FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13704

FusionGeneSummary for FNIP1_IL5

check button Fusion gene summary
Fusion gene informationFusion gene name: FNIP1_IL5
Fusion gene ID: 13704
HgeneTgene
Gene symbol

FNIP1

IL5

Gene ID

96459

3567

Gene namefolliculin interacting protein 1interleukin 5
Synonyms-EDF|IL-5|TRF
Cytomap

5q31.1

5q31.1

Type of geneprotein-codingprotein-coding
Descriptionfolliculin-interacting protein 1interleukin-5B-cell differentiation factor IT-cell replacing factorcolony-stimulating factor, eosinophileosinophil differentiation factor
Modification date2018051920180522
UniProtAcc

Q8TF40

P05113

Ensembl transtripts involved in fusion geneENST00000307968, ENST00000307954, 
ENST00000510461, ENST00000511848, 
ENST00000231454, 
Fusion gene scores* DoF score6 X 4 X 6=1442 X 2 X 2=8
# samples 82
** MAII scorelog2(8/144*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: FNIP1 [Title/Abstract] AND IL5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFNIP1

GO:0000122

negative regulation of transcription by RNA polymerase II

21209915

HgeneFNIP1

GO:0001932

regulation of protein phosphorylation

18663353

HgeneFNIP1

GO:0031334

positive regulation of protein complex assembly

25126726

HgeneFNIP1

GO:0033138

positive regulation of peptidyl-serine phosphorylation

19914239

TgeneIL5

GO:0071803

positive regulation of podosome assembly

15220135


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-FJ-A3ZF-01AFNIP1chr5

131132523

-IL5chr5

131878818

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000307968ENST00000231454FNIP1chr5

131132523

-IL5chr5

131878818

-
In-frameENST00000307954ENST00000231454FNIP1chr5

131132523

-IL5chr5

131878818

-
In-frameENST00000510461ENST00000231454FNIP1chr5

131132523

-IL5chr5

131878818

-
In-frameENST00000511848ENST00000231454FNIP1chr5

131132523

-IL5chr5

131878818

-

Top

FusionProtFeatures for FNIP1_IL5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FNIP1

Q8TF40

IL5

P05113

Acts as a co-chaperone of HSP90AA1. Inhibits the ATPaseactivity of HSP90AA1 leading to reduction in its chaperoneactivity. Facilitates the binding of client protein FLCN toHSP90AA1. Competes with the activating co-chaperone AHSA1 forbinding to HSP90AA1, thereby providing a reciprocal regulatorymechanism for chaperoning of client proteins (PubMed:27353360).May be involved in energy and/or nutrient sensing through the AMPKand mTOR signaling pathways (PubMed:17028174). May regulatephosphorylation of RPS6KB1 (PubMed:18663353).{ECO:0000269|PubMed:17028174, ECO:0000269|PubMed:18663353,ECO:0000269|PubMed:27353360}. Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFNIP1chr5:131132523chr5:131878818ENST00000307968-11796_99301139Compositional biasNote=Poly-Ser
HgeneFNIP1chr5:131132523chr5:131878818ENST00000510461-11896_99301167Compositional biasNote=Poly-Ser
HgeneFNIP1chr5:131132523chr5:131878818ENST00000511848-11396_9930509Compositional biasNote=Poly-Ser
HgeneFNIP1chr5:131132523chr5:131878818ENST00000307968-1171102_1157301139DomaindDENN FNIP1/2-type
HgeneFNIP1chr5:131132523chr5:131878818ENST00000307968-11737_478301139DomainuDENN FNIP1/2-type
HgeneFNIP1chr5:131132523chr5:131878818ENST00000307968-117486_1092301139DomaincDENN FNIP1/2-type
HgeneFNIP1chr5:131132523chr5:131878818ENST00000510461-1181102_1157301167DomaindDENN FNIP1/2-type
HgeneFNIP1chr5:131132523chr5:131878818ENST00000510461-11837_478301167DomainuDENN FNIP1/2-type
HgeneFNIP1chr5:131132523chr5:131878818ENST00000510461-118486_1092301167DomaincDENN FNIP1/2-type
HgeneFNIP1chr5:131132523chr5:131878818ENST00000511848-1131102_115730509DomaindDENN FNIP1/2-type
HgeneFNIP1chr5:131132523chr5:131878818ENST00000511848-11337_47830509DomainuDENN FNIP1/2-type
HgeneFNIP1chr5:131132523chr5:131878818ENST00000511848-113486_109230509DomaincDENN FNIP1/2-type


Top

FusionGeneSequence for FNIP1_IL5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FNIP1_ENST00000307968_chr5_131132523_-_IL5_ENST00000231454_chr5_131878818_-_117aa
MAPTLFQKLFSKRTGLGAPGRDARDPDCGFRLXGFLFLYIKITNCALKKSFREXAHWRVKLCKGVLWKDYSKTCPXXRNTLTAKKKSVEK

>In-frame_FNIP1_ENST00000307954_chr5_131132523_-_IL5_ENST00000231454_chr5_131878818_-_117aa
MAPTLFQKLFSKRTGLGAPGRDARDPDCGFRLXGFLFLYIKITNCALKKSFREXAHWRVKLCKGVLWKDYSKTCPXXRNTLTAKKKSVEK

