FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13890

FusionGeneSummary for FRMD4A_MCM10

check button Fusion gene summary
Fusion gene informationFusion gene name: FRMD4A_MCM10
Fusion gene ID: 13890
HgeneTgene
Gene symbol

FRMD4A

MCM10

Gene ID

55691

55388

Gene nameFERM domain containing 4Aminichromosome maintenance 10 replication initiation factor
SynonymsCCAFCA|FRMD4|bA295P9.4CNA43|DNA43|PRO2249
Cytomap

10p13

10p13

Type of geneprotein-codingprotein-coding
DescriptionFERM domain-containing protein 4AFERM domain containing 4protein MCM10 homologMCM10 minichromosome maintenance deficient 10homolog of yeast MCM10hsMCM10minichromosome maintenance complex component 10
Modification date2018051920180523
UniProtAcc

Q9P2Q2

Q7L590

Ensembl transtripts involved in fusion geneENST00000358621, ENST00000357447, 
ENST00000378503, ENST00000342409, 
ENST00000493380, ENST00000475141, 
ENST00000492155, 
ENST00000378714, 
ENST00000484800, ENST00000378694, 
Fusion gene scores* DoF score6 X 4 X 5=1202 X 2 X 2=8
# samples 62
** MAII scorelog2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: FRMD4A [Title/Abstract] AND MCM10 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-EJ-5525-01AFRMD4Achr10

13900847

-MCM10chr10

13214376

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000358621ENST00000378714FRMD4Achr10

13900847

-MCM10chr10

13214376

+
Frame-shitENST00000358621ENST00000484800FRMD4Achr10

13900847

-MCM10chr10

13214376

+
Frame-shitENST00000358621ENST00000378694FRMD4Achr10

13900847

-MCM10chr10

13214376

+
In-frameENST00000357447ENST00000378714FRMD4Achr10

13900847

-MCM10chr10

13214376

+
In-frameENST00000357447ENST00000484800FRMD4Achr10

13900847

-MCM10chr10

13214376

+
In-frameENST00000357447ENST00000378694FRMD4Achr10

13900847

-MCM10chr10

13214376

+
Frame-shitENST00000378503ENST00000378714FRMD4Achr10

13900847

-MCM10chr10

13214376

+
Frame-shitENST00000378503ENST00000484800FRMD4Achr10

13900847

-MCM10chr10

13214376

+
Frame-shitENST00000378503ENST00000378694FRMD4Achr10

13900847

-MCM10chr10

13214376

+
Frame-shitENST00000342409ENST00000378714FRMD4Achr10

13900847

-MCM10chr10

13214376

+
Frame-shitENST00000342409ENST00000484800FRMD4Achr10

13900847

-MCM10chr10

13214376

+
Frame-shitENST00000342409ENST00000378694FRMD4Achr10

13900847

-MCM10chr10

13214376

+
intron-3CDSENST00000493380ENST00000378714FRMD4Achr10

13900847

-MCM10chr10

13214376

+
intron-3CDSENST00000493380ENST00000484800FRMD4Achr10

13900847

-MCM10chr10

13214376

+
intron-3CDSENST00000493380ENST00000378694FRMD4Achr10

13900847

-MCM10chr10

13214376

+
intron-3CDSENST00000475141ENST00000378714FRMD4Achr10

13900847

-MCM10chr10

13214376

+
intron-3CDSENST00000475141ENST00000484800FRMD4Achr10

13900847

-MCM10chr10

13214376

+
intron-3CDSENST00000475141ENST00000378694FRMD4Achr10

13900847

-MCM10chr10

13214376

+
intron-3CDSENST00000492155ENST00000378714FRMD4Achr10

13900847

-MCM10chr10

13214376

+
intron-3CDSENST00000492155ENST00000484800FRMD4Achr10

13900847

-MCM10chr10

13214376

+
intron-3CDSENST00000492155ENST00000378694FRMD4Achr10

13900847

-MCM10chr10

13214376

+

Top

FusionProtFeatures for FRMD4A_MCM10


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FRMD4A

Q9P2Q2

MCM10

Q7L590

Scaffolding protein that regulates epithelial cellpolarity by connecting ARF6 activation with the PAR3 complex (Bysimilarity). Plays a redundant role with FRMD4B in epithelialpolarization (By similarity). May regulate MAPT secretion byactivating ARF6-signaling (PubMed:27044754).{ECO:0000250|UniProtKB:Q8BIE6, ECO:0000269|PubMed:27044754}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for FRMD4A_MCM10


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FRMD4A_ENST00000357447_chr10_13900847_-_MCM10_ENST00000378714_chr10_13214376_+_795aa
MAVQLVPDSALGLLMMTEGRRCQVHLLDDRKLELLVQRN_GICKSK_RPYKSS_K_QQLNRQQAQPVCKNPLRSLPGHLLRRGEFREFRS
QHAFLRSLMSLRYQEPRGWLEHQRLHLQIPKAHLQG_QVHPPNPYRRFLGTNLVG_LEVKLWGPQEVLGKRLNPSVWKPSLVCGSGGLET
PPQK_TRK_PAEN_SDCLRSRKRWPERSWKK_IG_HLGLT_RRLRHRV_IVEKPSATGN_MIFVT_HNVCPCSTLEKFTKRSGRRSRGLS
_GSSMPTP_SPRMVQRRCVTLSIILRRS_LWVKLLTWEPVKPRRRMESRARRL_ICVTVSTVSTMSRLSTRSSAQSVRICSPPSLEDEFQ
RSLPAEAPASKNGCAKMAFTTEGFLLPRMQLQLQQLWLLRRRFKPL_VIWLLRAQT_SSRKHGKNSEYPRRACLALRSSRN_WTCRRVEP
GT_NNI_PKPQLQGLWGAQNQPSSPSRPQHS_SNRSSGCWR_GEGNQKKYRSDFCRAQVKLRAQLCHLHQDSPLLSLHGQDPSSPGWREP
RPQ_RPSWGEVSWKEMMFSFMMSHHHQDQN_VL_QKPKS_LLSPN_GQKARFLQKQTQTALRRNKRTLRTSWR_RNV_KKTPCFLLKLRM
NWSLPGKKGENNLPIWNLRNFRKS_KQNQNTQAS_KRPRLRCRSATLSHW_KKNKWKKR_ETSEK_SAVS_HARRAPIPTSSCWRPASVS

