCTGAGCTGATCATACACTGACC
TGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCCCTTATTGCTGAAAGTAGATTG
CAATAAAACCCCAATAAAACGTTTGGTCGGATAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGT
CGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCG
CCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATT
GAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGT
TGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTAT
TCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGG
TGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAG
TATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAG
CTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGA
CTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTG
AAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTA
AATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAAT
AGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGA
TCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTG
CCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGAT
GTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAA
CAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTTT
AAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGCTCA
CCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGTAGTGTTGGCCCAGAGTGTGGTTACTGCCCTGAGGGCCATG
AAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCCCAGTGCATCATTTGCATCATTCCCCATTGACTGAATCCTC
AGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGATTCCATACTCCCTATTCCCTGGAGTTTTCTGGAATAAATTT
TCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGGAATTAACATGGCCAGTGTTTCACACAAGATTGGGTTCCCA
ATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAAGGAGTGTTATTTATGGCTTTGCCAAGCTACATCAAGAACT
CAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTTCTTCTCCTTGAATATTTATGTCCATTTTAACACTTCCTGG
TTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGTCAGACATTTGTTCTGCTGTCTTTCTAATCCAGCCAACGTC
TGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTTGTCATTTGATTGGATAGTTTCCAAGGAAGCCCCTCCAGAT
TGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAAACTTCCTGCTATTGCCTAAAGCTACGTCTGAAACTGAGTA
GGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGGGACAGGTCTTTCAGACTCACAGCTTGATACCCTAACAAAG
CAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCTGAGGGATACAGAGATGAAATTGTAAACTGTATCCAGATTA
TCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGGCCATTGCCATGGATGAAACCGAGATCTGCAGTCTGATCTG
TGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGATGATTCTGTATTTCAGAGTCAGTTTCTTGAGTAACTCCAGT
GCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTCCCACCCAAAAATTGGATTCCTTTTGGAGACTGATCTGTTG
GTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGACTGGCCCTAGGAAACTTGAATTAAATAAGCCTCTTCCCCTT
ACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCTATGCTGGTCTGCCTCAAAGTCTCAAGACCAAGGTGACTCA
AGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCTCTTCTTCTACCTCTACCCTCTCCAACTTCTCCTGGTCTTC
ACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGGGAAGTGGAACTTTGGTAAATGACTGTTTGCCTCATTTAAT
AGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCTCAGCAAGTACTGGTTATATTCTTTTTTTGTAAGGAAGATC
ATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACCTAGTCCTGATTTTTGTATTAATTGGTTCCCTTTAGCAAGG
GATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGCAGATAGATGGTCTCTAGCCTATTGTATTCTTAGACCAAAA
ATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTATGTGCTGGTACTTAAAGAGTACATTCTGCCTTGCTGTAGTG
AAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAGGTTGCCAGTGTTGCTGCCCATGATGAGTTATTTGCCTCTG
AGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAAGAAAGAACCACAAGCCTCCCAAGTATTTGGGTTCTATCTT
AGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATGTGTCTTCTTTCCTCCAACCTCTTACCTTAGATGCATCCTG
GTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCTCCAGTCTGTGAGGATACATAACATTTTCTCTACAATGAAT
CTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGACAGGGTTTCACTATGTTGCCCAGGCTGGTCTCAAACTCCT
GGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAGGTGTGTGCTACCGTGCCTGGCACTTTTTTGCCTTCTTAAT
GGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTATCTACTCTACCTTCCCTCTGCTCTCCTCCCTCCCTATCCTA
CTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTTTTATGCTGCTTCGCTTTTCTCTAAACAGATCTGATATTGC
TGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGAATCAAAATGCATTGTTGCATTAAGCTTTTTCAATAAAGGA
AAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGTTCTAAACTCTATATATACATATATATATATATATCTATAT
ATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACACTTCTAAAGATCACCATTTCTGAGAAGTTCTTGGAAATCT

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000474594_chr7_129019482_+_8419nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGGTTAAATCAGCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCC
TGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCACACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGT
CCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATA
ATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTAT
GACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTA
TTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTG
GAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGA
GATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTT
GTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAG
GCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAA
GGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGT
GGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAA
AATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAAC
AACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGAT
GAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAAT
GTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCA
AGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACA
ACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAA
GCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCCTGGAAAGCATTGTGTTGTTTG
CACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTTTATAGACTGATAAAATTTTTT
TCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACTAATTTCATTATATACTACTCG
TTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGTTGATTTTTATCAATATTCTGG
ACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAATGTACATTGCTAACAGGTAAC
TATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAGGAATCCTTTATTTCATTAATT
AATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAGTCAGCTCCTTTGCCTTCAGTG
TTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACAAGATTTTCTATTTACTCATCT
CATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGTCACTTTACCCAAAAACATTTG
AAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAGGCATTTGTGCCATTAGGTTTC
CATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATTTAAAATGTTTGAGTTTGTATA
TAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAGGTTCATTTGGAACTTACTGTT
AGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAACATTCTCCAATTCTAAATTTGC
TTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCCCTCAAGGTGTACCGTGTTGTC
TCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCCCACTCTAGTGTTCCTCAGCTC
TGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGCCAGCATAGCAGGTACAGTGGA
AGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAGAGTCTCCATATGTCAAACTCT
TGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTTAGGTAACCTTGCAAAATATTT
TACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAATTTAGCATGAAAAAGTTTTAG
TCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGTGGGATCATTATAAAGAAAATA
AATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGTATTTTATCATTCTATGTGCAT
AGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTCTTAAAAGAGAGCAGTGGTATA
GGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAAATTGCTAATTGTGCCAAATTT
ATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGCCAGTCAAGGCAGAACATTAAT
CTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCATCCTTTTCATTGTTTCCCCCGG
ATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTATGTGCTTTAAAAAGGAAAATG
GGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGGTGTTAATTTCTAGATATTTTC
TAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTAGTAATGGGCATTAAGCTGTGT
CCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATTGTGGCCATATATCTCAGATTT
TCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAATATAATCATTGTTAATGTTTT
CCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAACTGATATTGGTATTACTTGTG
TTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTCCCTCCAGGAAGACTGGCAAAT
ATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAAGCTTTTCACTTCTCAGTATAT
CCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGTTGACCCTCTCCAGCGTTCAAT
GTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATAAAAATGTACCTCAATAATGTT
CTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCTCAAGGTAAAGGTTTTAACAGA
TGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTGTAGTGTGTGTGTATAAATACA
TATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTCATATTTCTGATGTGTGAGGTA
TATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGAATGTAAAGAAAATGTTTTTGG
CTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTTTCCTGTTCTTTACATCCCTGT
TCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCTATGGCAATTGGACAGTTATAG
CATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAATATACATTTTATAAAGGACAA
ACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCATTATAAATGTTTTTTTCCTAC
GTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAAAAATTGTCCAACAGTGGGACT
ACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCATATTTCTCTAATAAAAAGACAT
AAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTTGCATTTTTAATATTGGCAAAA
CGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTCCCACCCTTTGTTCTCTATTTC
TCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGAGTGTGGCTTTTTGGAGGAAGT
GGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCATCAGGCATGAAAAGTTTTCTCA
TATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACAACTAATTTTTTTTATCTTTGG
AGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATTTAGTTCAAGGGCTAAGCAACA
CATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTAATATTAGATGACTTTGGATTT
TGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGCTGAGCTGATCATACACTGACC
TGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCCCTTATTGCTGAAAGTAGATTG
CAATAAAACCCCAATAAAACGTTTGGTCGGATAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGT
CGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCG
CCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATT
GAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGT
TGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTAT
TCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGG
TGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAG
TATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAG
CTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGA
CTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTG
AAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTA
AATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAAT
AGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGA
TCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTG
CCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGAT
GTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAA
CAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTTT
AAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGCTCA

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000446212_chr7_129019482_+_11421nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGGTTAAATCAGCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCC
TGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCACACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGT
CCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATA
ATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTAT
GACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTA
TTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTG
GAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGA
GATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTT
GTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAG
GCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAA
GGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGT
GGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAA
AATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAAC
AACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGAT
GAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAAT
GTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCA
AGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACA
ACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAA
GCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCCTGGAAAGCATTGTGTTGTTTG
CACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTTTATAGACTGATAAAATTTTTT
TCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACTAATTTCATTATATACTACTCG
TTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGTTGATTTTTATCAATATTCTGG
ACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAATGTACATTGCTAACAGGTAAC
TATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAGGAATCCTTTATTTCATTAATT
AATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAGTCAGCTCCTTTGCCTTCAGTG
TTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACAAGATTTTCTATTTACTCATCT
CATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGTCACTTTACCCAAAAACATTTG
AAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAGGCATTTGTGCCATTAGGTTTC
CATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATTTAAAATGTTTGAGTTTGTATA
TAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAGGTTCATTTGGAACTTACTGTT
AGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAACATTCTCCAATTCTAAATTTGC
TTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCCCTCAAGGTGTACCGTGTTGTC
TCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCCCACTCTAGTGTTCCTCAGCTC
TGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGCCAGCATAGCAGGTACAGTGGA
AGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAGAGTCTCCATATGTCAAACTCT
TGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTTAGGTAACCTTGCAAAATATTT
TACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAATTTAGCATGAAAAAGTTTTAG
TCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGTGGGATCATTATAAAGAAAATA
AATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGTATTTTATCATTCTATGTGCAT
AGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTCTTAAAAGAGAGCAGTGGTATA
GGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAAATTGCTAATTGTGCCAAATTT
ATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGCCAGTCAAGGCAGAACATTAAT
CTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCATCCTTTTCATTGTTTCCCCCGG
ATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTATGTGCTTTAAAAAGGAAAATG
GGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGGTGTTAATTTCTAGATATTTTC
TAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTAGTAATGGGCATTAAGCTGTGT
CCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATTGTGGCCATATATCTCAGATTT
TCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAATATAATCATTGTTAATGTTTT
CCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAACTGATATTGGTATTACTTGTG
TTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTCCCTCCAGGAAGACTGGCAAAT
ATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAAGCTTTTCACTTCTCAGTATAT
CCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGTTGACCCTCTCCAGCGTTCAAT
GTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATAAAAATGTACCTCAATAATGTT
CTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCTCAAGGTAAAGGTTTTAACAGA
TGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTGTAGTGTGTGTGTATAAATACA
TATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTCATATTTCTGATGTGTGAGGTA
TATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGAATGTAAAGAAAATGTTTTTGG
CTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTTTCCTGTTCTTTACATCCCTGT
TCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCTATGGCAATTGGACAGTTATAG
CATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAATATACATTTTATAAAGGACAA
ACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCATTATAAATGTTTTTTTCCTAC
GTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAAAAATTGTCCAACAGTGGGACT
ACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCATATTTCTCTAATAAAAAGACAT
AAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTTGCATTTTTAATATTGGCAAAA
CGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTCCCACCCTTTGTTCTCTATTTC
TCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGAGTGTGGCTTTTTGGAGGAAGT
GGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCATCAGGCATGAAAAGTTTTCTCA
TATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACAACTAATTTTTTTTATCTTTGG
AGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATTTAGTTCAAGGGCTAAGCAACA
CATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTAATATTAGATGACTTTGGATTT
TGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGCTGAGCTGATCATACACTGACC
TGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCCCTTATTGCTGAAAGTAGATTG
CAATAAAACCCCAATAAAACGTTTGGTCGGATACAGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGA
CGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACA
TCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAA
ATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTG
GGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATC
TATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGG
TGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAA
AAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGG
AAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGAT
GGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCC
CTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAA
TTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAG
AATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTG
AGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACA
GTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAG
GATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGAT
GAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATT
TTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGC
TCACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGTAGTGTTGGCCCAGAGTGTGGTTACTGCCCTGAGGGCC
ATGAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCCCAGTGCATCATTTGCATCATTCCCCATTGACTGAATC
CTCAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGATTCCATACTCCCTATTCCCTGGAGTTTTCTGGAATAAA
TTTTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGGAATTAACATGGCCAGTGTTTCACACAAGATTGGGTTC
CCAATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAAGGAGTGTTATTTATGGCTTTGCCAAGCTACATCAAGA
ACTCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTTCTTCTCCTTGAATATTTATGTCCATTTTAACACTTCC
TGGTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGTCAGACATTTGTTCTGCTGTCTTTCTAATCCAGCCAAC
GTCTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTTGTCATTTGATTGGATAGTTTCCAAGGAAGCCCCTCCA
GATTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAAACTTCCTGCTATTGCCTAAAGCTACGTCTGAAACTGA
GTAGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGGGACAGGTCTTTCAGACTCACAGCTTGATACCCTAACA
AAGCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCTGAGGGATACAGAGATGAAATTGTAAACTGTATCCAGA
TTATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGGCCATTGCCATGGATGAAACCGAGATCTGCAGTCTGAT
CTGTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGATGATTCTGTATTTCAGAGTCAGTTTCTTGAGTAACTCC
AGTGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTCCCACCCAAAAATTGGATTCCTTTTGGAGACTGATCTG
TTGGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGACTGGCCCTAGGAAACTTGAATTAAATAAGCCTCTTCCC
CTTACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCTATGCTGGTCTGCCTCAAAGTCTCAAGACCAAGGTGAC
TCAAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCTCTTCTTCTACCTCTACCCTCTCCAACTTCTCCTGGTC
TTCACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGGGAAGTGGAACTTTGGTAAATGACTGTTTGCCTCATTT
AATAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCTCAGCAAGTACTGGTTATATTCTTTTTTTGTAAGGAAG
ATCATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACCTAGTCCTGATTTTTGTATTAATTGGTTCCCTTTAGCA
AGGGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGCAGATAGATGGTCTCTAGCCTATTGTATTCTTAGACCA
AAAATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTATGTGCTGGTACTTAAAGAGTACATTCTGCCTTGCTGTA
GTGAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAGGTTGCCAGTGTTGCTGCCCATGATGAGTTATTTGCCT
CTGAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAAGAAAGAACCACAAGCCTCCCAAGTATTTGGGTTCTAT
CTTAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATGTGTCTTCTTTCCTCCAACCTCTTACCTTAGATGCATC
CTGGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCTCCAGTCTGTGAGGATACATAACATTTTCTCTACAATG
AATCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGACAGGGTTTCACTATGTTGCCCAGGCTGGTCTCAAACT
CCTGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAGGTGTGTGCTACCGTGCCTGGCACTTTTTTGCCTTCTT
AATGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTATCTACTCTACCTTCCCTCTGCTCTCCTCCCTCCCTATC
CTACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTTTTATGCTGCTTCGCTTTTCTCTAAACAGATCTGATAT
TGCTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGAATCAAAATGCATTGTTGCATTAAGCTTTTTCAATAAA
GGAAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGTTCTAAACTCTATATATACATATATATATATATATCTA
TATATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACACTTCTAAAGATCACCATTTCTGAGAAGTTCTTGGAAA

>In-frame_FRS2_ENST00000550389_chr12_69967865_+_AHCYL2_ENST00000490911_chr7_129019482_+_8383nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGGTTAAATCAGCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCC
TGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCACACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGT
CCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGTCATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATA
ATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGACTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTAT
GACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGGACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTA
TTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGTGGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTG
GAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGCTCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGA
GATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGCTCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTT
GTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCAAGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAG
GCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAGTAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAA
GGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAATGGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGT
GGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGATGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAA
AATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGGTCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAAC
AACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACCATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGAT
GAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCATAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAAT
GTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCGGGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCA
AGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGGTGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACA
ACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGTGATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAA
GCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAGTACTGATCTGCCCATGTGAGCCTGGAAAGCATTGTGTTGTTTG
CACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTCATTTCTAAACACTAACTCCTTTTATAGACTGATAAAATTTTTT
TCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAGCAGGTACTCCTTAAAGAACACTAATTTCATTATATACTACTCG
TTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAGTTGAAGTAAATGACATGCTGGTTGATTTTTATCAATATTCTGG
ACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAACTTTTTATAAAGCCTCTTGACAATGTACATTGCTAACAGGTAAC
TATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGTGGCCTCCAGCATGTAACATGAGGAATCCTTTATTTCATTAATT
AATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGTACCGCACCTCCTCTTACACCAGTCAGCTCCTTTGCCTTCAGTG
TTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGCACTGAAAGGCAGGAAGGAGACAAGATTTTCTATTTACTCATCT
CATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATAGGCTCAAGAATCAGTCTCAGGTCACTTTACCCAAAAACATTTG
AAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTTGACAACACATTGTTTTCTGGAGGCATTTGTGCCATTAGGTTTC
CATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTGTTGCCTTATGTCCTTTTCAATTTAAAATGTTTGAGTTTGTATA
TAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTTTTGTCAAATTATGGTTTTGAAGGTTCATTTGGAACTTACTGTT
AGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTTTACTTTTCAAGTTGATAAAAACATTCTCCAATTCTAAATTTGC
TTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGCTACTTTTAACATGCAAAGTTCCCTCAAGGTGTACCGTGTTGTC
TCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTACACGCTGCAGTTGTACTCTGCCCACTCTAGTGTTCCTCAGCTC
TGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTCCATGAAATATTAATATTGTTGCCAGCATAGCAGGTACAGTGGA
AGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAATTAAAGTTTATATAAACTGAAGAGTCTCCATATGTCAAACTCT
TGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAGAGAAGGTAGAGTGGAAAAGGTTAGGTAACCTTGCAAAATATTT
TACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATCTACCAGATATAACTAAGGTTAATTTAGCATGAAAAAGTTTTAG
TCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGATGGATTAGGAGAACAATAGAGTGGGATCATTATAAAGAAAATA
AATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTTTACTATAAATCAATATCAGTGTATTTTATCATTCTATGTGCAT
AGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCTTATTAAAGTGCTCACTGTTCTCTTAAAAGAGAGCAGTGGTATA
GGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCCACTTATCCTTTCTTCTGAGTAAATTGCTAATTGTGCCAAATTT
ATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATTGCACATTTTTTTCTGAAACAGCCAGTCAAGGCAGAACATTAAT
CTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTACTTTATTCTTTCTTTCCGTCATCCTTTTCATTGTTTCCCCCGG
ATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATTACAGTTTATGCTTTAAATACTATGTGCTTTAAAAAGGAAAATG
GGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTATTAGGAAAATATATACAACTGGTGTTAATTTCTAGATATTTTC
TAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACTACTTGTCCTTTGCAGTAGTTTAGTAATGGGCATTAAGCTGTGT
CCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATTGATATTTTATTAGCATATAATTGTGGCCATATATCTCAGATTT
TCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGATCCTTCTTTTTGGTTTTGGAAATATAATCATTGTTAATGTTTT
CCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATCTATCCCATGCTAGGGTTGGAAACTGATATTGGTATTACTTGTG
TTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAATGAAAATATGGTGCCTTCCCTCCCTCCAGGAAGACTGGCAAAT
ATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTTACTCTTTAAGATTCAGCAAAAAGCTTTTCACTTCTCAGTATAT
CCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCTTTGTTTTTATAGATACTAATGTTGACCCTCTCCAGCGTTCAAT
GTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCCCAAAACTGTGGCACAGCATATAAAAATGTACCTCAATAATGTT
CTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACAATGTGCCGCCATATTTTTGCCTCAAGGTAAAGGTTTTAACAGA
TGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATGCCCAAATGTTTTGTGCAATGTGTAGTGTGTGTGTATAAATACA
TATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAACTGATGTATTGGCATCTCATTCATATTTCTGATGTGTGAGGTA
TATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAAGGCATTGGTACGAAATTACAGAATGTAAAGAAAATGTTTTTGG
CTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCCAAACCAGCACCCTATCTATCTTTCCTGTTCTTTACATCCCTGT
TCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTAGCATCATTATAATTGCAGTTCTATGGCAATTGGACAGTTATAG
CATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCACATTTGCATTAGTAATGCAAAATATACATTTTATAAAGGACAA
ACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGACTATTGTATGTCCTAATTTGCATTATAAATGTTTTTTTCCTAC
GTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGATTTTTAATTTTTTCTTTTATAAAAAATTGTCCAACAGTGGGACT
ACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTAATTTCTTTTATAAACATTCCATATTTCTCTAATAAAAAGACAT
AAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGATCAGCATTTTAAATTTTGGTTTGCATTTTTAATATTGGCAAAA
CGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAACATAATTTTCCCTCTATCCCTTCCCACCCTTTGTTCTCTATTTC
TCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAATATAACTTTTACACTGAGGCCGAGTGTGGCTTTTTGGAGGAAGT
GGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTTTTTGCCATATAAGCCATGTCATCAGGCATGAAAAGTTTTCTCA
TATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTTAAGCTTAATTTTTGTCATGACAACTAATTTTTTTTATCTTTGG
AGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTTAGAATAAGCTAGTAATTGAATTTAGTTCAAGGGCTAAGCAACA
CATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTACAAATTATGTAAAATATGGTTTAATATTAGATGACTTTGGATTT
TGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGGTACTCAAGTTGATACTGGAAGCTGAGCTGATCATACACTGACC
TGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAGTTCTTTTCATGCTCACTTTCCCCTTATTGCTGAAAGTAGATTG
CAATAAAACCCCAATAAAACGTTTGGTCGGATAATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGT
CGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCG
CCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATT
GAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGT
TGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTAT
TCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGG
TGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAG
TATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAG
CTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGA
CTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTG
AAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTA
AATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAAT
AGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGA
TCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTG
CCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGAT
GTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAA
CAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTTT
AAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGCTCA

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000325006_chr7_129019482_+_11462nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGTTAAATCA
GCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCA
CACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGT
CATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGA
CTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGG
ACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGT
GGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGC
TCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGC
TCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCA
AGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAG
TAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAAT
GGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGA
TGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGG
TCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACC
ATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCA
TAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCG
GGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGG
TGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGT
GATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAG
TACTGATCTGCCCATGTGAGCCTGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTC
ATTTCTAAACACTAACTCCTTTTATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAG
CAGGTACTCCTTAAAGAACACTAATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAG
TTGAAGTAAATGACATGCTGGTTGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAAC
TTTTTATAAAGCCTCTTGACAATGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGT
GGCCTCCAGCATGTAACATGAGGAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGT
ACCGCACCTCCTCTTACACCAGTCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGC
ACTGAAAGGCAGGAAGGAGACAAGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATA
GGCTCAAGAATCAGTCTCAGGTCACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTT
GACAACACATTGTTTTCTGGAGGCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTG
TTGCCTTATGTCCTTTTCAATTTAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTT
TTGTCAAATTATGGTTTTGAAGGTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTT
TACTTTTCAAGTTGATAAAAACATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGC
TACTTTTAACATGCAAAGTTCCCTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTA
CACGCTGCAGTTGTACTCTGCCCACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTC
CATGAAATATTAATATTGTTGCCAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAA
TTAAAGTTTATATAAACTGAAGAGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAG
AGAAGGTAGAGTGGAAAAGGTTAGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATC
TACCAGATATAACTAAGGTTAATTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGA
TGGATTAGGAGAACAATAGAGTGGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTT
TACTATAAATCAATATCAGTGTATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCT
TATTAAAGTGCTCACTGTTCTCTTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCC
ACTTATCCTTTCTTCTGAGTAAATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATT
GCACATTTTTTTCTGAAACAGCCAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTA
CTTTATTCTTTCTTTCCGTCATCCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATT
ACAGTTTATGCTTTAAATACTATGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTA
TTAGGAAAATATATACAACTGGTGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACT
ACTTGTCCTTTGCAGTAGTTTAGTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATT
GATATTTTATTAGCATATAATTGTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGA
TCCTTCTTTTTGGTTTTGGAAATATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATC
TATCCCATGCTAGGGTTGGAAACTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAA
TGAAAATATGGTGCCTTCCCTCCCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTT
ACTCTTTAAGATTCAGCAAAAAGCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCT
TTGTTTTTATAGATACTAATGTTGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCC
CAAAACTGTGGCACAGCATATAAAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACA
ATGTGCCGCCATATTTTTGCCTCAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATG
CCCAAATGTTTTGTGCAATGTGTAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAA
CTGATGTATTGGCATCTCATTCATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAA
GGCATTGGTACGAAATTACAGAATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCC
AAACCAGCACCCTATCTATCTTTCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTA
GCATCATTATAATTGCAGTTCTATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCA
CATTTGCATTAGTAATGCAAAATATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGA
CTATTGTATGTCCTAATTTGCATTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGAT
TTTTAATTTTTTCTTTTATAAAAAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTA
ATTTCTTTTATAAACATTCCATATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGA
TCAGCATTTTAAATTTTGGTTTGCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAAC
ATAATTTTCCCTCTATCCCTTCCCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAAT
ATAACTTTTACACTGAGGCCGAGTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTT
TTTGCCATATAAGCCATGTCATCAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTT
AAGCTTAATTTTTGTCATGACAACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTT
AGAATAAGCTAGTAATTGAATTTAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTAC
AAATTATGTAAAATATGGTTTAATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGG
TACTCAAGTTGATACTGGAAGCTGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAG
TTCTTTTCATGCTCACTTTCCCCTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGCAGATCCAGTTTGCTGA
CCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAG
CTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTG
TGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAG
AGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGG
TGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCC
TGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGAT
CTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGT
TACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAA
ATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGT
CTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTG
TGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAA
CAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGT
GGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACT
GCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTT
GATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACA
CCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAA
TTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAA
TTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGCTCACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCC
TGTAGTGTTGGCCCAGAGTGTGGTTACTGCCCTGAGGGCCATGAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGC
TCCCAGTGCATCATTTGCATCATTCCCCATTGACTGAATCCTCAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGG
GATTCCATACTCCCTATTCCCTGGAGTTTTCTGGAATAAATTTTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTT
TGGAATTAACATGGCCAGTGTTTCACACAAGATTGGGTTCCCAATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAG
GAAGGAGTGTTATTTATGGCTTTGCCAAGCTACATCAAGAACTCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCC
TTTCTTCTCCTTGAATATTTATGTCCATTTTAACACTTCCTGGTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATT
TGTCAGACATTTGTTCTGCTGTCTTTCTAATCCAGCCAACGTCTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTC
CTTGTCATTTGATTGGATAGTTTCCAAGGAAGCCCCTCCAGATTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCT
GAAACTTCCTGCTATTGCCTAAAGCTACGTCTGAAACTGAGTAGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAA
TGGGACAGGTCTTTCAGACTCACAGCTTGATACCCTAACAAAGCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTG
GCTGAGGGATACAGAGATGAAATTGTAAACTGTATCCAGATTATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTT
TGGCCATTGCCATGGATGAAACCGAGATCTGCAGTCTGATCTGTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTT
GATGATTCTGTATTTCAGAGTCAGTTTCTTGAGTAACTCCAGTGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTAT
GTCCCACCCAAAAATTGGATTCCTTTTGGAGACTGATCTGTTGGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTG
GACTGGCCCTAGGAAACTTGAATTAAATAAGCCTCTTCCCCTTACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTT
CCTATGCTGGTCTGCCTCAAAGTCTCAAGACCAAGGTGACTCAAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGAT
TCTCTTCTTCTACCTCTACCCTCTCCAACTTCTCCTGGTCTTCACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGT
AGGGAAGTGGAACTTTGGTAAATGACTGTTTGCCTCATTTAATAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATG
TCTCAGCAAGTACTGGTTATATTCTTTTTTTGTAAGGAAGATCATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCT
ACCTAGTCCTGATTTTTGTATTAATTGGTTCCCTTTAGCAAGGGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTT
GGCAGATAGATGGTCTCTAGCCTATTGTATTCTTAGACCAAAAATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTAC
TATGTGCTGGTACTTAAAGAGTACATTCTGCCTTGCTGTAGTGAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGT
TAGGTTGCCAGTGTTGCTGCCCATGATGAGTTATTTGCCTCTGAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAA
GAAGAAAGAACCACAAGCCTCCCAAGTATTTGGGTTCTATCTTAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCA
ATGTGTCTTCTTTCCTCCAACCTCTTACCTTAGATGCATCCTGGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTG
GCTCCAGTCTGTGAGGATACATAACATTTTCTCTACAATGAATCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAG
AGACAGGGTTTCACTATGTTGCCCAGGCTGGTCTCAAACTCCTGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCA
CAGGTGTGTGCTACCGTGCCTGGCACTTTTTTGCCTTCTTAATGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATG
TATCTACTCTACCTTCCCTCTGCTCTCCTCCCTCCCTATCCTACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAG
CTTTTATGCTGCTTCGCTTTTCTCTAAACAGATCTGATATTGCTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAA
GGAATCAAAATGCATTGTTGCATTAAGCTTTTTCAATAAAGGAAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACA
GGTTCTAAACTCTATATATACATATATATATATATATCTATATATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATA
ACACTTCTAAAGATCACCATTTCTGAGAAGTTCTTGGAAATCTTTATGTCTAAGTGATTGTATTAGATCAGCAATAATGACTATGTAATC

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000446544_chr7_129019482_+_11459nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGTTAAATCA
GCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCA
CACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGT
CATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGA
CTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGG
ACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGT
GGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGC
TCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGC
TCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCA
AGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAG
TAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAAT
GGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGA
TGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGG
TCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACC
ATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCA
TAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCG
GGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGG
TGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGT
GATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAG
TACTGATCTGCCCATGTGAGCCTGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTC
ATTTCTAAACACTAACTCCTTTTATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAG
CAGGTACTCCTTAAAGAACACTAATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAG
TTGAAGTAAATGACATGCTGGTTGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAAC
TTTTTATAAAGCCTCTTGACAATGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGT
GGCCTCCAGCATGTAACATGAGGAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGT
ACCGCACCTCCTCTTACACCAGTCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGC
ACTGAAAGGCAGGAAGGAGACAAGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATA
GGCTCAAGAATCAGTCTCAGGTCACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTT
GACAACACATTGTTTTCTGGAGGCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTG
TTGCCTTATGTCCTTTTCAATTTAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTT
TTGTCAAATTATGGTTTTGAAGGTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTT
TACTTTTCAAGTTGATAAAAACATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGC
TACTTTTAACATGCAAAGTTCCCTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTA
CACGCTGCAGTTGTACTCTGCCCACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTC
CATGAAATATTAATATTGTTGCCAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAA
TTAAAGTTTATATAAACTGAAGAGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAG
AGAAGGTAGAGTGGAAAAGGTTAGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATC
TACCAGATATAACTAAGGTTAATTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGA
TGGATTAGGAGAACAATAGAGTGGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTT
TACTATAAATCAATATCAGTGTATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCT
TATTAAAGTGCTCACTGTTCTCTTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCC
ACTTATCCTTTCTTCTGAGTAAATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATT
GCACATTTTTTTCTGAAACAGCCAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTA
CTTTATTCTTTCTTTCCGTCATCCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATT
ACAGTTTATGCTTTAAATACTATGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTA
TTAGGAAAATATATACAACTGGTGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACT
ACTTGTCCTTTGCAGTAGTTTAGTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATT
GATATTTTATTAGCATATAATTGTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGA
TCCTTCTTTTTGGTTTTGGAAATATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATC
TATCCCATGCTAGGGTTGGAAACTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAA
TGAAAATATGGTGCCTTCCCTCCCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTT
ACTCTTTAAGATTCAGCAAAAAGCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCT
TTGTTTTTATAGATACTAATGTTGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCC
CAAAACTGTGGCACAGCATATAAAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACA
ATGTGCCGCCATATTTTTGCCTCAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATG
CCCAAATGTTTTGTGCAATGTGTAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAA
CTGATGTATTGGCATCTCATTCATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAA
GGCATTGGTACGAAATTACAGAATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCC
AAACCAGCACCCTATCTATCTTTCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTA
GCATCATTATAATTGCAGTTCTATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCA
CATTTGCATTAGTAATGCAAAATATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGA
CTATTGTATGTCCTAATTTGCATTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGAT
TTTTAATTTTTTCTTTTATAAAAAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTA
ATTTCTTTTATAAACATTCCATATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGA
TCAGCATTTTAAATTTTGGTTTGCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAAC
ATAATTTTCCCTCTATCCCTTCCCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAAT
ATAACTTTTACACTGAGGCCGAGTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTT
TTTGCCATATAAGCCATGTCATCAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTT
AAGCTTAATTTTTGTCATGACAACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTT
AGAATAAGCTAGTAATTGAATTTAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTAC
AAATTATGTAAAATATGGTTTAATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGG
TACTCAAGTTGATACTGGAAGCTGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAG
TTCTTTTCATGCTCACTTTCCCCTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCA
GAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTC
AGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGT
TAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGC
TCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGC
TCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGT
TTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTT
GGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTAC
TGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATT
TGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTG
TGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGC
CCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAA
GAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGC
GAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCT
GGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGAT
AGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCT
GCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTA
CTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTC
AGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGCTCACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGT
AGTGTTGGCCCAGAGTGTGGTTACTGCCCTGAGGGCCATGAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCC
CAGTGCATCATTTGCATCATTCCCCATTGACTGAATCCTCAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGAT
TCCATACTCCCTATTCCCTGGAGTTTTCTGGAATAAATTTTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGG
AATTAACATGGCCAGTGTTTCACACAAGATTGGGTTCCCAATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAA
GGAGTGTTATTTATGGCTTTGCCAAGCTACATCAAGAACTCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTT
CTTCTCCTTGAATATTTATGTCCATTTTAACACTTCCTGGTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGT
CAGACATTTGTTCTGCTGTCTTTCTAATCCAGCCAACGTCTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTT
GTCATTTGATTGGATAGTTTCCAAGGAAGCCCCTCCAGATTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAA
ACTTCCTGCTATTGCCTAAAGCTACGTCTGAAACTGAGTAGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGG
GACAGGTCTTTCAGACTCACAGCTTGATACCCTAACAAAGCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCT
GAGGGATACAGAGATGAAATTGTAAACTGTATCCAGATTATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGG
CCATTGCCATGGATGAAACCGAGATCTGCAGTCTGATCTGTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGAT
GATTCTGTATTTCAGAGTCAGTTTCTTGAGTAACTCCAGTGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTC
CCACCCAAAAATTGGATTCCTTTTGGAGACTGATCTGTTGGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGAC
TGGCCCTAGGAAACTTGAATTAAATAAGCCTCTTCCCCTTACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCT
ATGCTGGTCTGCCTCAAAGTCTCAAGACCAAGGTGACTCAAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCT
CTTCTTCTACCTCTACCCTCTCCAACTTCTCCTGGTCTTCACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGG
GAAGTGGAACTTTGGTAAATGACTGTTTGCCTCATTTAATAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCT
CAGCAAGTACTGGTTATATTCTTTTTTTGTAAGGAAGATCATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACC
TAGTCCTGATTTTTGTATTAATTGGTTCCCTTTAGCAAGGGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGC
AGATAGATGGTCTCTAGCCTATTGTATTCTTAGACCAAAAATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTAT
GTGCTGGTACTTAAAGAGTACATTCTGCCTTGCTGTAGTGAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAG
GTTGCCAGTGTTGCTGCCCATGATGAGTTATTTGCCTCTGAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAA
GAAAGAACCACAAGCCTCCCAAGTATTTGGGTTCTATCTTAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATG
TGTCTTCTTTCCTCCAACCTCTTACCTTAGATGCATCCTGGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCT
CCAGTCTGTGAGGATACATAACATTTTCTCTACAATGAATCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGA
CAGGGTTTCACTATGTTGCCCAGGCTGGTCTCAAACTCCTGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAG
GTGTGTGCTACCGTGCCTGGCACTTTTTTGCCTTCTTAATGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTAT
CTACTCTACCTTCCCTCTGCTCTCCTCCCTCCCTATCCTACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTT
TTATGCTGCTTCGCTTTTCTCTAAACAGATCTGATATTGCTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGA
ATCAAAATGCATTGTTGCATTAAGCTTTTTCAATAAAGGAAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGT
TCTAAACTCTATATATACATATATATATATATATCTATATATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACA
CTTCTAAAGATCACCATTTCTGAGAAGTTCTTGGAAATCTTTATGTCTAAGTGATTGTATTAGATCAGCAATAATGACTATGTAATCTCA

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000531335_chr7_129019482_+_11458nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGTTAAATCA
GCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCA
CACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGT
CATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGA
CTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGG
ACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGT
GGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGC
TCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGC
TCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCA
AGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAG
TAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAAT
GGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGA
TGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGG
TCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACC
ATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCA
TAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCG
GGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGG
TGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGT
GATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAG
TACTGATCTGCCCATGTGAGCCTGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTC
ATTTCTAAACACTAACTCCTTTTATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAG
CAGGTACTCCTTAAAGAACACTAATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAG
TTGAAGTAAATGACATGCTGGTTGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAAC
TTTTTATAAAGCCTCTTGACAATGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGT
GGCCTCCAGCATGTAACATGAGGAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGT
ACCGCACCTCCTCTTACACCAGTCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGC
ACTGAAAGGCAGGAAGGAGACAAGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATA
GGCTCAAGAATCAGTCTCAGGTCACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTT
GACAACACATTGTTTTCTGGAGGCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTG
TTGCCTTATGTCCTTTTCAATTTAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTT
TTGTCAAATTATGGTTTTGAAGGTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTT
TACTTTTCAAGTTGATAAAAACATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGC
TACTTTTAACATGCAAAGTTCCCTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTA
CACGCTGCAGTTGTACTCTGCCCACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTC
CATGAAATATTAATATTGTTGCCAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAA
TTAAAGTTTATATAAACTGAAGAGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAG
AGAAGGTAGAGTGGAAAAGGTTAGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATC
TACCAGATATAACTAAGGTTAATTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGA
TGGATTAGGAGAACAATAGAGTGGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTT
TACTATAAATCAATATCAGTGTATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCT
TATTAAAGTGCTCACTGTTCTCTTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCC
ACTTATCCTTTCTTCTGAGTAAATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATT
GCACATTTTTTTCTGAAACAGCCAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTA
CTTTATTCTTTCTTTCCGTCATCCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATT
ACAGTTTATGCTTTAAATACTATGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTA
TTAGGAAAATATATACAACTGGTGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACT
ACTTGTCCTTTGCAGTAGTTTAGTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATT
GATATTTTATTAGCATATAATTGTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGA
TCCTTCTTTTTGGTTTTGGAAATATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATC
TATCCCATGCTAGGGTTGGAAACTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAA
TGAAAATATGGTGCCTTCCCTCCCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTT
ACTCTTTAAGATTCAGCAAAAAGCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCT
TTGTTTTTATAGATACTAATGTTGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCC
CAAAACTGTGGCACAGCATATAAAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACA
ATGTGCCGCCATATTTTTGCCTCAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATG
CCCAAATGTTTTGTGCAATGTGTAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAA
CTGATGTATTGGCATCTCATTCATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAA
GGCATTGGTACGAAATTACAGAATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCC
AAACCAGCACCCTATCTATCTTTCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTA
GCATCATTATAATTGCAGTTCTATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCA
CATTTGCATTAGTAATGCAAAATATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGA
CTATTGTATGTCCTAATTTGCATTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGAT
TTTTAATTTTTTCTTTTATAAAAAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTA
ATTTCTTTTATAAACATTCCATATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGA
TCAGCATTTTAAATTTTGGTTTGCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAAC
ATAATTTTCCCTCTATCCCTTCCCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAAT
ATAACTTTTACACTGAGGCCGAGTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTT
TTTGCCATATAAGCCATGTCATCAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTT
AAGCTTAATTTTTGTCATGACAACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTT
AGAATAAGCTAGTAATTGAATTTAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTAC
AAATTATGTAAAATATGGTTTAATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGG
TACTCAAGTTGATACTGGAAGCTGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAG
TTCTTTTCATGCTCACTTTCCCCTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCA
GAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTC
AGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGT
TAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGC
TCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGC
TCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGT
TTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTT
GGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTAC
TGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATT
TGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTG
TGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGC
CCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAA
GAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGC
GAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCT
GGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGAT
AGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCT
GCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTA
CTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTC
AGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGCTCACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCCTGT
AGTGTTGGCCCAGAGTGTGGTTACTGCCCTGAGGGCCATGAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGCTCC
CAGTGCATCATTTGCATCATTCCCCATTGACTGAATCCTCAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGGGAT
TCCATACTCCCTATTCCCTGGAGTTTTCTGGAATAAATTTTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTTTGG
AATTAACATGGCCAGTGTTTCACACAAGATTGGGTTCCCAATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAGGAA
GGAGTGTTATTTATGGCTTTGCCAAGCTACATCAAGAACTCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCCTTT
CTTCTCCTTGAATATTTATGTCCATTTTAACACTTCCTGGTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATTTGT
CAGACATTTGTTCTGCTGTCTTTCTAATCCAGCCAACGTCTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTCCTT
GTCATTTGATTGGATAGTTTCCAAGGAAGCCCCTCCAGATTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCTGAA
ACTTCCTGCTATTGCCTAAAGCTACGTCTGAAACTGAGTAGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAATGG
GACAGGTCTTTCAGACTCACAGCTTGATACCCTAACAAAGCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTGGCT
GAGGGATACAGAGATGAAATTGTAAACTGTATCCAGATTATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTTTGG
CCATTGCCATGGATGAAACCGAGATCTGCAGTCTGATCTGTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTTGAT
GATTCTGTATTTCAGAGTCAGTTTCTTGAGTAACTCCAGTGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTATGTC
CCACCCAAAAATTGGATTCCTTTTGGAGACTGATCTGTTGGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTGGAC
TGGCCCTAGGAAACTTGAATTAAATAAGCCTCTTCCCCTTACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTTCCT
ATGCTGGTCTGCCTCAAAGTCTCAAGACCAAGGTGACTCAAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGATTCT
CTTCTTCTACCTCTACCCTCTCCAACTTCTCCTGGTCTTCACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGTAGG
GAAGTGGAACTTTGGTAAATGACTGTTTGCCTCATTTAATAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATGTCT
CAGCAAGTACTGGTTATATTCTTTTTTTGTAAGGAAGATCATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCTACC
TAGTCCTGATTTTTGTATTAATTGGTTCCCTTTAGCAAGGGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTTGGC
AGATAGATGGTCTCTAGCCTATTGTATTCTTAGACCAAAAATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTACTAT
GTGCTGGTACTTAAAGAGTACATTCTGCCTTGCTGTAGTGAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGTTAG
GTTGCCAGTGTTGCTGCCCATGATGAGTTATTTGCCTCTGAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAAGAA
GAAAGAACCACAAGCCTCCCAAGTATTTGGGTTCTATCTTAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCAATG
TGTCTTCTTTCCTCCAACCTCTTACCTTAGATGCATCCTGGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTGGCT
CCAGTCTGTGAGGATACATAACATTTTCTCTACAATGAATCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAGAGA
CAGGGTTTCACTATGTTGCCCAGGCTGGTCTCAAACTCCTGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCACAG
GTGTGTGCTACCGTGCCTGGCACTTTTTTGCCTTCTTAATGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATGTAT
CTACTCTACCTTCCCTCTGCTCTCCTCCCTCCCTATCCTACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAGCTT
TTATGCTGCTTCGCTTTTCTCTAAACAGATCTGATATTGCTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAAGGA
ATCAAAATGCATTGTTGCATTAAGCTTTTTCAATAAAGGAAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACAGGT
TCTAAACTCTATATATACATATATATATATATATCTATATATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATAACA
CTTCTAAAGATCACCATTTCTGAGAAGTTCTTGGAAATCTTTATGTCTAAGTGATTGTATTAGATCAGCAATAATGACTATGTAATCTCA

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000474594_chr7_129019482_+_8459nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGTTAAATCA
GCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCA
CACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGT
CATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGA
CTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGG
ACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGT
GGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGC
TCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGC
TCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCA
AGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAG
TAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAAT
GGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGA
TGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGG
TCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACC
ATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCA
TAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCG
GGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGG
TGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGT
GATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAG
TACTGATCTGCCCATGTGAGCCTGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTC
ATTTCTAAACACTAACTCCTTTTATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAG
CAGGTACTCCTTAAAGAACACTAATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAG
TTGAAGTAAATGACATGCTGGTTGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAAC
TTTTTATAAAGCCTCTTGACAATGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGT
GGCCTCCAGCATGTAACATGAGGAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGT
ACCGCACCTCCTCTTACACCAGTCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGC
ACTGAAAGGCAGGAAGGAGACAAGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATA
GGCTCAAGAATCAGTCTCAGGTCACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTT
GACAACACATTGTTTTCTGGAGGCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTG
TTGCCTTATGTCCTTTTCAATTTAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTT
TTGTCAAATTATGGTTTTGAAGGTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTT
TACTTTTCAAGTTGATAAAAACATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGC
TACTTTTAACATGCAAAGTTCCCTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTA
CACGCTGCAGTTGTACTCTGCCCACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTC
CATGAAATATTAATATTGTTGCCAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAA
TTAAAGTTTATATAAACTGAAGAGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAG
AGAAGGTAGAGTGGAAAAGGTTAGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATC
TACCAGATATAACTAAGGTTAATTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGA
TGGATTAGGAGAACAATAGAGTGGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTT
TACTATAAATCAATATCAGTGTATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCT
TATTAAAGTGCTCACTGTTCTCTTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCC
ACTTATCCTTTCTTCTGAGTAAATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATT
GCACATTTTTTTCTGAAACAGCCAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTA
CTTTATTCTTTCTTTCCGTCATCCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATT
ACAGTTTATGCTTTAAATACTATGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTA
TTAGGAAAATATATACAACTGGTGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACT
ACTTGTCCTTTGCAGTAGTTTAGTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATT
GATATTTTATTAGCATATAATTGTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGA
TCCTTCTTTTTGGTTTTGGAAATATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATC
TATCCCATGCTAGGGTTGGAAACTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAA
TGAAAATATGGTGCCTTCCCTCCCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTT
ACTCTTTAAGATTCAGCAAAAAGCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCT
TTGTTTTTATAGATACTAATGTTGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCC
CAAAACTGTGGCACAGCATATAAAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACA
ATGTGCCGCCATATTTTTGCCTCAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATG
CCCAAATGTTTTGTGCAATGTGTAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAA
CTGATGTATTGGCATCTCATTCATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAA
GGCATTGGTACGAAATTACAGAATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCC
AAACCAGCACCCTATCTATCTTTCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTA
GCATCATTATAATTGCAGTTCTATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCA
CATTTGCATTAGTAATGCAAAATATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGA
CTATTGTATGTCCTAATTTGCATTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGAT
TTTTAATTTTTTCTTTTATAAAAAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTA
ATTTCTTTTATAAACATTCCATATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGA
TCAGCATTTTAAATTTTGGTTTGCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAAC
ATAATTTTCCCTCTATCCCTTCCCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAAT
ATAACTTTTACACTGAGGCCGAGTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTT
TTTGCCATATAAGCCATGTCATCAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTT
AAGCTTAATTTTTGTCATGACAACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTT
AGAATAAGCTAGTAATTGAATTTAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTAC
AAATTATGTAAAATATGGTTTAATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGG
TACTCAAGTTGATACTGGAAGCTGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAG
TTCTTTTCATGCTCACTTTCCCCTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCA
GAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTC
AGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGT
TAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGC
TCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGC
TCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGT
TTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTT
GGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTAC
TGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATT
TGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTG
TGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGC
CCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAA
GAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGC
GAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCT
GGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGAT
AGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCT
GCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTA
CTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTC

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000446212_chr7_129019482_+_11461nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGTTAAATCA
GCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCA
CACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGT
CATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGA
CTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGG
ACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGT
GGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGC
TCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGC
TCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCA
AGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAG
TAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAAT
GGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGA
TGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGG
TCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACC
ATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCA
TAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCG
GGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGG
TGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGT
GATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAG
TACTGATCTGCCCATGTGAGCCTGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTC
ATTTCTAAACACTAACTCCTTTTATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAG
CAGGTACTCCTTAAAGAACACTAATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAG
TTGAAGTAAATGACATGCTGGTTGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAAC
TTTTTATAAAGCCTCTTGACAATGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGT
GGCCTCCAGCATGTAACATGAGGAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGT
ACCGCACCTCCTCTTACACCAGTCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGC
ACTGAAAGGCAGGAAGGAGACAAGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATA
GGCTCAAGAATCAGTCTCAGGTCACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTT
GACAACACATTGTTTTCTGGAGGCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTG
TTGCCTTATGTCCTTTTCAATTTAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTT
TTGTCAAATTATGGTTTTGAAGGTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTT
TACTTTTCAAGTTGATAAAAACATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGC
TACTTTTAACATGCAAAGTTCCCTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTA
CACGCTGCAGTTGTACTCTGCCCACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTC
CATGAAATATTAATATTGTTGCCAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAA
TTAAAGTTTATATAAACTGAAGAGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAG
AGAAGGTAGAGTGGAAAAGGTTAGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATC
TACCAGATATAACTAAGGTTAATTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGA
TGGATTAGGAGAACAATAGAGTGGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTT
TACTATAAATCAATATCAGTGTATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCT
TATTAAAGTGCTCACTGTTCTCTTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCC
ACTTATCCTTTCTTCTGAGTAAATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATT
GCACATTTTTTTCTGAAACAGCCAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTA
CTTTATTCTTTCTTTCCGTCATCCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATT
ACAGTTTATGCTTTAAATACTATGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTA
TTAGGAAAATATATACAACTGGTGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACT
ACTTGTCCTTTGCAGTAGTTTAGTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATT
GATATTTTATTAGCATATAATTGTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGA
TCCTTCTTTTTGGTTTTGGAAATATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATC
TATCCCATGCTAGGGTTGGAAACTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAA
TGAAAATATGGTGCCTTCCCTCCCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTT
ACTCTTTAAGATTCAGCAAAAAGCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCT
TTGTTTTTATAGATACTAATGTTGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCC
CAAAACTGTGGCACAGCATATAAAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACA
ATGTGCCGCCATATTTTTGCCTCAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATG
CCCAAATGTTTTGTGCAATGTGTAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAA
CTGATGTATTGGCATCTCATTCATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAA
GGCATTGGTACGAAATTACAGAATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCC
AAACCAGCACCCTATCTATCTTTCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTA
GCATCATTATAATTGCAGTTCTATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCA
CATTTGCATTAGTAATGCAAAATATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGA
CTATTGTATGTCCTAATTTGCATTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGAT
TTTTAATTTTTTCTTTTATAAAAAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTA
ATTTCTTTTATAAACATTCCATATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGA
TCAGCATTTTAAATTTTGGTTTGCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAAC
ATAATTTTCCCTCTATCCCTTCCCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAAT
ATAACTTTTACACTGAGGCCGAGTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTT
TTTGCCATATAAGCCATGTCATCAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTT
AAGCTTAATTTTTGTCATGACAACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTT
AGAATAAGCTAGTAATTGAATTTAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTAC
AAATTATGTAAAATATGGTTTAATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGG
TACTCAAGTTGATACTGGAAGCTGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAG
TTCTTTTCATGCTCACTTTCCCCTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGCAGATCCAGTTTGCTGA
CCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAG
CTCAGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTG
TGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAG
AGCTCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGG
TGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCC
TGTTTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGAT
CTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGT
TACTGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAA
ATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGT
CTGTGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTG
TGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAA
CAAGAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGT
GGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACT
GCTGGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTT
GATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACA
CCTGCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAA
TTACTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAA
TTCAGCAAGCTGCTTCTCCAATCAAAGCTGCCTGCCGTGCTCACCCTGTGTGTTAGGTTATTTATTTATTAAAATCAAGAATCCTGTGCC
TGTAGTGTTGGCCCAGAGTGTGGTTACTGCCCTGAGGGCCATGAAAGCCACAGAGGATGGGCTGAGGAAGGAAAGAAATGGGGTTACTGC
TCCCAGTGCATCATTTGCATCATTCCCCATTGACTGAATCCTCAGCAGTGGCCGTTTTTCCTCTTGTCCAGGCTCACGAGTTAGTCCAGG
GATTCCATACTCCCTATTCCCTGGAGTTTTCTGGAATAAATTTTCAGCACCTGCTTTTCTCAGCTTGGCCCTTCCCCGGGTGAGGCCGTT
TGGAATTAACATGGCCAGTGTTTCACACAAGATTGGGTTCCCAATCTTGACCATCACTATCACTGCCTTCTTTATATAAAGGCTAATAAG
GAAGGAGTGTTATTTATGGCTTTGCCAAGCTACATCAAGAACTCAGCTGTGCTGTGCCTACCAGGGGTCTCCTTTCTTACCCAGGACTCC
TTTCTTCTCCTTGAATATTTATGTCCATTTTAACACTTCCTGGTTGCAAGAGGGATGTGCCTCCATTATTTCCTCCACAGTTTTGGTATT
TGTCAGACATTTGTTCTGCTGTCTTTCTAATCCAGCCAACGTCTGCTCAGGAAGTGGGGCCAGCTCCACTGGGACCCATAGTTTTACTTC
CTTGTCATTTGATTGGATAGTTTCCAAGGAAGCCCCTCCAGATTGGCACTATCTCAGAAAAGGAGAGCTTGTTGTGAAACACTGCTTCCT
GAAACTTCCTGCTATTGCCTAAAGCTACGTCTGAAACTGAGTAGGGAAAGGCATACTTTTCCAGGGACTTAGGGGGATAGGCTTTGGAAA
TGGGACAGGTCTTTCAGACTCACAGCTTGATACCCTAACAAAGCAGAGTATATTTATTTGTTTCCCAGGAAGGCCATTGCAGTTTGACTG
GCTGAGGGATACAGAGATGAAATTGTAAACTGTATCCAGATTATCAAAGCTAATTTGACTAGTTTGAACCTCGTCAGACATTCATTCCTT
TGGCCATTGCCATGGATGAAACCGAGATCTGCAGTCTGATCTGTGGACTTCTCTGCTGGCATATCTTTTATGATTTAACCTCTTCCATTT
GATGATTCTGTATTTCAGAGTCAGTTTCTTGAGTAACTCCAGTGCTACAAAAAGAATTAGTAATGTGGTGTGGGCAGCGTGACATTTTAT
GTCCCACCCAAAAATTGGATTCCTTTTGGAGACTGATCTGTTGGTCTCAGGCATTTCATTAGGACCAGATTGGTTCTAAGAGTTAGTCTG
GACTGGCCCTAGGAAACTTGAATTAAATAAGCCTCTTCCCCTTACCGATCCTTTTTAACACTCTCAGGTTTGTTTGTTTCCCACTTTTTT
CCTATGCTGGTCTGCCTCAAAGTCTCAAGACCAAGGTGACTCAAGATAACACCAGACCACGCATGATCACCAAAACCTTCCCATCCTGAT
TCTCTTCTTCTACCTCTACCCTCTCCAACTTCTCCTGGTCTTCACATATACTCTCAAAGCTAGTCTGAAAGTGACCTTACTTTCGGAAGT
AGGGAAGTGGAACTTTGGTAAATGACTGTTTGCCTCATTTAATAGTATACAGGCTCAGCCCATAGACTACAGTTCTTCAGAGGCCATATG
TCTCAGCAAGTACTGGTTATATTCTTTTTTTGTAAGGAAGATCATAAATGCTAAAAATTCCACTAAGCCATTCAGTTCTTCCTTTTGCCT
ACCTAGTCCTGATTTTTGTATTAATTGGTTCCCTTTAGCAAGGGATTCAGATCTTTGTACCTTATCTTATATCCAGAGCAGATTCCATTT
GGCAGATAGATGGTCTCTAGCCTATTGTATTCTTAGACCAAAAATCATAACCTGCTGTTTCTCAGCAAAGCCTTGCTCTCTGGAGCTTAC
TATGTGCTGGTACTTAAAGAGTACATTCTGCCTTGCTGTAGTGAAGAGACCCACTCCAAATAAAAAAGGGGCCACACGGGGCTTCTAAGT