>In-frame_FNIP1_ENST00000510461_chr5_131132523_-_IL5_ENST00000231454_chr5_131878818_-_117aa
MAPTLFQKLFSKRTGLGAPGRDARDPDCGFRLXGFLFLYIKITNCALKKSFREXAHWRVKLCKGVLWKDYSKTCPXXRNTLTAKKKSVEK

>In-frame_FNIP1_ENST00000511848_chr5_131132523_-_IL5_ENST00000231454_chr5_131878818_-_117aa
MAPTLFQKLFSKRTGLGAPGRDARDPDCGFRLXGFLFLYIKITNCALKKSFREXAHWRVKLCKGVLWKDYSKTCPXXRNTLTAKKKSVEK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FNIP1_ENST00000307968_chr5_131132523_-_IL5_ENST00000231454_chr5_131878818_-_353nt
ATGGCCCCTACGCTGTTCCAGAAGCTCTTCAGCAAGAGGACCGGGCTGGGCGCGCCCGGCCGCGACGCCCGGGACCCAGATTGCGGGTTC
AGACTCTGAGGATTCCTGTTCCTGTACATAAAAATCACCAACTGTGCACTGAAGAAATCTTTCAGGGAATAGGCACACTGGAGAGTCAAA
CTGTGCAAGGGGGTACTGTGGAAAGACTATTCAAAAACTTGTCCTTAATAAAGAAATACATTGACGGCCAAAAAAAAAAGTGTGGAGAAG

>In-frame_FNIP1_ENST00000307954_chr5_131132523_-_IL5_ENST00000231454_chr5_131878818_-_353nt
ATGGCCCCTACGCTGTTCCAGAAGCTCTTCAGCAAGAGGACCGGGCTGGGCGCGCCCGGCCGCGACGCCCGGGACCCAGATTGCGGGTTC
AGACTCTGAGGATTCCTGTTCCTGTACATAAAAATCACCAACTGTGCACTGAAGAAATCTTTCAGGGAATAGGCACACTGGAGAGTCAAA
CTGTGCAAGGGGGTACTGTGGAAAGACTATTCAAAAACTTGTCCTTAATAAAGAAATACATTGACGGCCAAAAAAAAAAGTGTGGAGAAG

>In-frame_FNIP1_ENST00000510461_chr5_131132523_-_IL5_ENST00000231454_chr5_131878818_-_353nt
ATGGCCCCTACGCTGTTCCAGAAGCTCTTCAGCAAGAGGACCGGGCTGGGCGCGCCCGGCCGCGACGCCCGGGACCCAGATTGCGGGTTC
AGACTCTGAGGATTCCTGTTCCTGTACATAAAAATCACCAACTGTGCACTGAAGAAATCTTTCAGGGAATAGGCACACTGGAGAGTCAAA
CTGTGCAAGGGGGTACTGTGGAAAGACTATTCAAAAACTTGTCCTTAATAAAGAAATACATTGACGGCCAAAAAAAAAAGTGTGGAGAAG

>In-frame_FNIP1_ENST00000511848_chr5_131132523_-_IL5_ENST00000231454_chr5_131878818_-_353nt
ATGGCCCCTACGCTGTTCCAGAAGCTCTTCAGCAAGAGGACCGGGCTGGGCGCGCCCGGCCGCGACGCCCGGGACCCAGATTGCGGGTTC
AGACTCTGAGGATTCCTGTTCCTGTACATAAAAATCACCAACTGTGCACTGAAGAAATCTTTCAGGGAATAGGCACACTGGAGAGTCAAA
CTGTGCAAGGGGGTACTGTGGAAAGACTATTCAAAAACTTGTCCTTAATAAAGAAATACATTGACGGCCAAAAAAAAAAGTGTGGAGAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_FNIP1_ENST00000307968_chr5_131132523_-_IL5_ENST00000231454_chr5_131878818_-_720nt
ATGGCCCCTACGCTGTTCCAGAAGCTCTTCAGCAAGAGGACCGGGCTGGGCGCGCCCGGCCGCGACGCCCGGGACCCAGATTGCGGGTTC
AGACTCTGAGGATTCCTGTTCCTGTACATAAAAATCACCAACTGTGCACTGAAGAAATCTTTCAGGGAATAGGCACACTGGAGAGTCAAA
CTGTGCAAGGGGGTACTGTGGAAAGACTATTCAAAAACTTGTCCTTAATAAAGAAATACATTGACGGCCAAAAAAAAAAGTGTGGAGAAG
AAAGACGGAGAGTAAACCAATTCCTAGACTACCTGCAAGAGTTTCTTGGTGTAATGAACACCGAGTGGATAATAGAAAGTTGAGACTAAA
CTGGTTTGTTGCAGCCAAAGATTTTGGAGGAGAAGGACATTTTACTGCAGTGAGAATGAGGGCCAAGAAAGAGTCAGGCCTTAATTTTCA
GTATAATTTAACTTCAGAGGGAAAGTAAATATTTCAGGCATACTGACACTTTGCCAGAAAGCATAAAATTCTTAAAATATATTTCAGATA
TCAGAATCATTGAAGTATTTTCCTCCAGGCAAAATTGATATACTTTTTTCTTATTTAACTTAACATTCTGTAAAATGTCTGTTAACTTAA
TAGTATTTATGAAATGGTTAAGAATTTGGTAAATTAGTATTTATTTAATGTTATGTTGTGTTCTAATAAAACAAAAATAGACAACTGTTC