>In-frame_FRMD4A_ENST00000357447_chr10_13900847_-_MCM10_ENST00000484800_chr10_13214376_+_796aa
MAVQLVPDSALGLLMMTEGRRCQVHLLDDRKLELLVQRN_GICKSK_RPYKSS_K_QQLNRQQAQPVCKNPL_RSLPGHLLRRGEFREFR
SQHAFLRSLMSLRYQEPRGWLEHQRLHLQIPKAHLQG_QVHPPNPYRRFLGTNLVG_LEVKLWGPQEVLGKRLNPSVWKPSLVCGSGGLE
TPPQK_TRK_PAEN_SDCLRSRKRWPERSWKK_IG_HLGLT_RRLRHRV_IVEKPSATGN_MIFVT_HNVCPCSTLEKFTKRSGRRSRGL
S_GSSMPTP_SPRMVQRRCVTLSIILRRS_LWVKLLTWEPVKPRRRMESRARRL_ICVTVSTVSTMSRLSTRSSAQSVRICSPPSLEDEF
QRSLPAEAPASKNGCAKMAFTTEGFLLPRMQLQLQQLWLLRRRFKPL_VIWLLRAQT_SSRKHGKNSEYPRRACLALRSSRN_WTCRRVE
PGT_NNI_PKPQLQGLWGAQNQPSSPSRPQHS_SNRSSGCWR_GEGNQKKYRSDFCRAQVKLRAQLCHLHQDSPLLSLHGQDPSSPGWRE
PRPQ_RPSWGEVSWKEMMFSFMMSHHHQDQN_VL_QKPKS_LLSPN_GQKARFLQKQTQTALRRNKRTLRTSWR_RNV_KKTPCFLLKLR
MNWSLPGKKGENNLPIWNLRNFRKS_KQNQNTQAS_KRPRLRCRSATLSHW_KKNKWKKR_ETSEK_SAVS_HARRAPIPTSSCWRPASV

>In-frame_FRMD4A_ENST00000357447_chr10_13900847_-_MCM10_ENST00000378694_chr10_13214376_+_776aa
MAVQLVPDSALGLLMMTEGRRCQVHLLDDRKLELLVQRN_GICKSK_RPYKSS_K_QQLNRQQAQPVCKNPLRSLPGHLLRRGEFREFRS
QHAFLRSLMSLRYQEPRGWLEHQRLHLQIPKAHLQG_QVHPPNPYRRFLGTNLVG_LEVKLWGPQEVLGKRLNPSVWKPSLVCGSGGLET
PPQK_TRK_PAEN_SDCLRSRKRWPERSWKK_IG_HLGLT_RRLRHRV_IVEKPSATGN_MIFVT_HNVCPCSTLEKFTKRSGRRSRGLS
_GSSMPTP_SPRMVQRRCVTLSIILRRS_LWVKLLTWEPVKPRRRMESRARRL_ICVTVSTVSTMSRLSTRSSAQSVRICSPPSLEDEFQ
RSLPAEAPASKNGCAKMAFTTEGFLLPRMQLQLQQLWLLRRRFKPL_VIWLLRAQT_SSRKHGKNSEYPRRACLALRSSRN_WTCRRVEP
GT_NNI_PKPQLQGLWGAQNQPSSPSRPQHS_SNRSSGCWR_GEGNQKKYRSDFCRAQVKLRAQLCHLHQDSPLLSLHGQDPSSPGWREP
RPQ_RPSWGEVSWKEMMFSFMMSHHHQDQN_VL_QKPKS_LLSPN_GQKARFLQKQTQTALRRNKRTLRTSWR_RNV_KKTPCFLLKLRM
NWSLPGKKGENNLPIWNLRNFRKS_KQNQNTQAS_KRPRLRCRSATLSHW_KKNKWKKR_ETSEK_SAVS_HARRAPIPTSSCWRPASVS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FRMD4A_ENST00000357447_chr10_13900847_-_MCM10_ENST00000378714_chr10_13214376_+_2387nt
ATGGCAGTGCAGCTGGTGCCCGACTCAGCTCTCGGCCTGCTGATGATGACGGAGGGCCGCCGATGTCAAGTACATCTTCTTGATGACAGG
AAGCTGGAACTCCTAGTACAGAGGAATTAAGGAATTTGCAAGAGCAAATGAAGGCCTTACAAGAGCAGCTAAAAGTAACAACAATTAAAC
AGACAGCAAGCCCAGCCCGTCTGCAAAAATCCCCTGAGAAGTCTCCCCGGCCACCTCTTAAGGAGAGGAGAGTTCAGAGAATTCAGGAGT
CAACATGCTTTTCTGCGGAGCTTGATGTCCCTGCGCTACCAAGAACCAAGAGGGTGGCTCGAACACCAAAGGCTTCACCTCCAGATCCCA
AAAGCTCATCTTCAAGGATGACAAGTGCACCCTCCCAACCCCTACAGACGATTTCTCGGAACAAACCTAGTGGGATAACTAGAGGTCAAA
TTGTGGGGACCCCAGGAAGTTCTGGGGAAACGACTCAACCCATCTGTGTGGAAGCCTTCTCTGGTCTGCGGCTCAGGCGGCCTCGAGTAT
CCTCCACAGAAATGAACAAGAAAATGACCGGCCGAAAACTGATCAGACTGTCTCAGATCAAGGAAAAGATGGCCAGAGAGAAGCTGGAAG
AAATAGATTGGGTGACATTTGGGGTTATATTGAAGAAGGTTACGCCACAGAGTGTGAATAGTGGAAAAACCTTCAGCATATGGAAACTGA
ATGATCTTCGTGACCTGACACAATGTGTGTCCTTGTTCTTATTTGGAGAAGTTCACAAAGCGCTCTGGAAGACGGAGCAGGGGACTGTCG
TAGGGATCCTCAATGCCAACCCCATGAAGCCCAAGGATGGTTCAGAGGAGGTGTGTTTATCTATCGATCATCCTCAGAAGGTCTTAATTA
TGGGTGAAGCTCTTGACCTGGGAACCTGTAAAGCCAAGAAGAAGAATGGAGAGCCGTGCACGCAGACTGTGAATTTGCGTGACTGTGAGT
ACTGTCAGTACCATGTCCAGGCTCAGTACAAGAAGCTCAGCGCAAAGCGTGCGGATCTGCAGTCCACCTTCTCTGGAGGACGAATTCCAA
AGAAGTTTGCCCGCAGAGGCACCAGCCTCAAAGAACGGCTGTGCCAAGATGGCTTTTACTACGGAGGGGTTTCTTCTGCCTCGTATGCAG
CTTCAATTGCAGCAGCTGTGGCTCCTAAGAAGAAGATTCAAACCACTCTGAGTAATCTGGTTGTTAAGGGCACAAACTTGATCATCCAGG
AAACACGGCAAAAACTCGGAATACCCCAGAAGAGCCTGTCTTGCTCTGAGGAGTTCAAGGAACTGATGGACCTGCCGACGTGTGGAGCCA
GGAACTTAAAACAACATTTAGCCAAAGCCACAGCTTCAGGGATTATGGGGAGCCCAAAACCAGCCATCAAGTCCATCTCGGCCTCAGCAC
TCTTGAAGCAACAGAAGCAGCGGATGTTGGAGATGAGGAGAAGGAAATCAGAAGAAATACAGAAGCGATTTCTGCAGAGCTCAAGTGAAG
TTGAGAGCCCAGCTGTGCCATCTTCATCAAGACAGCCCCCTGCTCAGCCTCCACGGACAGGATCCGAGTTCCCCAGGCTGGAGGGAGCCC
CGGCCACAATGACGCCCAAGCTGGGGCGAGGTGTCTTGGAAGGAGATGATGTTCTCTTTTATGATGAGTCACCACCACCAAGACCAAAAC
TGAGTGCTTTAGCAGAAGCCAAAAAGTTAGCTGCTATCACCAAATTAAGGGCAAAAGGCCAGGTTCTTACAAAAACAAACCCAAACAGCA
TTAAGAAGAAACAAAAGGACCCTCAGGACATCCTGGAGGTGAAGGAACGTGTAGAAAAAAACACCATGTTTTCTTCTCAAGCTGAGGATG
AATTGGAGCCTGCCAGGAAAAAAAGGAGAGAACAACTTGCCTATCTGGAATCTGAGGAATTTCAGAAAATCCTAAAAGCAAAATCAAAAC
ACACAGGCATCCTGAAAGAGGCCGAGGCTGAGATGCAGGAGCGCTACTTTGAGCCACTGGTGAAAAAAGAACAAATGGAAGAAAAGATGA
GAAACATCAGAGAAGTGAAGTGCCGTGTCGTGACATGCAAGACGTGCGCCTATACCCACTTCAAGCTGCTGGAGACCTGCGTCAGTGAGC
AGCATGAATACCACTGGCATGATGGTGTGAAGAGGTTTTTCAAATGTCCCTGTGGAAACAGAAGCATCTCCTTGGACAGACTCCCGAACA
AGCACTGCAGTAACTGTGGCCTCTACAAATGGGAACGGGACGGAATGCTAAAGGAAAAGACTGGTCCAAAGATAGGAGGAGAAACTCTGT

