|
||||||
|
 | |
| |
| |
| |
| |
|
Fusion gene ID: 13707 |
FusionGeneSummary for FNIP2_FAM159A |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: FNIP2_FAM159A | Fusion gene ID: 13707 | Hgene | Tgene | Gene symbol | FNIP2 | FAM159A | Gene ID | 57600 |
| Gene name | folliculin interacting protein 2 | ||
| Synonyms | FNIPL|MAPO1 | ||
| Cytomap | 4q32.1 | ||
| Type of gene | protein-coding | ||
| Description | folliculin-interacting protein 2FNIP1-like proteinO6-methylguanine-induced apoptosis 1 protein | ||
| Modification date | 20180519 | ||
| UniProtAcc | Q9P278 | ||
| Ensembl transtripts involved in fusion gene | ENST00000264433, ENST00000379346, ENST00000505445, | ENST00000517870, ENST00000401050, | |
| Fusion gene scores | * DoF score | 9 X 5 X 6=270 | 2 X 1 X 2=4 |
| # samples | 9 | 2 | |
| ** MAII score | log2(9/270*10)=-1.58496250072116 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(2/4*10)=2.32192809488736 | |
| Context | PubMed: FNIP2 [Title/Abstract] AND FAM159A [Title/Abstract] AND fusion [Title/Abstract] | ||
| Functional or gene categories assigned by FusionGDB annotation | |||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | FNIP2 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 21209915 |
| Hgene | FNIP2 | GO:0001932 | regulation of protein phosphorylation | 18663353 |
| Hgene | FNIP2 | GO:0006468 | protein phosphorylation | 18663353 |
| Hgene | FNIP2 | GO:0031334 | positive regulation of protein complex assembly | 25126726 |
| Hgene | FNIP2 | GO:0033138 | positive regulation of peptidyl-serine phosphorylation | 19914239 |
| Fusion gene information from three resources (ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018)) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Data type | Source | Cancer type | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| TCGA | RV | LGG | TCGA-HT-7475-01A | FNIP2 | chr4 | 159690471 | + | FAM159A | chr1 | 53108535 | + |
| * LD: Li Ding group's fusion gene list RV: Roel Verhaak group's fusion gene list ChiTaRs fusion database |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| In-frame | ENST00000264433 | ENST00000517870 | FNIP2 | chr4 | 159690471 | + | FAM159A | chr1 | 53108535 | + |
| 5CDS-3UTR | ENST00000264433 | ENST00000401050 | FNIP2 | chr4 | 159690471 | + | FAM159A | chr1 | 53108535 | + |
| intron-3CDS | ENST00000379346 | ENST00000517870 | FNIP2 | chr4 | 159690471 | + | FAM159A | chr1 | 53108535 | + |
| intron-3UTR | ENST00000379346 | ENST00000401050 | FNIP2 | chr4 | 159690471 | + | FAM159A | chr1 | 53108535 | + |
| intron-3CDS | ENST00000505445 | ENST00000517870 | FNIP2 | chr4 | 159690471 | + | FAM159A | chr1 | 53108535 | + |
| intron-3UTR | ENST00000505445 | ENST00000401050 | FNIP2 | chr4 | 159690471 | + | FAM159A | chr1 | 53108535 | + |
Top |
FusionProtFeatures for FNIP2_FAM159A |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| FNIP2 | FAM159A |
| Acts as a co-chaperone of HSP90AA1. Inhibits the ATPaseactivity of HSP90AA1 leading to reduction in its chaperoneactivity. Facilitates the binding of client protein FLCN toHSP90AA1 (PubMed:27353360). May play a role in the signaltransduction pathway of apoptosis induced by O6-methylguanine-mispaired lesions (By similarity). May be involved in energyand/or nutrient sensing through the AMPK and mTOR signalingpathways (PubMed:18403135). May regulate phosphorylation ofRPS6KB1 (PubMed:18663353). {ECO:0000250|UniProtKB:Q80TD3,ECO:0000269|PubMed:18403135, ECO:0000269|PubMed:18663353,ECO:0000269|PubMed:27353360}. | Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at . * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | >FAM159A | chr4:159690471 | chr1:53108535 | ENST00000517870 | + | 0 | 3 | 70_90 | 60 | 191 | Transmembrane | Helical |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | >FNIP2 | chr4:159690471 | chr1:53108535 | ENST00000264433 | + | 1 | 17 | 242_265 | 35 | 1115 | Compositional bias | Note=Ser-rich |
