FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13827

FusionGeneSummary for FOXP1_ACTN4

check button Fusion gene summary
Fusion gene informationFusion gene name: FOXP1_ACTN4
Fusion gene ID: 13827
HgeneTgene
Gene symbol

FOXP1

ACTN4

Gene ID

27086

81

Gene nameforkhead box P1actinin alpha 4
Synonyms12CC4|HSPC215|MFH|QRF1|hFKH1BACTININ-4|FSGS|FSGS1
Cytomap

3p13

19q13.2

Type of geneprotein-codingprotein-coding
Descriptionforkhead box protein P1fork head-related protein like Bglutamine-rich factor 1mac-1-regulated forkheadalpha-actinin-4focal segmental glomerulosclerosis 1non-muscle alpha-actinin 4
Modification date2018052220180522
UniProtAcc

Q9H334

O43707

Ensembl transtripts involved in fusion geneENST00000318789, ENST00000475937, 
ENST00000493089, ENST00000484350, 
ENST00000318779, ENST00000491238, 
ENST00000498215, ENST00000468577, 
ENST00000472382, 
ENST00000252699, 
ENST00000424234, ENST00000390009, 
ENST00000497637, 
Fusion gene scores* DoF score21 X 13 X 11=300319 X 14 X 7=1862
# samples 2620
** MAII scorelog2(26/3003*10)=-3.52982094652869
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/1862*10)=-3.21878116778407
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FOXP1 [Title/Abstract] AND ACTN4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFOXP1

GO:0002903

negative regulation of B cell apoptotic process

25267198

HgeneFOXP1

GO:0030316

osteoclast differentiation

18799727

HgeneFOXP1

GO:0032496

response to lipopolysaccharide

18799727

HgeneFOXP1

GO:0032680

regulation of tumor necrosis factor production

18799727

HgeneFOXP1

GO:0035926

chemokine (C-C motif) ligand 2 secretion

18799727

HgeneFOXP1

GO:0036035

osteoclast development

18799727

HgeneFOXP1

GO:0042116

macrophage activation

18799727

HgeneFOXP1

GO:0042117

monocyte activation

18799727

HgeneFOXP1

GO:0045655

regulation of monocyte differentiation

15286807

HgeneFOXP1

GO:0045892

negative regulation of transcription, DNA-templated

20950788

HgeneFOXP1

GO:0050706

regulation of interleukin-1 beta secretion

18799727

HgeneFOXP1

GO:0050727

regulation of inflammatory response

18799727

HgeneFOXP1

GO:0060766

negative regulation of androgen receptor signaling pathway

18640093

HgeneFOXP1

GO:1900424

regulation of defense response to bacterium

18799727

HgeneFOXP1

GO:1901256

regulation of macrophage colony-stimulating factor production

18799727

HgeneFOXP1

GO:2001182

regulation of interleukin-12 secretion

18799727

TgeneACTN4

GO:0035357

peroxisome proliferator activated receptor signaling pathway

22351778

TgeneACTN4

GO:0048384

retinoic acid receptor signaling pathway

22351778

TgeneACTN4

GO:0051272

positive regulation of cellular component movement

9508771


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDDLBCTCGA-GS-A9TU-01AFOXP1chr3

71247353

-ACTN4chr19

39217597

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000318789ENST00000252699FOXP1chr3