>In-frame_FRMD4A_ENST00000357447_chr10_13900847_-_MCM10_ENST00000484800_chr10_13214376_+_2390nt
ATGGCAGTGCAGCTGGTGCCCGACTCAGCTCTCGGCCTGCTGATGATGACGGAGGGCCGCCGATGTCAAGTACATCTTCTTGATGACAGG
AAGCTGGAACTCCTAGTACAGAGGAATTAAGGAATTTGCAAGAGCAAATGAAGGCCTTACAAGAGCAGCTAAAAGTAACAACAATTAAAC
AGACAGCAAGCCCAGCCCGTCTGCAAAAATCCCCTGTAGAGAAGTCTCCCCGGCCACCTCTTAAGGAGAGGAGAGTTCAGAGAATTCAGG
AGTCAACATGCTTTTCTGCGGAGCTTGATGTCCCTGCGCTACCAAGAACCAAGAGGGTGGCTCGAACACCAAAGGCTTCACCTCCAGATC
CCAAAAGCTCATCTTCAAGGATGACAAGTGCACCCTCCCAACCCCTACAGACGATTTCTCGGAACAAACCTAGTGGGATAACTAGAGGTC
AAATTGTGGGGACCCCAGGAAGTTCTGGGGAAACGACTCAACCCATCTGTGTGGAAGCCTTCTCTGGTCTGCGGCTCAGGCGGCCTCGAG
TATCCTCCACAGAAATGAACAAGAAAATGACCGGCCGAAAACTGATCAGACTGTCTCAGATCAAGGAAAAGATGGCCAGAGAGAAGCTGG
AAGAAATAGATTGGGTGACATTTGGGGTTATATTGAAGAAGGTTACGCCACAGAGTGTGAATAGTGGAAAAACCTTCAGCATATGGAAAC
TGAATGATCTTCGTGACCTGACACAATGTGTGTCCTTGTTCTTATTTGGAGAAGTTCACAAAGCGCTCTGGAAGACGGAGCAGGGGACTG
TCGTAGGGATCCTCAATGCCAACCCCATGAAGCCCAAGGATGGTTCAGAGGAGGTGTGTTTATCTATCGATCATCCTCAGAAGGTCTTAA
TTATGGGTGAAGCTCTTGACCTGGGAACCTGTAAAGCCAAGAAGAAGAATGGAGAGCCGTGCACGCAGACTGTGAATTTGCGTGACTGTG
AGTACTGTCAGTACCATGTCCAGGCTCAGTACAAGAAGCTCAGCGCAAAGCGTGCGGATCTGCAGTCCACCTTCTCTGGAGGACGAATTC
CAAAGAAGTTTGCCCGCAGAGGCACCAGCCTCAAAGAACGGCTGTGCCAAGATGGCTTTTACTACGGAGGGGTTTCTTCTGCCTCGTATG
CAGCTTCAATTGCAGCAGCTGTGGCTCCTAAGAAGAAGATTCAAACCACTCTGAGTAATCTGGTTGTTAAGGGCACAAACTTGATCATCC
AGGAAACACGGCAAAAACTCGGAATACCCCAGAAGAGCCTGTCTTGCTCTGAGGAGTTCAAGGAACTGATGGACCTGCCGACGTGTGGAG
CCAGGAACTTAAAACAACATTTAGCCAAAGCCACAGCTTCAGGGATTATGGGGAGCCCAAAACCAGCCATCAAGTCCATCTCGGCCTCAG
CACTCTTGAAGCAACAGAAGCAGCGGATGTTGGAGATGAGGAGAAGGAAATCAGAAGAAATACAGAAGCGATTTCTGCAGAGCTCAAGTG
AAGTTGAGAGCCCAGCTGTGCCATCTTCATCAAGACAGCCCCCTGCTCAGCCTCCACGGACAGGATCCGAGTTCCCCAGGCTGGAGGGAG
CCCCGGCCACAATGACGCCCAAGCTGGGGCGAGGTGTCTTGGAAGGAGATGATGTTCTCTTTTATGATGAGTCACCACCACCAAGACCAA
AACTGAGTGCTTTAGCAGAAGCCAAAAAGTTAGCTGCTATCACCAAATTAAGGGCAAAAGGCCAGGTTCTTACAAAAACAAACCCAAACA
GCATTAAGAAGAAACAAAAGGACCCTCAGGACATCCTGGAGGTGAAGGAACGTGTAGAAAAAAACACCATGTTTTCTTCTCAAGCTGAGG
ATGAATTGGAGCCTGCCAGGAAAAAAAGGAGAGAACAACTTGCCTATCTGGAATCTGAGGAATTTCAGAAAATCCTAAAAGCAAAATCAA
AACACACAGGCATCCTGAAAGAGGCCGAGGCTGAGATGCAGGAGCGCTACTTTGAGCCACTGGTGAAAAAAGAACAAATGGAAGAAAAGA
TGAGAAACATCAGAGAAGTGAAGTGCCGTGTCGTGACATGCAAGACGTGCGCCTATACCCACTTCAAGCTGCTGGAGACCTGCGTCAGTG
AGCAGCATGAATACCACTGGCATGATGGTGTGAAGAGGTTTTTCAAATGTCCCTGTGGAAACAGAAGCATCTCCTTGGACAGACTCCCGA
ACAAGCACTGCAGTAACTGTGGCCTCTACAAATGGGAACGGGACGGAATGCTAAAGGAAAAGACTGGTCCAAAGATAGGAGGAGAAACTC