| Hgene | >FNIP2 | chr4:159690471 | chr1:53108535 | ENST00000264433 | + | 1 | 17 | 95_116 | 35 | 1115 | Compositional bias | Note=Ser-rich |
| Hgene | >FNIP2 | chr4:159690471 | chr1:53108535 | ENST00000379346 | + | 1 | 17 | 242_265 | 0 | 1138 | Compositional bias | Note=Ser-rich |
| Hgene | >FNIP2 | chr4:159690471 | chr1:53108535 | ENST00000379346 | + | 1 | 17 | 95_116 | 0 | 1138 | Compositional bias | Note=Ser-rich |
| Hgene | >FNIP2 | chr4:159690471 | chr1:53108535 | ENST00000264433 | + | 1 | 17 | 1050_1105 | 35 | 1115 | Domain | dDENN FNIP1/2-type |
| Hgene | >FNIP2 | chr4:159690471 | chr1:53108535 | ENST00000264433 | + | 1 | 17 | 42_460 | 35 | 1115 | Domain | uDENN FNIP1/2-type |
| Hgene | >FNIP2 | chr4:159690471 | chr1:53108535 | ENST00000264433 | + | 1 | 17 | 468_1040 | 35 | 1115 | Domain | cDENN FNIP1/2-type |
| Hgene | >FNIP2 | chr4:159690471 | chr1:53108535 | ENST00000379346 | + | 1 | 17 | 1050_1105 | 0 | 1138 | Domain | dDENN FNIP1/2-type |
| Hgene | >FNIP2 | chr4:159690471 | chr1:53108535 | ENST00000379346 | + | 1 | 17 | 42_460 | 0 | 1138 | Domain | uDENN FNIP1/2-type |
| Hgene | >FNIP2 | chr4:159690471 | chr1:53108535 | ENST00000379346 | + | 1 | 17 | 468_1040 | 0 | 1138 | Domain | cDENN FNIP1/2-type |
| Tgene | FAM159A | chr4:159690471 | chr1:53108535 | ENST00000517870 | + | 0 | 3 | 48_68 | 60 | 191 | Transmembrane | Helical |
Top |
FusionGeneSequence for FNIP2_FAM159A |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. (nt: nucleotides, aa: amino acids) |
| * Fusion amino acid sequences. |
| >In-frame_FNIP2_ENST00000264433_chr4_159690471_+_FAM159A_ENST00000517870_chr1_53108535_+_166aa MAPTLLQKLFNKRGSSGSSAAASAQGRAPKEGPAFSIGALIGLSVAAVVLLAFIVTACVLCYLFISSKPHTKLDLGLSLQTAGPEEVSPD |
| * Fusion transcript sequences (only coding sequence (CDS) region). |
| >In-frame_FNIP2_ENST00000264433_chr4_159690471_+_FAM159A_ENST00000517870_chr1_53108535_+_498nt ATGGCCCCGACCCTGCTCCAGAAGCTCTTCAACAAAAGGGGCAGCAGCGGCAGCTCCGCGGCGGCGTCTGCCCAGGGCAGGGCTCCTAAG GAAGGACCCGCCTTTAGCATTGGCGCTCTCATAGGCCTGTCCGTAGCAGCAGTGGTTCTTCTCGCCTTCATTGTTACCGCCTGTGTGCTC TGCTACCTGTTCATCAGCTCTAAGCCCCACACAAAGTTGGACCTGGGCTTGAGCTTACAGACAGCAGGCCCTGAGGAGGTTTCTCCTGAC TGCCAAGGTGTGAACACAGGCATGGCGGCAGAAGTGCCAAAAGTGAGCCCTCTCCAGCAGAGTTACTCCTGCTTGAACCCGCAGCTGGAG AGCAATGAGGGGCAGGCTGTGAACTCCAAACGCCTCCTCCATCATTGCTTCATGGCCACAGTGACCACCAGTGACATTCCAGGCAGCCCT |
| * Fusion transcript sequences (Full-length transcript). |
| >In-frame_FNIP2_ENST00000264433_chr4_159690471_+_FAM159A_ENST00000517870_chr1_53108535_+_598nt GCGGCCGCCGCCCCCGGCTGCGCGCTGAGCCGCCGGCCCCCCGAGCGCCACGGCCGGAGCTGCGGCGGCGGCATCATGGCCCCGACCCTG CTCCAGAAGCTCTTCAACAAAAGGGGCAGCAGCGGCAGCTCCGCGGCGGCGTCTGCCCAGGGCAGGGCTCCTAAGGAAGGACCCGCCTTT AGCATTGGCGCTCTCATAGGCCTGTCCGTAGCAGCAGTGGTTCTTCTCGCCTTCATTGTTACCGCCTGTGTGCTCTGCTACCTGTTCATC AGCTCTAAGCCCCACACAAAGTTGGACCTGGGCTTGAGCTTACAGACAGCAGGCCCTGAGGAGGTTTCTCCTGACTGCCAAGGTGTGAAC ACAGGCATGGCGGCAGAAGTGCCAAAAGTGAGCCCTCTCCAGCAGAGTTACTCCTGCTTGAACCCGCAGCTGGAGAGCAATGAGGGGCAG GCTGTGAACTCCAAACGCCTCCTCCATCATTGCTTCATGGCCACAGTGACCACCAGTGACATTCCAGGCAGCCCTGAGGAAGCCTCTGTA |
Top |
FusionGenePPI for FNIP2_FAM159A |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in . |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| FNIP2 | FLCN, GABARAP, HSP90AA1, HSPA1B, STIP1, CDC37, PTGES3, NR3C1, CDK4, BRAF, FNIP2, FNIP1 | FAM159A |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Hgene | FNIP2 | chr4:159690471 | chr1:53108535 | ENST00000264433 | + | 1 | 17 | 544_911 | 35 | 1115 | PRKAA1 |
| Hgene | FNIP2 | chr4:159690471 | chr1:53108535 | ENST00000379346 | + | 1 | 17 | 544_911 | 0 | 1138 | PRKAA1 |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
RelatedDrugs for FNIP2_FAM159A |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.0 2018-04-02) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for FNIP2_FAM159A |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|