71247353

-ACTN4chr19

39217597

+
Frame-shitENST00000318789ENST00000424234FOXP1chr3

71247353

-ACTN4chr19

39217597

+
Frame-shitENST00000318789ENST00000390009FOXP1chr3

71247353

-ACTN4chr19

39217597

+
5CDS-intronENST00000318789ENST00000497637FOXP1chr3

71247353

-ACTN4chr19

39217597

+
In-frameENST00000475937ENST00000252699FOXP1chr3

71247353

-ACTN4chr19

39217597

+
In-frameENST00000475937ENST00000424234FOXP1chr3

71247353

-ACTN4chr19

39217597

+
In-frameENST00000475937ENST00000390009FOXP1chr3

71247353

-ACTN4chr19

39217597

+
5CDS-intronENST00000475937ENST00000497637FOXP1chr3

71247353

-ACTN4chr19

39217597

+
Frame-shitENST00000493089ENST00000252699FOXP1chr3

71247353

-ACTN4chr19

39217597

+
Frame-shitENST00000493089ENST00000424234FOXP1chr3

71247353

-ACTN4chr19

39217597

+
Frame-shitENST00000493089ENST00000390009FOXP1chr3

71247353

-ACTN4chr19

39217597

+
5CDS-intronENST00000493089ENST00000497637FOXP1chr3

71247353

-ACTN4chr19

39217597

+
Frame-shitENST00000484350ENST00000252699FOXP1chr3

71247353

-ACTN4chr19

39217597

+
Frame-shitENST00000484350ENST00000424234FOXP1chr3

71247353

-ACTN4chr19

39217597

+
Frame-shitENST00000484350ENST00000390009FOXP1chr3

71247353

-ACTN4chr19

39217597

+
5CDS-intronENST00000484350ENST00000497637FOXP1chr3

71247353

-ACTN4chr19

39217597

+
Frame-shitENST00000318779ENST00000252699FOXP1chr3

71247353

-ACTN4chr19

39217597

+
Frame-shitENST00000318779ENST00000424234FOXP1chr3

71247353

-ACTN4chr19

39217597

+
Frame-shitENST00000318779ENST00000390009FOXP1chr3

71247353

-ACTN4chr19

39217597

+
5CDS-intronENST00000318779ENST00000497637FOXP1chr3

71247353

-ACTN4chr19

39217597

+
intron-3CDSENST00000491238ENST00000252699FOXP1chr3

71247353

-ACTN4chr19

39217597

+
intron-3CDSENST00000491238ENST00000424234FOXP1chr3

71247353

-ACTN4chr19

39217597

+
intron-3CDSENST00000491238ENST00000390009FOXP1chr3

71247353

-ACTN4chr19

39217597

+
intron-intronENST00000491238ENST00000497637FOXP1chr3

71247353

-ACTN4chr19

39217597

+
In-frameENST00000498215ENST00000252699FOXP1chr3

71247353

-ACTN4chr19

39217597

+
In-frameENST00000498215ENST00000424234FOXP1chr3

71247353

-ACTN4chr19

39217597

+
In-frameENST00000498215ENST00000390009FOXP1chr3

71247353

-ACTN4chr19

39217597

+
5CDS-intronENST00000498215ENST00000497637FOXP1chr3

71247353

-ACTN4chr19

39217597

+
In-frameENST00000468577ENST00000252699FOXP1chr3

71247353

-ACTN4chr19

39217597

+
In-frameENST00000468577ENST00000424234FOXP1chr3

71247353

-ACTN4chr19

39217597

+
In-frameENST00000468577ENST00000390009FOXP1chr3

71247353

-ACTN4chr19

39217597

+
5CDS-intronENST00000468577ENST00000497637FOXP1chr3

71247353

-ACTN4chr19

39217597

+
intron-3CDSENST00000472382ENST00000252699FOXP1chr3

71247353

-ACTN4chr19

39217597

+
intron-3CDSENST00000472382ENST00000424234FOXP1chr3

71247353

-ACTN4chr19

39217597

+
intron-3CDSENST00000472382ENST00000390009FOXP1chr3

71247353

-ACTN4chr19

39217597

+
intron-intronENST00000472382ENST00000497637FOXP1chr3

71247353

-ACTN4chr19

39217597

+

Top

FusionProtFeatures for FOXP1_ACTN4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FOXP1

Q9H334

ACTN4

O43707

F-actin cross-linking protein which is thought to anchoractin to a variety of intracellular structures. This is a bundlingprotein (Probable). Probably involved in vesicular trafficking viaits association with the CART complex. The CART complex isnecessary for efficient transferrin receptor recycling but not forEGFR degradation (PubMed:15772161). Involved in tight junctionassembly in epithelial cells probably through interaction withMICALL2. Links MICALL2 to the actin cytoskeleton and recruits itto the tight junctions (By similarity). May also function as atranscriptional coactivator, stimulating transcription mediated bythe nuclear hormone receptors PPARG and RARA (PubMed:22351778).{ECO:0000250|UniProtKB:P57780, ECO:0000269|PubMed:15772161,ECO:0000269|PubMed:22351778, ECO:0000305|PubMed:9508771}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for FOXP1_ACTN4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ACTN4_ENST00000252699_chr19_39217597_+_242aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQHIRVGWEQLLTTIARTINEVENQILTRDAK
GISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIA

>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ACTN4_ENST00000424234_chr19_39217597_+_242aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQHIRVGWEQLLTTIARTINEVENQILTRDAK
GISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIA

>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ACTN4_ENST00000390009_chr19_39217597_+_242aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQHIRVGWEQLLTTIARTINEVENQILTRDAK
GISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIA

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ACTN4_ENST00000252699_chr19_39217597_+_242aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQHIRVGWEQLLTTIARTINEVENQILTRDAK
GISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIA

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ACTN4_ENST00000424234_chr19_39217597_+_242aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQHIRVGWEQLLTTIARTINEVENQILTRDAK
GISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIA

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ACTN4_ENST00000390009_chr19_39217597_+_242aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQHIRVGWEQLLTTIARTINEVENQILTRDAK
GISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIA

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ACTN4_ENST00000252699_chr19_39217597_+_242aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQHIRVGWEQLLTTIARTINEVENQILTRDAK
GISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIA

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ACTN4_ENST00000424234_chr19_39217597_+_242aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQHIRVGWEQLLTTIARTINEVENQILTRDAK
GISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIA

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ACTN4_ENST00000390009_chr19_39217597_+_242aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQHIRVGWEQLLTTIARTINEVENQILTRDAK
GISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ACTN4_ENST00000252699_chr19_39217597_+_726nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
CACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAG
GGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTC
AAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCC
AACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCT
TCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATC
GCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGAC

>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ACTN4_ENST00000424234_chr19_39217597_+_726nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
CACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAG
GGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTC
AAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCC
AACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCT
TCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATC
GCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGAC

>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ACTN4_ENST00000390009_chr19_39217597_+_726nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
CACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAG
GGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTC
AAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCC
AACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCT
TCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATC
GCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGAC

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ACTN4_ENST00000252699_chr19_39217597_+_726nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
CACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAG
GGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTC
AAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCC
AACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCT
TCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATC
GCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGAC

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ACTN4_ENST00000424234_chr19_39217597_+_726nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
CACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAG
GGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTC
AAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCC
AACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCT
TCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATC
GCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGAC

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ACTN4_ENST00000390009_chr19_39217597_+_726nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
CACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAG
GGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTC
AAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCC
AACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCT
TCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATC
GCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGAC

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ACTN4_ENST00000252699_chr19_39217597_+_726nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
CACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAG
GGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTC
AAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCC
AACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCT
TCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATC
GCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGAC

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ACTN4_ENST00000424234_chr19_39217597_+_726nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
CACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAG
GGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTC
AAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCC
AACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCT
TCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATC
GCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGAC

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ACTN4_ENST00000390009_chr19_39217597_+_726nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
CACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAG
GGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTC
AAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCC
AACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCT
TCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATC
GCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ACTN4_ENST00000252699_chr19_39217597_+_3308nt
ATCACAGCTTGGTGCTGGGGCTCAGCATGGCCAGGTGGCTAACCAGGGCTTGGTGTCAACTACATTTGGGATGATGACACTTGGAGGACA
CAGAGCCACTGTGCAGCAGGAGTCGCCACTGCTAACAGCCAGAGTGTCCCAGAAGCTTTTGTTGACAATTCCAGTTTCCGAACAAAACAT
TTCGGCAATGGTGAGGGCTTCGATCCCTTCTCTGATTTGCTGTCAGCCATGAACGGATGGATGTGATGCCTGCTAGCCAAAAGGCTTCCC
TCTGTGTGTTGCAGTCCTGTGGCATTATGCATGCCCCCTCCCAGTGACCCCAGGCTTTTTATGGCTGTGAGACACGTTAAAATTTCAGGG
GTAAGACGTGACCTTTTGAGGTGACTATAACTGAAGATTGCTTTACAGAAGCCAAAAAAGGTTTTTGAGTCATGATGCAAGAATCTGGGA
CTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGGGCGGT
CCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGCACATCCGCGTGGGCTGGG
AGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGA
TGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCC
TGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGA
CCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAG
GGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACC
AGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGACCTGTGAGGCCCCAGAGACC
TGACCCAACACCCCCGACGGCCTCCAGGAGGGGCCTGGGCAGCCCCACAGTCCCATTCCTCCACTCTGTATCTATGCAAAGCACTCTCTG
CAGTCCTCCGGGGTGGGTGGGTGGGCAGGGAGGGGCTGGGGCAGGCTCTCTCCTCTCTCTCTTTGTGGGTTGGCCAGGAGGTTCCCCCGA
CCAGGTTGGGGAGACTTGGGGCCAGCGCTTCTGGTCTGGTAAATATGTATGATGTGTTGTGCTTTTTTAACCAAGGAGGGGCCAGTGGAT
TCCCACAGCACAACCGGTCCCTTCCATGCCCTGGGATGCCTCACCACACCCAGGTCTCTTCCTTTGCTCTGAGGTCCCTTCAAGGCCTCC
CCAATCCAGGCCAAAGCCCCATGTGCCTTGTCCAGGAACTGCCTGGGCCATGCGAGGGGCCAGCAGAGGGCGCCACCACCACCTGACGGC
TGGGGACCCACCCAGCCCCTCTCCCCTCTCTGCTCCAGACTCACTTGCCATTGCCAGGAGATGGCCCCAACAAGCACCCCGCTTTTGCAG
CAGAGGAGCTGAGTTGGCAGACCGGGCCCCCCTGAACCGCACCCCATCCCACCAGCCCCGGCCTTGCTTTGTCTGGCCTCACGTGTCTCA
GATTTTCTAAGAACCAAAAAAAAAAAAGGAAAAAAAACACAAAACAACAAAAACCAAAAAAAAAAAAAATCACAAAAACAAAAAAACTAT
AAAAAAGAAAGAATTAAAAACTTTCAGAGAATTACTATTTACTTTATTAACTTACGGATTTATTATATAAATATATATTCACCTAGCAAC
ATATCTCTGCCGTCTCTCCTGCTCTCATAATGAAGACATAGCCGATTCTCTGCCCGGGCCCCTTGCTGATGCTCCTCCGGGTCTGCGTCG
GGCGTGGGTCTCTGGGGACCCTCCAGAGGTGGAGGTGGGCTGATGGCCTGGCTGCCTGGTGGTTGATGGTTTTGCTCCCCCTACCTTTTT
TTTTTGAGTTTATTCTGATTGATTTTTTTTCTTGGTTTCTGGATAAACCACCCTCTGGGGACAGGATAATAAAACATGTAATATTTTTAA
GAAGGATTCCTGCAGCATCATCTTTTTTTATTTCTCCTGTGTCTGTCCTCCACCTTCTAGGAGAGCCAGGGCAGAGCTAGCACTGTCTTA
AGCTGTCAACGTGGACTAGCTCGTGTCATCTGCTCGAGAAGGGCTGTCGCTGTTCTTGTTTCTGAGTGAGGAGTACGCAGGCCAGAGTGG
TCACCCGGCCGTGAGCAGTGAGGGCCAGAGACTAGCCCCAGACAGGTGGATGCCAGAGAGAGTGGCACCCATGCCAGGCAAGGCCTAGGG
AGGTGGTCTTGCTCAGCAACCCTGCCCTGAGCAGCAGGTGCGCCCATCCGGAGATCCTAGGAGAAGGTGGCCACCTCCATCCACTAAGGA
AGAGAAGGAAGACAGTGGCTTGAGGCAGGGAGCTCGCAGGACAGAGCCTGAGCCACCCTGTCCCTCCCACCTGGCTCACCTGTCTGTGGG
TCAGGCAGATGACCCCCTCACCCCCATCCAGGTGCTGGCTGCAGTGGCCTGTGCAGAGAGGGGCAGGGTGAGTGCCCACCAGTCCCCGTA
CCCCTTCCCCCCATGCCCCACCATGCCGGGGTGGTACTCACAGAAGATGCAGGTGAGGTGGGCCACACAGGACACGAACCGCTCGAAGTC
CACACGCAGACGGCTATCCCGGTAGCGGCTGGTGAGGGTCTGGGTCAGCTGGTTGTTCAGGTGGAAGCCTAGGGGGAGGCTGCTTCTGAG
CCCAGTGGCCCACAGGGAACCCACCTTGGCATTGCATCCCCACCCCACCTCCTCAGGGAGGACATGAATGCCACAGGGTGTCACACCCCA
ACTCTGCCCCATCCCGGCAGGGTGAGTACAGGCTGATCCCTTCAATCCTCTGGGCCTGTTTCCTCATCCATCAAACGGACTAAGACAGCC
CCGACCCCATAGGGTGTGTGAAGACAGAACGCTCAGGACAGCGTCTGACACGTGACTCGATGTGTGGGTACTGTTACTCCTTAAATCCTG

>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ACTN4_ENST00000424234_chr19_39217597_+_1157nt
ATCACAGCTTGGTGCTGGGGCTCAGCATGGCCAGGTGGCTAACCAGGGCTTGGTGTCAACTACATTTGGGATGATGACACTTGGAGGACA
CAGAGCCACTGTGCAGCAGGAGTCGCCACTGCTAACAGCCAGAGTGTCCCAGAAGCTTTTGTTGACAATTCCAGTTTCCGAACAAAACAT
TTCGGCAATGGTGAGGGCTTCGATCCCTTCTCTGATTTGCTGTCAGCCATGAACGGATGGATGTGATGCCTGCTAGCCAAAAGGCTTCCC
TCTGTGTGTTGCAGTCCTGTGGCATTATGCATGCCCCCTCCCAGTGACCCCAGGCTTTTTATGGCTGTGAGACACGTTAAAATTTCAGGG
GTAAGACGTGACCTTTTGAGGTGACTATAACTGAAGATTGCTTTACAGAAGCCAAAAAAGGTTTTTGAGTCATGATGCAAGAATCTGGGA
CTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGGGCGGT
CCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGCACATCCGCGTGGGCTGGG
AGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGA
TGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCC
TGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGA
CCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAG
GGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACC

>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ACTN4_ENST00000390009_chr19_39217597_+_1172nt
ATCACAGCTTGGTGCTGGGGCTCAGCATGGCCAGGTGGCTAACCAGGGCTTGGTGTCAACTACATTTGGGATGATGACACTTGGAGGACA
CAGAGCCACTGTGCAGCAGGAGTCGCCACTGCTAACAGCCAGAGTGTCCCAGAAGCTTTTGTTGACAATTCCAGTTTCCGAACAAAACAT
TTCGGCAATGGTGAGGGCTTCGATCCCTTCTCTGATTTGCTGTCAGCCATGAACGGATGGATGTGATGCCTGCTAGCCAAAAGGCTTCCC
TCTGTGTGTTGCAGTCCTGTGGCATTATGCATGCCCCCTCCCAGTGACCCCAGGCTTTTTATGGCTGTGAGACACGTTAAAATTTCAGGG
GTAAGACGTGACCTTTTGAGGTGACTATAACTGAAGATTGCTTTACAGAAGCCAAAAAAGGTTTTTGAGTCATGATGCAAGAATCTGGGA
CTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGGGCGGT
CCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGCACATCCGCGTGGGCTGGG
AGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGA
TGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCC
TGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGA
CCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAG
GGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACC
AGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGACCTGTGAGGCCCCAGAGACC

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ACTN4_ENST00000252699_chr19_39217597_+_3200nt
AGACAATAAGAAACAAACGGTACAACTCCACAAAAGGCTTCCCGGAAAATAAGTGTCAAATAAATCCTACGGAACTCTCGCTTCTGCCAC
TGAGCTCTGTATATGCAAACCTGTTTTTATGCCATCGCTTCCCCAGGCTGAGCTGCGTTTGTTTGGAAATGTAAGCCACTGCCTTTTCTT
TTTTTCTTTTTTCCTTTTTTTTTTTTCCCCCCTCACTTCATCTGAGGGCTCTGGATTAATTCCTTGAGACATATCTTTGCATACATATCT
CATGAGTTATGTTTCCTGGAGCCTTTTACTAGGAACATTAAGGTTTTTGAGTCATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACG
GTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGG
CCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGCACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCA
TTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGT
CCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGA
ACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCG
ACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCA
CAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGC
CCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGACCTGTGAGGCCCCAGAGACCTGACCCAACACCCCCGAC
GGCCTCCAGGAGGGGCCTGGGCAGCCCCACAGTCCCATTCCTCCACTCTGTATCTATGCAAAGCACTCTCTGCAGTCCTCCGGGGTGGGT
GGGTGGGCAGGGAGGGGCTGGGGCAGGCTCTCTCCTCTCTCTCTTTGTGGGTTGGCCAGGAGGTTCCCCCGACCAGGTTGGGGAGACTTG
GGGCCAGCGCTTCTGGTCTGGTAAATATGTATGATGTGTTGTGCTTTTTTAACCAAGGAGGGGCCAGTGGATTCCCACAGCACAACCGGT
CCCTTCCATGCCCTGGGATGCCTCACCACACCCAGGTCTCTTCCTTTGCTCTGAGGTCCCTTCAAGGCCTCCCCAATCCAGGCCAAAGCC
CCATGTGCCTTGTCCAGGAACTGCCTGGGCCATGCGAGGGGCCAGCAGAGGGCGCCACCACCACCTGACGGCTGGGGACCCACCCAGCCC
CTCTCCCCTCTCTGCTCCAGACTCACTTGCCATTGCCAGGAGATGGCCCCAACAAGCACCCCGCTTTTGCAGCAGAGGAGCTGAGTTGGC
AGACCGGGCCCCCCTGAACCGCACCCCATCCCACCAGCCCCGGCCTTGCTTTGTCTGGCCTCACGTGTCTCAGATTTTCTAAGAACCAAA
AAAAAAAAAGGAAAAAAAACACAAAACAACAAAAACCAAAAAAAAAAAAAATCACAAAAACAAAAAAACTATAAAAAAGAAAGAATTAAA
AACTTTCAGAGAATTACTATTTACTTTATTAACTTACGGATTTATTATATAAATATATATTCACCTAGCAACATATCTCTGCCGTCTCTC
CTGCTCTCATAATGAAGACATAGCCGATTCTCTGCCCGGGCCCCTTGCTGATGCTCCTCCGGGTCTGCGTCGGGCGTGGGTCTCTGGGGA
CCCTCCAGAGGTGGAGGTGGGCTGATGGCCTGGCTGCCTGGTGGTTGATGGTTTTGCTCCCCCTACCTTTTTTTTTTGAGTTTATTCTGA
TTGATTTTTTTTCTTGGTTTCTGGATAAACCACCCTCTGGGGACAGGATAATAAAACATGTAATATTTTTAAGAAGGATTCCTGCAGCAT
CATCTTTTTTTATTTCTCCTGTGTCTGTCCTCCACCTTCTAGGAGAGCCAGGGCAGAGCTAGCACTGTCTTAAGCTGTCAACGTGGACTA
GCTCGTGTCATCTGCTCGAGAAGGGCTGTCGCTGTTCTTGTTTCTGAGTGAGGAGTACGCAGGCCAGAGTGGTCACCCGGCCGTGAGCAG
TGAGGGCCAGAGACTAGCCCCAGACAGGTGGATGCCAGAGAGAGTGGCACCCATGCCAGGCAAGGCCTAGGGAGGTGGTCTTGCTCAGCA
ACCCTGCCCTGAGCAGCAGGTGCGCCCATCCGGAGATCCTAGGAGAAGGTGGCCACCTCCATCCACTAAGGAAGAGAAGGAAGACAGTGG
CTTGAGGCAGGGAGCTCGCAGGACAGAGCCTGAGCCACCCTGTCCCTCCCACCTGGCTCACCTGTCTGTGGGTCAGGCAGATGACCCCCT
CACCCCCATCCAGGTGCTGGCTGCAGTGGCCTGTGCAGAGAGGGGCAGGGTGAGTGCCCACCAGTCCCCGTACCCCTTCCCCCCATGCCC
CACCATGCCGGGGTGGTACTCACAGAAGATGCAGGTGAGGTGGGCCACACAGGACACGAACCGCTCGAAGTCCACACGCAGACGGCTATC
CCGGTAGCGGCTGGTGAGGGTCTGGGTCAGCTGGTTGTTCAGGTGGAAGCCTAGGGGGAGGCTGCTTCTGAGCCCAGTGGCCCACAGGGA
ACCCACCTTGGCATTGCATCCCCACCCCACCTCCTCAGGGAGGACATGAATGCCACAGGGTGTCACACCCCAACTCTGCCCCATCCCGGC
AGGGTGAGTACAGGCTGATCCCTTCAATCCTCTGGGCCTGTTTCCTCATCCATCAAACGGACTAAGACAGCCCCGACCCCATAGGGTGTG
TGAAGACAGAACGCTCAGGACAGCGTCTGACACGTGACTCGATGTGTGGGTACTGTTACTCCTTAAATCCTGTGGGGCTTTCTCCTTGCC

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ACTN4_ENST00000424234_chr19_39217597_+_1049nt
AGACAATAAGAAACAAACGGTACAACTCCACAAAAGGCTTCCCGGAAAATAAGTGTCAAATAAATCCTACGGAACTCTCGCTTCTGCCAC
TGAGCTCTGTATATGCAAACCTGTTTTTATGCCATCGCTTCCCCAGGCTGAGCTGCGTTTGTTTGGAAATGTAAGCCACTGCCTTTTCTT
TTTTTCTTTTTTCCTTTTTTTTTTTTCCCCCCTCACTTCATCTGAGGGCTCTGGATTAATTCCTTGAGACATATCTTTGCATACATATCT
CATGAGTTATGTTTCCTGGAGCCTTTTACTAGGAACATTAAGGTTTTTGAGTCATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACG
GTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGG
CCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGCACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCA
TTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGT
CCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGA
ACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCG
ACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCA
CAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGC

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ACTN4_ENST00000390009_chr19_39217597_+_1064nt
AGACAATAAGAAACAAACGGTACAACTCCACAAAAGGCTTCCCGGAAAATAAGTGTCAAATAAATCCTACGGAACTCTCGCTTCTGCCAC
TGAGCTCTGTATATGCAAACCTGTTTTTATGCCATCGCTTCCCCAGGCTGAGCTGCGTTTGTTTGGAAATGTAAGCCACTGCCTTTTCTT
TTTTTCTTTTTTCCTTTTTTTTTTTTCCCCCCTCACTTCATCTGAGGGCTCTGGATTAATTCCTTGAGACATATCTTTGCATACATATCT
CATGAGTTATGTTTCCTGGAGCCTTTTACTAGGAACATTAAGGTTTTTGAGTCATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACG
GTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGG
CCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGCACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCA
TTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGT
CCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGA
ACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCG
ACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCA
CAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGC

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ACTN4_ENST00000252699_chr19_39217597_+_2877nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
CACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAG
GGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTC
AAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCC
AACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCT
TCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATC
GCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGAC
CTGTGAGGCCCCAGAGACCTGACCCAACACCCCCGACGGCCTCCAGGAGGGGCCTGGGCAGCCCCACAGTCCCATTCCTCCACTCTGTAT
CTATGCAAAGCACTCTCTGCAGTCCTCCGGGGTGGGTGGGTGGGCAGGGAGGGGCTGGGGCAGGCTCTCTCCTCTCTCTCTTTGTGGGTT
GGCCAGGAGGTTCCCCCGACCAGGTTGGGGAGACTTGGGGCCAGCGCTTCTGGTCTGGTAAATATGTATGATGTGTTGTGCTTTTTTAAC
CAAGGAGGGGCCAGTGGATTCCCACAGCACAACCGGTCCCTTCCATGCCCTGGGATGCCTCACCACACCCAGGTCTCTTCCTTTGCTCTG
AGGTCCCTTCAAGGCCTCCCCAATCCAGGCCAAAGCCCCATGTGCCTTGTCCAGGAACTGCCTGGGCCATGCGAGGGGCCAGCAGAGGGC
GCCACCACCACCTGACGGCTGGGGACCCACCCAGCCCCTCTCCCCTCTCTGCTCCAGACTCACTTGCCATTGCCAGGAGATGGCCCCAAC
AAGCACCCCGCTTTTGCAGCAGAGGAGCTGAGTTGGCAGACCGGGCCCCCCTGAACCGCACCCCATCCCACCAGCCCCGGCCTTGCTTTG
TCTGGCCTCACGTGTCTCAGATTTTCTAAGAACCAAAAAAAAAAAAGGAAAAAAAACACAAAACAACAAAAACCAAAAAAAAAAAAAATC
ACAAAAACAAAAAAACTATAAAAAAGAAAGAATTAAAAACTTTCAGAGAATTACTATTTACTTTATTAACTTACGGATTTATTATATAAA
TATATATTCACCTAGCAACATATCTCTGCCGTCTCTCCTGCTCTCATAATGAAGACATAGCCGATTCTCTGCCCGGGCCCCTTGCTGATG
CTCCTCCGGGTCTGCGTCGGGCGTGGGTCTCTGGGGACCCTCCAGAGGTGGAGGTGGGCTGATGGCCTGGCTGCCTGGTGGTTGATGGTT
TTGCTCCCCCTACCTTTTTTTTTTGAGTTTATTCTGATTGATTTTTTTTCTTGGTTTCTGGATAAACCACCCTCTGGGGACAGGATAATA
AAACATGTAATATTTTTAAGAAGGATTCCTGCAGCATCATCTTTTTTTATTTCTCCTGTGTCTGTCCTCCACCTTCTAGGAGAGCCAGGG
CAGAGCTAGCACTGTCTTAAGCTGTCAACGTGGACTAGCTCGTGTCATCTGCTCGAGAAGGGCTGTCGCTGTTCTTGTTTCTGAGTGAGG
AGTACGCAGGCCAGAGTGGTCACCCGGCCGTGAGCAGTGAGGGCCAGAGACTAGCCCCAGACAGGTGGATGCCAGAGAGAGTGGCACCCA
TGCCAGGCAAGGCCTAGGGAGGTGGTCTTGCTCAGCAACCCTGCCCTGAGCAGCAGGTGCGCCCATCCGGAGATCCTAGGAGAAGGTGGC
CACCTCCATCCACTAAGGAAGAGAAGGAAGACAGTGGCTTGAGGCAGGGAGCTCGCAGGACAGAGCCTGAGCCACCCTGTCCCTCCCACC
TGGCTCACCTGTCTGTGGGTCAGGCAGATGACCCCCTCACCCCCATCCAGGTGCTGGCTGCAGTGGCCTGTGCAGAGAGGGGCAGGGTGA
GTGCCCACCAGTCCCCGTACCCCTTCCCCCCATGCCCCACCATGCCGGGGTGGTACTCACAGAAGATGCAGGTGAGGTGGGCCACACAGG
ACACGAACCGCTCGAAGTCCACACGCAGACGGCTATCCCGGTAGCGGCTGGTGAGGGTCTGGGTCAGCTGGTTGTTCAGGTGGAAGCCTA
GGGGGAGGCTGCTTCTGAGCCCAGTGGCCCACAGGGAACCCACCTTGGCATTGCATCCCCACCCCACCTCCTCAGGGAGGACATGAATGC
CACAGGGTGTCACACCCCAACTCTGCCCCATCCCGGCAGGGTGAGTACAGGCTGATCCCTTCAATCCTCTGGGCCTGTTTCCTCATCCAT
CAAACGGACTAAGACAGCCCCGACCCCATAGGGTGTGTGAAGACAGAACGCTCAGGACAGCGTCTGACACGTGACTCGATGTGTGGGTAC