>In-frame_FRMD4A_ENST00000357447_chr10_13900847_-_MCM10_ENST00000378694_chr10_13214376_+_2330nt
ATGGCAGTGCAGCTGGTGCCCGACTCAGCTCTCGGCCTGCTGATGATGACGGAGGGCCGCCGATGTCAAGTACATCTTCTTGATGACAGG
AAGCTGGAACTCCTAGTACAGAGGAATTAAGGAATTTGCAAGAGCAAATGAAGGCCTTACAAGAGCAGCTAAAAGTAACAACAATTAAAC
AGACAGCAAGCCCAGCCCGTCTGCAAAAATCCCCTGAGAAGTCTCCCCGGCCACCTCTTAAGGAGAGGAGAGTTCAGAGAATTCAGGAGT
CAACATGCTTTTCTGCGGAGCTTGATGTCCCTGCGCTACCAAGAACCAAGAGGGTGGCTCGAACACCAAAGGCTTCACCTCCAGATCCCA
AAAGCTCATCTTCAAGGATGACAAGTGCACCCTCCCAACCCCTACAGACGATTTCTCGGAACAAACCTAGTGGGATAACTAGAGGTCAAA
TTGTGGGGACCCCAGGAAGTTCTGGGGAAACGACTCAACCCATCTGTGTGGAAGCCTTCTCTGGTCTGCGGCTCAGGCGGCCTCGAGTAT
CCTCCACAGAAATGAACAAGAAAATGACCGGCCGAAAACTGATCAGACTGTCTCAGATCAAGGAAAAGATGGCCAGAGAGAAGCTGGAAG
AAATAGATTGGGTGACATTTGGGGTTATATTGAAGAAGGTTACGCCACAGAGTGTGAATAGTGGAAAAACCTTCAGCATATGGAAACTGA
ATGATCTTCGTGACCTGACACAATGTGTGTCCTTGTTCTTATTTGGAGAAGTTCACAAAGCGCTCTGGAAGACGGAGCAGGGGACTGTCG
TAGGGATCCTCAATGCCAACCCCATGAAGCCCAAGGATGGTTCAGAGGAGGTGTGTTTATCTATCGATCATCCTCAGAAGGTCTTAATTA
TGGGTGAAGCTCTTGACCTGGGAACCTGTAAAGCCAAGAAGAAGAATGGAGAGCCGTGCACGCAGACTGTGAATTTGCGTGACTGTGAGT
ACTGTCAGTACCATGTCCAGGCTCAGTACAAGAAGCTCAGCGCAAAGCGTGCGGATCTGCAGTCCACCTTCTCTGGAGGACGAATTCCAA
AGAAGTTTGCCCGCAGAGGCACCAGCCTCAAAGAACGGCTGTGCCAAGATGGCTTTTACTACGGAGGGGTTTCTTCTGCCTCGTATGCAG
CTTCAATTGCAGCAGCTGTGGCTCCTAAGAAGAAGATTCAAACCACTCTGAGTAATCTGGTTGTTAAGGGCACAAACTTGATCATCCAGG
AAACACGGCAAAAACTCGGAATACCCCAGAAGAGCCTGTCTTGCTCTGAGGAGTTCAAGGAACTGATGGACCTGCCGACGTGTGGAGCCA
GGAACTTAAAACAACATTTAGCCAAAGCCACAGCTTCAGGGATTATGGGGAGCCCAAAACCAGCCATCAAGTCCATCTCGGCCTCAGCAC
TCTTGAAGCAACAGAAGCAGCGGATGTTGGAGATGAGGAGAAGGAAATCAGAAGAAATACAGAAGCGATTTCTGCAGAGCTCAAGTGAAG
TTGAGAGCCCAGCTGTGCCATCTTCATCAAGACAGCCCCCTGCTCAGCCTCCACGGACAGGATCCGAGTTCCCCAGGCTGGAGGGAGCCC
CGGCCACAATGACGCCCAAGCTGGGGCGAGGTGTCTTGGAAGGAGATGATGTTCTCTTTTATGATGAGTCACCACCACCAAGACCAAAAC
TGAGTGCTTTAGCAGAAGCCAAAAAGTTAGCTGCTATCACCAAATTAAGGGCAAAAGGCCAGGTTCTTACAAAAACAAACCCAAACAGCA
TTAAGAAGAAACAAAAGGACCCTCAGGACATCCTGGAGGTGAAGGAACGTGTAGAAAAAAACACCATGTTTTCTTCTCAAGCTGAGGATG
AATTGGAGCCTGCCAGGAAAAAAAGGAGAGAACAACTTGCCTATCTGGAATCTGAGGAATTTCAGAAAATCCTAAAAGCAAAATCAAAAC
ACACAGGCATCCTGAAAGAGGCCGAGGCTGAGATGCAGGAGCGCTACTTTGAGCCACTGGTGAAAAAAGAACAAATGGAAGAAAAGATGA
GAAACATCAGAGAAGTGAAGTGCCGTGTCGTGACATGCAAGACGTGCGCCTATACCCACTTCAAGCTGCTGGAGACCTGCGTCAGTGAGC
AGCATGAATACCACTGGCATGATGGTGTGAAGAGGTTTTTCAAATGTCCCTGTGGAAACAGAAGCATCTCCTTGGACAGACTCCCGAACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_FRMD4A_ENST00000357447_chr10_13900847_-_MCM10_ENST00000378714_chr10_13214376_+_4550nt
GAACGCTCACAGAACAGGCAGTGCAATTCCATGTTCCTCTTAAGTATGTTAGCCCTACCGGGAGCTGAGCTGGCCAGTCTACTTGGAGAG
GAAAAGTAGATCTGGGGAAGGTGGAAGGGTCAGTTCCTAAGTGACTTCCTCCTCGGGGATGGTAAGGGCATTTGCTGATCTCCAGTGACT
GCCTGGTGCCTCATGGTCAGACTCGGCTGTCTCACTCCCAGATATCTGATTTTGCAAAAAGGGACACACCTATCTGCAGCAAAGAAGACA
CTGACCAGATTGCGAGCGGTGCTTTTGGATGCTCTGTAGCCACCCGGGGCCCAGGAGGACTGACTCGGCAGCAGGATTCGTGCATGGGAA
TCGGAGACCATGGCAGTGCAGCTGGTGCCCGACTCAGCTCTCGGCCTGCTGATGATGACGGAGGGCCGCCGATGTCAAGTACATCTTCTT
GATGACAGGAAGCTGGAACTCCTAGTACAGAGGAATTAAGGAATTTGCAAGAGCAAATGAAGGCCTTACAAGAGCAGCTAAAAGTAACAA
CAATTAAACAGACAGCAAGCCCAGCCCGTCTGCAAAAATCCCCTGAGAAGTCTCCCCGGCCACCTCTTAAGGAGAGGAGAGTTCAGAGAA
TTCAGGAGTCAACATGCTTTTCTGCGGAGCTTGATGTCCCTGCGCTACCAAGAACCAAGAGGGTGGCTCGAACACCAAAGGCTTCACCTC
CAGATCCCAAAAGCTCATCTTCAAGGATGACAAGTGCACCCTCCCAACCCCTACAGACGATTTCTCGGAACAAACCTAGTGGGATAACTA
GAGGTCAAATTGTGGGGACCCCAGGAAGTTCTGGGGAAACGACTCAACCCATCTGTGTGGAAGCCTTCTCTGGTCTGCGGCTCAGGCGGC
CTCGAGTATCCTCCACAGAAATGAACAAGAAAATGACCGGCCGAAAACTGATCAGACTGTCTCAGATCAAGGAAAAGATGGCCAGAGAGA