TAGGTTGCCAGTGTTGCTGCCCATGATGAGTTATTTGCCTCTGAGTTTCAGATGACCTCTCTGTAGGGACACTGTGTTATCAACCATTAA
GAAGAAAGAACCACAAGCCTCCCAAGTATTTGGGTTCTATCTTAGGGTTGAAATCTGGTCATTATTCCCTCTACCCTTGGAATCAGAGCA
ATGTGTCTTCTTTCCTCCAACCTCTTACCTTAGATGCATCCTGGTTATCTGGAAGCATGGGAAAGAAGGCTACTTATCTCTTTGTATGTG
GCTCCAGTCTGTGAGGATACATAACATTTTCTCTACAATGAATCTGTGCTAATATTTTGCCTTCTTTCTTTCTTTTCTTTTCACCCTTAG
AGACAGGGTTTCACTATGTTGCCCAGGCTGGTCTCAAACTCCTGGGCTCAAGCAATCCTCCTGCCTCAGCTTCCTGAGTAGCTGGAACCA
CAGGTGTGTGCTACCGTGCCTGGCACTTTTTTGCCTTCTTAATGGAGATATTCAGTTTTCTTTTTTTCATTTAAACAAAGAAAAAAAATG
TATCTACTCTACCTTCCCTCTGCTCTCCTCCCTCCCTATCCTACTTGCCCATATGAGCACGGCTCCCCATGGCCACATACTCCTGCAAAG
CTTTTATGCTGCTTCGCTTTTCTCTAAACAGATCTGATATTGCTGCTCCTGTGGTTTTCTCAAAATTAACTTTGCCGTGGTTTTTAAAAA
GGAATCAAAATGCATTGTTGCATTAAGCTTTTTCAATAAAGGAAAATTACGGAAGGAAAATAGGCAACACCAGCAAATTATATGTGGACA
GGTTCTAAACTCTATATATACATATATATATATATATCTATATATCTATATACGTAATCATCTAGTTCTGTCATCTTACTGAAAGGAATA
ACACTTCTAAAGATCACCATTTCTGAGAAGTTCTTGGAAATCTTTATGTCTAAGTGATTGTATTAGATCAGCAATAATGACTATGTAATC

>In-frame_FRS2_ENST00000397997_chr12_69967865_+_AHCYL2_ENST00000490911_chr7_129019482_+_8423nt
CGCCCCCTCAACCTTCGCGGGGCGCGGGCCGCAGCTTTTCGGTTCACAGCGGGCAGGGAAAGCCGCGGGAAGGGTACTCCAGGCGAGAGG
CGGACGCGAGTCGTCGTGGCAGGAAAAGTGACTAGCTCCCCTTCGTTGTCAGCCAGGGACGAGAACACAGCCACGCTCCCACCCGGCTGC
CAACGATCCCTCGGCGGCGATGTCGGCCGCCGGTGCCCGAGGCCTGCGGGCCACCTACCACCGGCTCCTCGATAAAGTGGAGCTGATGCT
GCCCGAGAAATTGAGGCCGTTGTACAACCATCCAGCAGGAACAAAATTGTATCTGTTTTTCTCAGAAGAGAATTCCACAAGGTTAAATCA
GCAAACAAAGAAAACATGGTATTTTGAAATATGATTAAACTCCTGATGCTGCAGCAGAGGCTAAGAATATTAATGGCCAGATCTAGTGCA
CACATGGTCTTCTGAAGAAGCCATGGGTAGCTGTTGTAGCTGTCCAGATAAAGACACTGTCCCAGATAACCATCGGAACAAGTTTAAGGT
CATTAATGTGGATGATGATGGGAATGAGTTAGGTTCTGGCATAATGGAACTTACAGACACAGAACTGATTTTATACACCCGCAAACGTGA
CTCAGTAAAATGGCACTACCTCTGCCTGCGACGCTATGGCTATGACTCGAATCTCTTTTCTTTTGAAAGTGGTCGAAGGTGTCAAACTGG
ACAAGGAATCTTTGCCTTTAAGTGTGCCCGTGCAGAAGAATTATTTAACATGTTGCAAGAGATTATGCAAAATAATAGTATAAATGTGGT
GGAAGAGCCAGTTGTAGAAAGAAATAATCATCAGACAGAATTGGAAGTCCCTAGAACACCTCGAACACCTACAACTCCAGGATTTGCTGC
TCAGAACTTACCTAATGGATATCCCCGATATCCCTCATTTGGAGATGCTTCATCCCATCCGTCAAGCAGACATCCTTCTGTGGGAAGTGC
TCGCCTGCCTTCAGTAGGGGAAGAATCTACACATCCTTTGCTTGTGGCTGAGGAACAAGTACATACCTATGTCAACACTACAGGTGTGCA
AGAAGAGCGGAAAAACCGCACAAGTGTGCATGTTCCATTGGAGGCGAGGGTTTCTAACGCTGAAAGCAGCACACCAAAAGAAGAACCAAG
TAGTATTGAGGACAGGGATCCTCAGATTCTTCTTGAACCTGAAGGAGTCAAATTTGTTTTAGGGCCAACCCCTGTTCAAAAGCAGTTAAT
GGAAAAAGAGAAACTGGAGCAACTTGGAAGAGATCAAGTTAGTGGAAGTGGAGCAAATAACACAGAATGGGACACTGGCTATGACAGTGA
TGAACGAAGAGATGCACCCTCTGTTAACAAACTGGTGTATGAAAATATAAATGGGCTATCTATCCCTAGTGCCTCAGGGGTCAGGAGAGG
TCGTCTGACATCCACCAGTACCTCAGATACCCAGAATATCAACAACTCAGCTCAGAGAAGAACTGCATTATTAAACTATGAAAATCTACC
ATCTTTGCCTCCTGTTTGGGAAGCCCGCAAGCTAAGTAGGGATGAAGATGACAATTTAGGACCAAAGACCCCATCTCTAAATGGCTACCA
TAATAATCTAGATCCAATGCATAACTATGTAAATACAGAGAATGTAACAGTGCCAGCAAGTGCTCACAAAATAGAATATTCAAGGCGTCG
GGACTGTACACCAACAGTCTTTAACTTTGATATCAGACGCCCAAGTTTAGAACACAGGCAGCTTAATTACATACAGGTTGACTTGGAAGG
TGGCAGTGACTCTGACAACCCTCAGACTCCAAAAACGCCTACAACTCCCCTTCCACAAACCCCTACCAGGCGCACAGAGCTGTATGCCGT
GATAGACATCGAGAGAACTGCTGCTATGTCAAATTTGCAGAAAGCACTGCCACGAGATGATGGTACATCTAGGAAAACTAGACACAATAG
TACTGATCTGCCCATGTGAGCCTGGAAAGCATTGTGTTGTTTGCACCTTTGTGAAGTTTTTAAAAATGAAGATGCAAGTGCTTCATTTTC
ATTTCTAAACACTAACTCCTTTTATAGACTGATAAAATTTTTTTCTGAATATTTCATGTGCATCTTTAACTAAAGGGAATTAATGTAGAG
CAGGTACTCCTTAAAGAACACTAATTTCATTATATACTACTCGTTGTACAGCAGCATTCCCGTTTTCACAGTGCCTATTTAAAATGAGAG
TTGAAGTAAATGACATGCTGGTTGATTTTTATCAATATTCTGGACTTAACGCATACCTTTCATGTCTAAGTCATGGTTGGCTTTTAAAAC
TTTTTATAAAGCCTCTTGACAATGTACATTGCTAACAGGTAACTATAGGCTTTGAAAGTAATGCTCGTAGATTCAGTGTTCACAGTATGT
GGCCTCCAGCATGTAACATGAGGAATCCTTTATTTCATTAATTAATGGCTTTTTGACTTGAGCCAAAACATATGTAAAGGAAACAGAAGT
ACCGCACCTCCTCTTACACCAGTCAGCTCCTTTGCCTTCAGTGTTACTAGAAAGCGGCCTGTGTCCATGAGTGTGCTTTGCTGTTGGTGC
ACTGAAAGGCAGGAAGGAGACAAGATTTTCTATTTACTCATCTCATGATGTCATTTGAAGGGCATGTCCAGATATCTTAAAATTATAATA
GGCTCAAGAATCAGTCTCAGGTCACTTTACCCAAAAACATTTGAAAATCTGAACCACAATCTCCTGAAAGTTTTTCTCCTATAGATTGTT
GACAACACATTGTTTTCTGGAGGCATTTGTGCCATTAGGTTTCCATTTATCTTCAGTTTTTTTCTTTGGTGTTTGGGATGTCTTATTTTG
TTGCCTTATGTCCTTTTCAATTTAAAATGTTTGAGTTTGTATATAGTTTTGAAATTGGATTATGTGTTCATTGTTGTTTAGTTTGCATTT
TTGTCAAATTATGGTTTTGAAGGTTCATTTGGAACTTACTGTTAGTCTGTAACAGGGTTGCCCTTGTCCAGTATTTATTTATAAGCTGTT
TACTTTTCAAGTTGATAAAAACATTCTCCAATTCTAAATTTGCTTGTGTCCATAGGTGATCTCTTTAGCAAACTGAGAAAAAAAGGAAGC
TACTTTTAACATGCAAAGTTCCCTCAAGGTGTACCGTGTTGTCTCTGTGGGCACTCTTCCCCAGCACTTTAGCAGTAATTCCCCCAGCTA
CACGCTGCAGTTGTACTCTGCCCACTCTAGTGTTCCTCAGCTCTGCTGTCCTTTTACTTGTAGCTGGATCTTTGATTATCCTTCGATTTC
CATGAAATATTAATATTGTTGCCAGCATAGCAGGTACAGTGGAAGTCTTGTAGCAGTGAGATTGTATCATAATTTAGGATTTAAAATGAA
TTAAAGTTTATATAAACTGAAGAGTCTCCATATGTCAAACTCTTGGAAAATCAAAGATGTTCCAATTTCCTAAACACTAGAGAATACGAG
AGAAGGTAGAGTGGAAAAGGTTAGGTAACCTTGCAAAATATTTTACTATTTTCTCTAAATATGAGGAAGTTTGAGATTATGATCTGGATC
TACCAGATATAACTAAGGTTAATTTAGCATGAAAAAGTTTTAGTCATATTGGCATCCAACCTATTCAGTAACCGAATCATAGGACAATGA
TGGATTAGGAGAACAATAGAGTGGGATCATTATAAAGAAAATAAATTATTAAAGGTGTCTTTATCGTTTTAGTGCCATTTTTAGTGTCTT
TACTATAAATCAATATCAGTGTATTTTATCATTCTATGTGCATAGCAGAATTTTCTTTTCTCCCTTTTGTTCCCCTGTGAACTTGGTGCT
TATTAAAGTGCTCACTGTTCTCTTAAAAGAGAGCAGTGGTATAGGTGTGCAGTTTCCATGATGCAGGTTCCATTTTTAATATATTGTTCC
ACTTATCCTTTCTTCTGAGTAAATTGCTAATTGTGCCAAATTTATGTAATAGTTTTTGTAATGTGGAATAAGAATTATGATGGAACCATT
GCACATTTTTTTCTGAAACAGCCAGTCAAGGCAGAACATTAATCTCCAAATGCAAGGGCTGATCTATTTATTCATTTTGGAGGTTGGGTA
CTTTATTCTTTCTTTCCGTCATCCTTTTCATTGTTTCCCCCGGATTCTAATTAGTTTTTATTTTTTTTAGATAACTCCAATATAATCATT
ACAGTTTATGCTTTAAATACTATGTGCTTTAAAAAGGAAAATGGGACCAATTTGTCTGCTAAGAATTTGATTTTAGGTACTATAAGAGTA
TTAGGAAAATATATACAACTGGTGTTAATTTCTAGATATTTTCTAGAAATCACTTGTGTTCCTATTTAATAAAAGGTAATTTAGAATACT
ACTTGTCCTTTGCAGTAGTTTAGTAATGGGCATTAAGCTGTGTCCTCGAAGGATGTACCTATTACTAGGTGCATTTTAGAATGAAATATT
GATATTTTATTAGCATATAATTGTGGCCATATATCTCAGATTTTCTGAGGCAGATCTAATTTTAGATAATTCTGTTGGTAGACCATGTGA
TCCTTCTTTTTGGTTTTGGAAATATAATCATTGTTAATGTTTTCCCTCCAAATAGAATACTGTTTTATCCATACAAATCATAACAGCATC
TATCCCATGCTAGGGTTGGAAACTGATATTGGTATTACTTGTGTTTTTTCTTAGTGTGTTTTATTTCCCAGTTTCATCTTCTTCTAAAAA
TGAAAATATGGTGCCTTCCCTCCCTCCAGGAAGACTGGCAAATATTTCCTTTTATTTACTGCTGCTGTGGAGTGATGAGATATGCACTTT
ACTCTTTAAGATTCAGCAAAAAGCTTTTCACTTCTCAGTATATCCAGAATACATCATATCTGGGACTTAGGAAAATTTGCCAAGCAATCT
TTGTTTTTATAGATACTAATGTTGACCCTCTCCAGCGTTCAATGTTATAAATAGAACAAGTCAAGCTAGTGTTTATCTCCTCCCCCTCCC
CAAAACTGTGGCACAGCATATAAAAATGTACCTCAATAATGTTCTATTAAAAATGGGACAGGGGCCTTATGTTTTCATAATTTCCCAACA
ATGTGCCGCCATATTTTTGCCTCAAGGTAAAGGTTTTAACAGATGAAAAAGTACTTCCCAATTCCCCCGTGCTATTCCTAACCTATAATG
CCCAAATGTTTTGTGCAATGTGTAGTGTGTGTGTATAAATACATATATTCTTGAAATAGACATACCATCAGAGACATCATTCACAAGTAA
CTGATGTATTGGCATCTCATTCATATTTCTGATGTGTGAGGTATATGGTACTAATTACCTTTTCCTTGATGTTTGCCAAATTTGAATAAA
GGCATTGGTACGAAATTACAGAATGTAAAGAAAATGTTTTTGGCTTGAAAAATTAACATATTTTATGACGTACCACAGTATACTCTGCCC
AAACCAGCACCCTATCTATCTTTCCTGTTCTTTACATCCCTGTTCCCCATCCCTACTTCCTCATTTTTGGTATAACACAGTTCTTTTGTA
GCATCATTATAATTGCAGTTCTATGGCAATTGGACAGTTATAGCATGGAAACAGACTGGTATAAGTAGTACAGTAGTCACCAGTGTGCCA
CATTTGCATTAGTAATGCAAAATATACATTTTATAAAGGACAAACTTTGTGTTATGTTTTATTTTCATTACATTGTATAATATTGTAAGA
CTATTGTATGTCCTAATTTGCATTATAAATGTTTTTTTCCTACGTAAAGGCATAAATATAGCAACTTTGTATAAAGGTAGCTTATTAGAT
TTTTAATTTTTTCTTTTATAAAAAATTGTCCAACAGTGGGACTACCATTGCCAAATTGTATATGAAATATGAATTTTACCCCCATGGTTA
ATTTCTTTTATAAACATTCCATATTTCTCTAATAAAAAGACATAAGTGATACTGTACTATGCATACATTGTATCTTAATGCTGTTTCAGA
TCAGCATTTTAAATTTTGGTTTGCATTTTTAATATTGGCAAAACGTAACCACTGTTAATTAAAATAAAACCTTGTTGTATATGTAACAAC
ATAATTTTCCCTCTATCCCTTCCCACCCTTTGTTCTCTATTTCTCCCTATCAGTGCCAACTTCATACATTTTGTAGCATGGCAATAAAAT
ATAACTTTTACACTGAGGCCGAGTGTGGCTTTTTGGAGGAAGTGGGGATGGGACGATTGCCCTCTAGTTGTCCTTTGCATATGACTGTTT
TTTGCCATATAAGCCATGTCATCAGGCATGAAAAGTTTTCTCATATATGATGTAAACTTGCTTTTAAGGACAAGTGTGAATGTGCTTTTT
AAGCTTAATTTTTGTCATGACAACTAATTTTTTTTATCTTTGGAGAAGTCAGAGTTCTTTACAATCAAACGTTTATTAACTGGAGTACTT
AGAATAAGCTAGTAATTGAATTTAGTTCAAGGGCTAAGCAACACATTTTTAAATCCTTATTTATTGTAGAGTATTAGTATACTGTCCTAC
AAATTATGTAAAATATGGTTTAATATTAGATGACTTTGGATTTTGCAATGCCTTACTGTTGTCATTCTAGCATAAATATCCATAATGAGG
TACTCAAGTTGATACTGGAAGCTGAGCTGATCATACACTGACCTGAAGCATTCATGAAAAGCTGCTTTATTGAATAAAGTCTGATTGGAG
TTCTTTTCATGCTCACTTTCCCCTTATTGCTGAAAGTAGATTGCAATAAAACCCCAATAAAACGTTTGGTCGGATCCAGTTTGCTGACCA
GAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGACGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTC
AGCGGCTTCATATACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGCAGTGACTTCTGTGT
TAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAAATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGC
TCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCTGTGCTTATGGAAACTCTGGGTGC
TCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATCTATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGT
TTTTGCCTGGAAGGGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAGGGCTGGCAGCCAAACATGATCTT
GGATGATGGAGGGGATCTTACCCACTGGATTTATAAAAAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTAC
TGGAGTTCACAGGCTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAATGACTCAGTCACCAAACAGAAATT
TGACAACCTCTACTGTTGCCGTGAATCAATTCTTGATGGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTG
TGGCTATGGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTAACTGAAATTGACCCCATCTGTGC
CCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAATTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAA
GAATGTGGTAACCAGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACATTCCAACACAGAGATTGACGTGGC
GAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTGAGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCT
GGCAGAGGGCCGCCTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCTACTACTCAGGCTCTTGCCTTGAT
AGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAGGATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCT
GCCTACCTTTGATGCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAGAATGGGCCCTTCAAGCCTAATTA
CTACAGGTATTAAGTTCCTGTAACTCAAACCAGAATTTTTAAGGAATAGAACTCCAAGCCTTTTCTCCACTACTATACAAGAAAGAATTC


Top

FusionGenePPI for FRS2_AHCYL2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FRS2PTPN11, INSR, SOS1, GRB2, CBL, FGFR1, CRK, NTRK1, NTRK2, NTRK3, RET, PRKCI, FGFR2, FLOT1, SORBS1, SPRY2, LYN, BECN1, RPS6, TMEM17, GAB1, GAB2, CDH1, TRIM25AHCYL2BAP1, JOSD2, WDR48, CLK4, CSNK1E, HOXC9, DHX8, UNKL, ZC3H3, DOK4, PITX2, MSL1, VSX2, GRN, RBM23, SYT6, ZNF444, FAM13C, ZBTB44, ANP32B, ANP32E, RPL17, PSMD4, RPS8, XPO1, AHCYL1, PIP4K2A, CAMKV, ZIC2, FOXK2, HEXIM2, ABCF2, ZNF263, RASL10B, NFKBIL1, PIP4K2C, FOXK1, DUSP11, TGIF2LY, CEP72, HOXB6, FAM19A3, BANP, PIP4K2B, KIF18B, FBXW11, FOXD4, HOXB9, PLCD3, ARRB2, NUAK2, ZNHIT6, EEF1D, CAB39, SNX20, PIP5K1A, ZNF414, C4orf26, CLK3, WDR33, PDCD2L, ARSI, JUN, SOST, PTPN21


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FRS2_AHCYL2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FRS2_AHCYL2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneAHCYL2C0033578Prostatic Neoplasms1CTD_human