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ACTN4_ENST00000424234_chr19_39217597_+_726nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
CACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAG
GGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTC
AAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCC
AACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCT
TCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATC
GCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGAC

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ACTN4_ENST00000390009_chr19_39217597_+_741nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
CACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAG
GGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTC
AAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCC
AACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCT
TCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATC
GCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGAC


Top

FusionGenePPI for FOXP1_ACTN4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FOXP1CTBP1, FOXP1, FOXP2, FOXP4, GATAD2B, MTA1, NCOR2, ELAVL1, MYC, IL3RA, CCDC183, UNK, RCC1, HOXD13, QSER1, SATB1, SATB2, CTBP2, MYH10, LIG3, C10orf2, CUX1, VRK3, XRCC1, CHD1L, RPA2, BLM, MRE11A, MYL12B, TBP, TP53, TTF2, ZBTB10, MYL9, RPA3, TFCP2, TOP2A, UBP1, FOXP3, AURKA, SNRNP70ACTN4MYOZ2, MYOZ1, PDLIM1, USP6NL, SLC9A3R2, COL17A1, TRIM3, MAGI1, GSN, CAMK2A, CAMK2B, INO80, UBTF, STAT1, HDAC7, MEF2A, UCHL5, TJP1, ATXN7, HDAC5, VDR, ESR1, PSMA3, ELAVL1, SIRT7, SLC2A4, ISG15, COIL, SACS, HGS, UBASH3B, SHC1, NOS3, ACTN2, ACTN1, FMNL1, TRAF3IP1, FN1, VCAM1, CDH1, ITGA4, SVIL, CD81, IGSF8, ICAM1, TXN, RPS27, POT1, KPNA2, MAPK7, CDKN2A, VCP, SF3A3, GNB2, HUWE1, ACTN3, BMP7, ALK, CUL7, OBSL1, CCDC8, EGFR, LUZP4, RARA, HSPB1, AHNAK, ALDOA, ALDOC, IDH3A, MYH15, MYH2, MYH7B, NCAPG2, PSMA6, PSMB5, PUS7, TPM2, TSG101, CKB, CYC1, ECSIT, MCFD2, PSMB8, TPM1, TPM3, TPM4, NTRK1, CAPZA2, DBN1, FLNA, MYH9, MYO1C, PPP1CB, IQGAP1, PDLIM7, SYNPO, MAPRE1, SIN3B, MYEF2, LIMA1, ANLN, MYO5C, MYO19, MYO18A, CTNNB1, MCM2, NFYA, CDC73, DDIAS, SSH1, NCL, DLD, DNM1L, PDHA1, SOD1, TRIM25, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FOXP1_ACTN4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FOXP1_ACTN4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFOXP1C0024232Lymphatic Metastasis1CTD_human
HgeneFOXP1C0027626Neoplasm Invasiveness1CTD_human
HgeneFOXP1C0030297Pancreatic Neoplasm1CTD_human
HgeneFOXP1C0042900Vitiligo1CTD_human
HgeneFOXP1C0279628Adenocarcinoma Of Esophagus1CTD_human
HgeneFOXP1C1510586Autism Spectrum Disorders1CTD_human
HgeneFOXP1C3495559Juvenile arthritis1CTD_human
HgeneFOXP1C4013764MENTAL RETARDATION WITH LANGUAGE IMPAIRMENT AND WITH OR WITHOUT AUTISTIC FEATURES1CTD_human;ORPHANET;UNIPROT
TgeneACTN4C0333497Segmental glomerulosclerosis3UNIPROT
TgeneACTN4C0024667Animal Mammary Neoplasms1CTD_human
TgeneACTN4C0024668Mammary Neoplasms, Experimental1CTD_human