AGCTGGAAGAAATAGATTGGGTGACATTTGGGGTTATATTGAAGAAGGTTACGCCACAGAGTGTGAATAGTGGAAAAACCTTCAGCATAT
GGAAACTGAATGATCTTCGTGACCTGACACAATGTGTGTCCTTGTTCTTATTTGGAGAAGTTCACAAAGCGCTCTGGAAGACGGAGCAGG
GGACTGTCGTAGGGATCCTCAATGCCAACCCCATGAAGCCCAAGGATGGTTCAGAGGAGGTGTGTTTATCTATCGATCATCCTCAGAAGG
TCTTAATTATGGGTGAAGCTCTTGACCTGGGAACCTGTAAAGCCAAGAAGAAGAATGGAGAGCCGTGCACGCAGACTGTGAATTTGCGTG
ACTGTGAGTACTGTCAGTACCATGTCCAGGCTCAGTACAAGAAGCTCAGCGCAAAGCGTGCGGATCTGCAGTCCACCTTCTCTGGAGGAC
GAATTCCAAAGAAGTTTGCCCGCAGAGGCACCAGCCTCAAAGAACGGCTGTGCCAAGATGGCTTTTACTACGGAGGGGTTTCTTCTGCCT
CGTATGCAGCTTCAATTGCAGCAGCTGTGGCTCCTAAGAAGAAGATTCAAACCACTCTGAGTAATCTGGTTGTTAAGGGCACAAACTTGA
TCATCCAGGAAACACGGCAAAAACTCGGAATACCCCAGAAGAGCCTGTCTTGCTCTGAGGAGTTCAAGGAACTGATGGACCTGCCGACGT
GTGGAGCCAGGAACTTAAAACAACATTTAGCCAAAGCCACAGCTTCAGGGATTATGGGGAGCCCAAAACCAGCCATCAAGTCCATCTCGG
CCTCAGCACTCTTGAAGCAACAGAAGCAGCGGATGTTGGAGATGAGGAGAAGGAAATCAGAAGAAATACAGAAGCGATTTCTGCAGAGCT
CAAGTGAAGTTGAGAGCCCAGCTGTGCCATCTTCATCAAGACAGCCCCCTGCTCAGCCTCCACGGACAGGATCCGAGTTCCCCAGGCTGG
AGGGAGCCCCGGCCACAATGACGCCCAAGCTGGGGCGAGGTGTCTTGGAAGGAGATGATGTTCTCTTTTATGATGAGTCACCACCACCAA
GACCAAAACTGAGTGCTTTAGCAGAAGCCAAAAAGTTAGCTGCTATCACCAAATTAAGGGCAAAAGGCCAGGTTCTTACAAAAACAAACC
CAAACAGCATTAAGAAGAAACAAAAGGACCCTCAGGACATCCTGGAGGTGAAGGAACGTGTAGAAAAAAACACCATGTTTTCTTCTCAAG
CTGAGGATGAATTGGAGCCTGCCAGGAAAAAAAGGAGAGAACAACTTGCCTATCTGGAATCTGAGGAATTTCAGAAAATCCTAAAAGCAA
AATCAAAACACACAGGCATCCTGAAAGAGGCCGAGGCTGAGATGCAGGAGCGCTACTTTGAGCCACTGGTGAAAAAAGAACAAATGGAAG
AAAAGATGAGAAACATCAGAGAAGTGAAGTGCCGTGTCGTGACATGCAAGACGTGCGCCTATACCCACTTCAAGCTGCTGGAGACCTGCG
TCAGTGAGCAGCATGAATACCACTGGCATGATGGTGTGAAGAGGTTTTTCAAATGTCCCTGTGGAAACAGAAGCATCTCCTTGGACAGAC
TCCCGAACAAGCACTGCAGTAACTGTGGCCTCTACAAATGGGAACGGGACGGAATGCTAAAGGAAAAGACTGGTCCAAAGATAGGAGGAG
AAACTCTGTTACCAAGAGGAGAAGAACATGCTAAATTTCTGAACAGCCTTAAATAACCCGAACTTCAGACATTTTCCCACAGACTTCCTG
GCCTCCTGTGACTCTGGAAAGCAAAGGATTGGCTGTGTATTGTCCATTGATTCCTGATTGACGCCGTCAAAAACAAATGCTTGTTAAGCC
CATAAGCTTTGCCTGCTTACTTTCTGCCATTGGGTTGGTTTGATACCACATTTAACATTGACATTTAAGTGGAAAACCAAGTTATCATTG
TCTTTTCTAAGCTCAGTGTGGATGATTGCATTACTTCATTCACTGAAGTTTTTGCCCAAAAATTGGAAGGTAAACAGAGAGCTATGTTTC
TGTATCTTTTGGTTATAGAGTGTTCACTTCTTTATCATAACAAAATTCTAGTGTTTATACGAACACCCAGAGGCAAAAGAATTTGGCTTA
ATTCTCACTCCAGGTAAGTAGCTTAACTTCTGGGCTTCAGTTTTCTCATCTGTAAAATCAGGAAGATTGGACTAAGTGATCCTGAAATGT
ATTTTTTAGCACTGGATTTCTACAAATAATAAAACTTTCCCATCTAGATAATGATGATCACATAGTCTTGATGTACGGACATTAAAAGCC
AGATTTCTTCATTCAATTCTGTTATCTCTGTTTTACTCTTTGAAATTGATCAAGCCACTGAATCACTTTGCATTTCAGTTTATATATATA
GAGAGAAAGAAGGTGTCTGCTCTTACATTATTGTGGAGCCCTGTGATAGAAATATGTAAAATCTCATATTATTTTTTTTTTAATTTTTTT
ATTTTTTATGACAGGGTCTCACTATGTCACCCTGGCTGGAGTGCAGTAGTGCGATCGCGGCACACTGCAGCCTTGGCTTCCCTGGGCTCA
AGCAGTCCTCCCACCTCAGTCTCCCAAATAGCTAGGACTACAGGCGTGCGTGACCAAGCCCAGCTAATTTTTGCATTTTTTGTAGAGATG
GGGTTTTGCCATGTTGCTCAGGCTGGTCTCAAACTCCTGAGCACTAGCAATCCACCCACCTCTGTTTCCAAAAAAAAAAAAAAAATGAAA
GGTCAACCCCTATGCAAATTACCACAGCAAAGGTTTCATTCAGGAGATTCTTCCATCTGGGCAACCTGGTTTTCCAAATATCATTTGACC
TAAGTGAATGTTGATACTAGCTAAAGATTGGGTAAATTGGTTGAATTATTGTATTGAAGCTTGAGCTGTAGCTAAAAGTAATTTAGGTTT
CCCCTAAGATGTTATTATGTTAGGGACATAACACTTTTGGGAGGTTGTTGTGGGAGATGGTTGATTTAGGTTTTCAAAAGCTAGAAATAA
AATTTACATGCCTTAGATTTCATAAAATTCTGCTCTAATTGGGTGGAAGGTGCTGTATCTAACTTGTGTTCCTCCTAAGGTTATGTCCTA
ATAACTATTCTTTTAGGAGTATACTTCTACTTTATAGAAGGTTGCTTTTCTTTTTAATTTTTTCTAACAAAGAAAAGAATAAAGTATTTA
TTAATAAGAACCAGAAAGCACTTGAAACTGATGTTTTTAATGGCTCATTTAGGGTAGATTTATTTATCTCATTAACTTAAAACAGCTATG
TGTATGAAATAGGTCACAACAGAACTTGAACACCAGGTTGGTGTCTGAGCAATCCCTTTCTTATGGGAAAAACAATGTTCTTGTTTGAAC
AGAGGGTATCATTGCAGTCAGTATTCACGTGTATATTGTTATATAAGTTGTATAATATGCTTGTAAAGGCTGAGGGTGAGCTGTATCTGG

>In-frame_FRMD4A_ENST00000357447_chr10_13900847_-_MCM10_ENST00000484800_chr10_13214376_+_3185nt
GAACGCTCACAGAACAGGCAGTGCAATTCCATGTTCCTCTTAAGTATGTTAGCCCTACCGGGAGCTGAGCTGGCCAGTCTACTTGGAGAG
GAAAAGTAGATCTGGGGAAGGTGGAAGGGTCAGTTCCTAAGTGACTTCCTCCTCGGGGATGGTAAGGGCATTTGCTGATCTCCAGTGACT
GCCTGGTGCCTCATGGTCAGACTCGGCTGTCTCACTCCCAGATATCTGATTTTGCAAAAAGGGACACACCTATCTGCAGCAAAGAAGACA
CTGACCAGATTGCGAGCGGTGCTTTTGGATGCTCTGTAGCCACCCGGGGCCCAGGAGGACTGACTCGGCAGCAGGATTCGTGCATGGGAA
TCGGAGACCATGGCAGTGCAGCTGGTGCCCGACTCAGCTCTCGGCCTGCTGATGATGACGGAGGGCCGCCGATGTCAAGTACATCTTCTT
GATGACAGGAAGCTGGAACTCCTAGTACAGAGGAATTAAGGAATTTGCAAGAGCAAATGAAGGCCTTACAAGAGCAGCTAAAAGTAACAA
CAATTAAACAGACAGCAAGCCCAGCCCGTCTGCAAAAATCCCCTGTAGAGAAGTCTCCCCGGCCACCTCTTAAGGAGAGGAGAGTTCAGA
GAATTCAGGAGTCAACATGCTTTTCTGCGGAGCTTGATGTCCCTGCGCTACCAAGAACCAAGAGGGTGGCTCGAACACCAAAGGCTTCAC
CTCCAGATCCCAAAAGCTCATCTTCAAGGATGACAAGTGCACCCTCCCAACCCCTACAGACGATTTCTCGGAACAAACCTAGTGGGATAA
CTAGAGGTCAAATTGTGGGGACCCCAGGAAGTTCTGGGGAAACGACTCAACCCATCTGTGTGGAAGCCTTCTCTGGTCTGCGGCTCAGGC
GGCCTCGAGTATCCTCCACAGAAATGAACAAGAAAATGACCGGCCGAAAACTGATCAGACTGTCTCAGATCAAGGAAAAGATGGCCAGAG
AGAAGCTGGAAGAAATAGATTGGGTGACATTTGGGGTTATATTGAAGAAGGTTACGCCACAGAGTGTGAATAGTGGAAAAACCTTCAGCA
TATGGAAACTGAATGATCTTCGTGACCTGACACAATGTGTGTCCTTGTTCTTATTTGGAGAAGTTCACAAAGCGCTCTGGAAGACGGAGC
AGGGGACTGTCGTAGGGATCCTCAATGCCAACCCCATGAAGCCCAAGGATGGTTCAGAGGAGGTGTGTTTATCTATCGATCATCCTCAGA
AGGTCTTAATTATGGGTGAAGCTCTTGACCTGGGAACCTGTAAAGCCAAGAAGAAGAATGGAGAGCCGTGCACGCAGACTGTGAATTTGC
GTGACTGTGAGTACTGTCAGTACCATGTCCAGGCTCAGTACAAGAAGCTCAGCGCAAAGCGTGCGGATCTGCAGTCCACCTTCTCTGGAG
GACGAATTCCAAAGAAGTTTGCCCGCAGAGGCACCAGCCTCAAAGAACGGCTGTGCCAAGATGGCTTTTACTACGGAGGGGTTTCTTCTG
CCTCGTATGCAGCTTCAATTGCAGCAGCTGTGGCTCCTAAGAAGAAGATTCAAACCACTCTGAGTAATCTGGTTGTTAAGGGCACAAACT
TGATCATCCAGGAAACACGGCAAAAACTCGGAATACCCCAGAAGAGCCTGTCTTGCTCTGAGGAGTTCAAGGAACTGATGGACCTGCCGA
CGTGTGGAGCCAGGAACTTAAAACAACATTTAGCCAAAGCCACAGCTTCAGGGATTATGGGGAGCCCAAAACCAGCCATCAAGTCCATCT
CGGCCTCAGCACTCTTGAAGCAACAGAAGCAGCGGATGTTGGAGATGAGGAGAAGGAAATCAGAAGAAATACAGAAGCGATTTCTGCAGA
GCTCAAGTGAAGTTGAGAGCCCAGCTGTGCCATCTTCATCAAGACAGCCCCCTGCTCAGCCTCCACGGACAGGATCCGAGTTCCCCAGGC
TGGAGGGAGCCCCGGCCACAATGACGCCCAAGCTGGGGCGAGGTGTCTTGGAAGGAGATGATGTTCTCTTTTATGATGAGTCACCACCAC
CAAGACCAAAACTGAGTGCTTTAGCAGAAGCCAAAAAGTTAGCTGCTATCACCAAATTAAGGGCAAAAGGCCAGGTTCTTACAAAAACAA
ACCCAAACAGCATTAAGAAGAAACAAAAGGACCCTCAGGACATCCTGGAGGTGAAGGAACGTGTAGAAAAAAACACCATGTTTTCTTCTC
AAGCTGAGGATGAATTGGAGCCTGCCAGGAAAAAAAGGAGAGAACAACTTGCCTATCTGGAATCTGAGGAATTTCAGAAAATCCTAAAAG
CAAAATCAAAACACACAGGCATCCTGAAAGAGGCCGAGGCTGAGATGCAGGAGCGCTACTTTGAGCCACTGGTGAAAAAAGAACAAATGG
AAGAAAAGATGAGAAACATCAGAGAAGTGAAGTGCCGTGTCGTGACATGCAAGACGTGCGCCTATACCCACTTCAAGCTGCTGGAGACCT
GCGTCAGTGAGCAGCATGAATACCACTGGCATGATGGTGTGAAGAGGTTTTTCAAATGTCCCTGTGGAAACAGAAGCATCTCCTTGGACA
GACTCCCGAACAAGCACTGCAGTAACTGTGGCCTCTACAAATGGGAACGGGACGGAATGCTAAAGGAAAAGACTGGTCCAAAGATAGGAG
GAGAAACTCTGTTACCAAGAGGAGAAGAACATGCTAAATTTCTGAACAGCCTTAAATAACCCGAACTTCAGACATTTTCCCACAGACTTC
CTGGCCTCCTGTGACTCTGGAAAGCAAAGGATTGGCTGTGTATTGTCCATTGATTCCTGATTGACGCCGTCAAAAACAAATGCTTGTTAA
GCCCATAAGCTTTGCCTGCTTACTTTCTGCCATTGGGTTGGTTTGATACCACATTTAACATTGACATTTAAGTGGAAAACCAAGTTATCA
TTGTCTTTTCTAAGCTCAGTGTGGATGATTGCATTACTTCATTCACTGAAGTTTTTGCCCAAAAATTGGAAGGTAAACAGAGAGCTATGT
TTCTGTATCTTTTGGTTATAGAGTGTTCACTTCTTTATCATAACAAAATTCTAGTGTTTATACGAACACCCAGAGGCAAAAGAATTTGGC

>In-frame_FRMD4A_ENST00000357447_chr10_13900847_-_MCM10_ENST00000378694_chr10_13214376_+_4643nt
GAACGCTCACAGAACAGGCAGTGCAATTCCATGTTCCTCTTAAGTATGTTAGCCCTACCGGGAGCTGAGCTGGCCAGTCTACTTGGAGAG
GAAAAGTAGATCTGGGGAAGGTGGAAGGGTCAGTTCCTAAGTGACTTCCTCCTCGGGGATGGTAAGGGCATTTGCTGATCTCCAGTGACT
GCCTGGTGCCTCATGGTCAGACTCGGCTGTCTCACTCCCAGATATCTGATTTTGCAAAAAGGGACACACCTATCTGCAGCAAAGAAGACA
CTGACCAGATTGCGAGCGGTGCTTTTGGATGCTCTGTAGCCACCCGGGGCCCAGGAGGACTGACTCGGCAGCAGGATTCGTGCATGGGAA
TCGGAGACCATGGCAGTGCAGCTGGTGCCCGACTCAGCTCTCGGCCTGCTGATGATGACGGAGGGCCGCCGATGTCAAGTACATCTTCTT
GATGACAGGAAGCTGGAACTCCTAGTACAGAGGAATTAAGGAATTTGCAAGAGCAAATGAAGGCCTTACAAGAGCAGCTAAAAGTAACAA
CAATTAAACAGACAGCAAGCCCAGCCCGTCTGCAAAAATCCCCTGAGAAGTCTCCCCGGCCACCTCTTAAGGAGAGGAGAGTTCAGAGAA
TTCAGGAGTCAACATGCTTTTCTGCGGAGCTTGATGTCCCTGCGCTACCAAGAACCAAGAGGGTGGCTCGAACACCAAAGGCTTCACCTC
CAGATCCCAAAAGCTCATCTTCAAGGATGACAAGTGCACCCTCCCAACCCCTACAGACGATTTCTCGGAACAAACCTAGTGGGATAACTA
GAGGTCAAATTGTGGGGACCCCAGGAAGTTCTGGGGAAACGACTCAACCCATCTGTGTGGAAGCCTTCTCTGGTCTGCGGCTCAGGCGGC
CTCGAGTATCCTCCACAGAAATGAACAAGAAAATGACCGGCCGAAAACTGATCAGACTGTCTCAGATCAAGGAAAAGATGGCCAGAGAGA
AGCTGGAAGAAATAGATTGGGTGACATTTGGGGTTATATTGAAGAAGGTTACGCCACAGAGTGTGAATAGTGGAAAAACCTTCAGCATAT
GGAAACTGAATGATCTTCGTGACCTGACACAATGTGTGTCCTTGTTCTTATTTGGAGAAGTTCACAAAGCGCTCTGGAAGACGGAGCAGG
GGACTGTCGTAGGGATCCTCAATGCCAACCCCATGAAGCCCAAGGATGGTTCAGAGGAGGTGTGTTTATCTATCGATCATCCTCAGAAGG
TCTTAATTATGGGTGAAGCTCTTGACCTGGGAACCTGTAAAGCCAAGAAGAAGAATGGAGAGCCGTGCACGCAGACTGTGAATTTGCGTG
ACTGTGAGTACTGTCAGTACCATGTCCAGGCTCAGTACAAGAAGCTCAGCGCAAAGCGTGCGGATCTGCAGTCCACCTTCTCTGGAGGAC
GAATTCCAAAGAAGTTTGCCCGCAGAGGCACCAGCCTCAAAGAACGGCTGTGCCAAGATGGCTTTTACTACGGAGGGGTTTCTTCTGCCT
CGTATGCAGCTTCAATTGCAGCAGCTGTGGCTCCTAAGAAGAAGATTCAAACCACTCTGAGTAATCTGGTTGTTAAGGGCACAAACTTGA
TCATCCAGGAAACACGGCAAAAACTCGGAATACCCCAGAAGAGCCTGTCTTGCTCTGAGGAGTTCAAGGAACTGATGGACCTGCCGACGT
GTGGAGCCAGGAACTTAAAACAACATTTAGCCAAAGCCACAGCTTCAGGGATTATGGGGAGCCCAAAACCAGCCATCAAGTCCATCTCGG
CCTCAGCACTCTTGAAGCAACAGAAGCAGCGGATGTTGGAGATGAGGAGAAGGAAATCAGAAGAAATACAGAAGCGATTTCTGCAGAGCT
CAAGTGAAGTTGAGAGCCCAGCTGTGCCATCTTCATCAAGACAGCCCCCTGCTCAGCCTCCACGGACAGGATCCGAGTTCCCCAGGCTGG
AGGGAGCCCCGGCCACAATGACGCCCAAGCTGGGGCGAGGTGTCTTGGAAGGAGATGATGTTCTCTTTTATGATGAGTCACCACCACCAA
GACCAAAACTGAGTGCTTTAGCAGAAGCCAAAAAGTTAGCTGCTATCACCAAATTAAGGGCAAAAGGCCAGGTTCTTACAAAAACAAACC
CAAACAGCATTAAGAAGAAACAAAAGGACCCTCAGGACATCCTGGAGGTGAAGGAACGTGTAGAAAAAAACACCATGTTTTCTTCTCAAG
CTGAGGATGAATTGGAGCCTGCCAGGAAAAAAAGGAGAGAACAACTTGCCTATCTGGAATCTGAGGAATTTCAGAAAATCCTAAAAGCAA
AATCAAAACACACAGGCATCCTGAAAGAGGCCGAGGCTGAGATGCAGGAGCGCTACTTTGAGCCACTGGTGAAAAAAGAACAAATGGAAG
AAAAGATGAGAAACATCAGAGAAGTGAAGTGCCGTGTCGTGACATGCAAGACGTGCGCCTATACCCACTTCAAGCTGCTGGAGACCTGCG
TCAGTGAGCAGCATGAATACCACTGGCATGATGGTGTGAAGAGGTTTTTCAAATGTCCCTGTGGAAACAGAAGCATCTCCTTGGACAGAC
TCCCGAACAAGCACTGCAGTAACTGTGGCCTCTACAAATGGGAACGGGACGGAATGCTAAAGGTATGCCATTTGCGTACTAATTTTTGAC
TCCTTTTAGTGACCCATGCTAATAATGTGGAACCATCTCCTATTAAAATATTTTCATTTTTCTAGGAAAAGACTGGTCCAAAGATAGGAG
GAGAAACTCTGTTACCAAGAGGAGAAGAACATGCTAAATTTCTGAACAGCCTTAAATAACCCGAACTTCAGACATTTTCCCACAGACTTC
CTGGCCTCCTGTGACTCTGGAAAGCAAAGGATTGGCTGTGTATTGTCCATTGATTCCTGATTGACGCCGTCAAAAACAAATGCTTGTTAA
GCCCATAAGCTTTGCCTGCTTACTTTCTGCCATTGGGTTGGTTTGATACCACATTTAACATTGACATTTAAGTGGAAAACCAAGTTATCA
TTGTCTTTTCTAAGCTCAGTGTGGATGATTGCATTACTTCATTCACTGAAGTTTTTGCCCAAAAATTGGAAGGTAAACAGAGAGCTATGT
TTCTGTATCTTTTGGTTATAGAGTGTTCACTTCTTTATCATAACAAAATTCTAGTGTTTATACGAACACCCAGAGGCAAAAGAATTTGGC
TTAATTCTCACTCCAGGTAAGTAGCTTAACTTCTGGGCTTCAGTTTTCTCATCTGTAAAATCAGGAAGATTGGACTAAGTGATCCTGAAA
TGTATTTTTTAGCACTGGATTTCTACAAATAATAAAACTTTCCCATCTAGATAATGATGATCACATAGTCTTGATGTACGGACATTAAAA
GCCAGATTTCTTCATTCAATTCTGTTATCTCTGTTTTACTCTTTGAAATTGATCAAGCCACTGAATCACTTTGCATTTCAGTTTATATAT
ATAGAGAGAAAGAAGGTGTCTGCTCTTACATTATTGTGGAGCCCTGTGATAGAAATATGTAAAATCTCATATTATTTTTTTTTTAATTTT
TTTATTTTTTATGACAGGGTCTCACTATGTCACCCTGGCTGGAGTGCAGTAGTGCGATCGCGGCACACTGCAGCCTTGGCTTCCCTGGGC
TCAAGCAGTCCTCCCACCTCAGTCTCCCAAATAGCTAGGACTACAGGCGTGCGTGACCAAGCCCAGCTAATTTTTGCATTTTTTGTAGAG
ATGGGGTTTTGCCATGTTGCTCAGGCTGGTCTCAAACTCCTGAGCACTAGCAATCCACCCACCTCTGTTTCCAAAAAAAAAAAAAAAATG
AAAGGTCAACCCCTATGCAAATTACCACAGCAAAGGTTTCATTCAGGAGATTCTTCCATCTGGGCAACCTGGTTTTCCAAATATCATTTG
ACCTAAGTGAATGTTGATACTAGCTAAAGATTGGGTAAATTGGTTGAATTATTGTATTGAAGCTTGAGCTGTAGCTAAAAGTAATTTAGG
TTTCCCCTAAGATGTTATTATGTTAGGGACATAACACTTTTGGGAGGTTGTTGTGGGAGATGGTTGATTTAGGTTTTCAAAAGCTAGAAA
TAAAATTTACATGCCTTAGATTTCATAAAATTCTGCTCTAATTGGGTGGAAGGTGCTGTATCTAACTTGTGTTCCTCCTAAGGTTATGTC
CTAATAACTATTCTTTTAGGAGTATACTTCTACTTTATAGAAGGTTGCTTTTCTTTTTAATTTTTTCTAACAAAGAAAAGAATAAAGTAT
TTATTAATAAGAACCAGAAAGCACTTGAAACTGATGTTTTTAATGGCTCATTTAGGGTAGATTTATTTATCTCATTAACTTAAAACAGCT
ATGTGTATGAAATAGGTCACAACAGAACTTGAACACCAGGTTGGTGTCTGAGCAATCCCTTTCTTATGGGAAAAACAATGTTCTTGTTTG
AACAGAGGGTATCATTGCAGTCAGTATTCACGTGTATATTGTTATATAAGTTGTATAATATGCTTGTAAAGGCTGAGGGTGAGCTGTATC


Top

FusionGenePPI for FRMD4A_MCM10


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FRMD4AHNRNPA1, TRAF3IP1, YEATS4, WDR83MCM10KRT15, CEP70, HOOK2, ZBTB43, CCDC85B, CALCOCO2, CEP72, DPPA2, TRIM37, NINL, MCM6, CCND3, ZBTB8A, MCM7, ORC2, RPAP1, IKBKG, DDB1, RBX1, CUL4A, VPRBP, APP, ORC4, CDC45, MCM2, CDC7, MCM3, CDC5L, CDC6, CCND1, CDK6, ORC3, CDKN2A, CDKN1A, GOLGA2, TEX264, TMEM171, MCMBP, MCM4, SIRT1, NTRK1, HIST1H2BG, PCM1, TNIP1, POLR2G, SUPT5H, OFD1, CCDC14, USP37, YWHAE, IKZF5, CAV3, KLHL40, TPH1, RELL2, CACNG5


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FRMD4A_MCM10


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FRMD4A_MCM10


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFRMD4AC0236969Substance-Related Disorders1CTD_human