>In-frame_FNIP1_ENST00000307954_chr5_131132523_-_IL5_ENST00000231454_chr5_131878818_-_749nt
GGAGCGACCCCTGCCTGGCCGTGGCTAGCATGGCCCCTACGCTGTTCCAGAAGCTCTTCAGCAAGAGGACCGGGCTGGGCGCGCCCGGCC
GCGACGCCCGGGACCCAGATTGCGGGTTCAGACTCTGAGGATTCCTGTTCCTGTACATAAAAATCACCAACTGTGCACTGAAGAAATCTT
TCAGGGAATAGGCACACTGGAGAGTCAAACTGTGCAAGGGGGTACTGTGGAAAGACTATTCAAAAACTTGTCCTTAATAAAGAAATACAT
TGACGGCCAAAAAAAAAAGTGTGGAGAAGAAAGACGGAGAGTAAACCAATTCCTAGACTACCTGCAAGAGTTTCTTGGTGTAATGAACAC
CGAGTGGATAATAGAAAGTTGAGACTAAACTGGTTTGTTGCAGCCAAAGATTTTGGAGGAGAAGGACATTTTACTGCAGTGAGAATGAGG
GCCAAGAAAGAGTCAGGCCTTAATTTTCAGTATAATTTAACTTCAGAGGGAAAGTAAATATTTCAGGCATACTGACACTTTGCCAGAAAG
CATAAAATTCTTAAAATATATTTCAGATATCAGAATCATTGAAGTATTTTCCTCCAGGCAAAATTGATATACTTTTTTCTTATTTAACTT
AACATTCTGTAAAATGTCTGTTAACTTAATAGTATTTATGAAATGGTTAAGAATTTGGTAAATTAGTATTTATTTAATGTTATGTTGTGT

>In-frame_FNIP1_ENST00000510461_chr5_131132523_-_IL5_ENST00000231454_chr5_131878818_-_816nt
ATATGACTGAGGCGCCCATGGGGGTGGCGGGGCGGCTGTAGGAGCAGGGGCCTAGCAAGCGCCCAGCGGAGCGACCCCTGCCTGGCCGTG
GCTAGCATGGCCCCTACGCTGTTCCAGAAGCTCTTCAGCAAGAGGACCGGGCTGGGCGCGCCCGGCCGCGACGCCCGGGACCCAGATTGC
GGGTTCAGACTCTGAGGATTCCTGTTCCTGTACATAAAAATCACCAACTGTGCACTGAAGAAATCTTTCAGGGAATAGGCACACTGGAGA
GTCAAACTGTGCAAGGGGGTACTGTGGAAAGACTATTCAAAAACTTGTCCTTAATAAAGAAATACATTGACGGCCAAAAAAAAAAGTGTG
GAGAAGAAAGACGGAGAGTAAACCAATTCCTAGACTACCTGCAAGAGTTTCTTGGTGTAATGAACACCGAGTGGATAATAGAAAGTTGAG
ACTAAACTGGTTTGTTGCAGCCAAAGATTTTGGAGGAGAAGGACATTTTACTGCAGTGAGAATGAGGGCCAAGAAAGAGTCAGGCCTTAA
TTTTCAGTATAATTTAACTTCAGAGGGAAAGTAAATATTTCAGGCATACTGACACTTTGCCAGAAAGCATAAAATTCTTAAAATATATTT
CAGATATCAGAATCATTGAAGTATTTTCCTCCAGGCAAAATTGATATACTTTTTTCTTATTTAACTTAACATTCTGTAAAATGTCTGTTA
ACTTAATAGTATTTATGAAATGGTTAAGAATTTGGTAAATTAGTATTTATTTAATGTTATGTTGTGTTCTAATAAAACAAAAATAGACAA

>In-frame_FNIP1_ENST00000511848_chr5_131132523_-_IL5_ENST00000231454_chr5_131878818_-_815nt
TATGACTGAGGCGCCCATGGGGGTGGCGGGGCGGCTGTAGGAGCAGGGGCCTAGCAAGCGCCCAGCGGAGCGACCCCTGCCTGGCCGTGG
CTAGCATGGCCCCTACGCTGTTCCAGAAGCTCTTCAGCAAGAGGACCGGGCTGGGCGCGCCCGGCCGCGACGCCCGGGACCCAGATTGCG
GGTTCAGACTCTGAGGATTCCTGTTCCTGTACATAAAAATCACCAACTGTGCACTGAAGAAATCTTTCAGGGAATAGGCACACTGGAGAG
TCAAACTGTGCAAGGGGGTACTGTGGAAAGACTATTCAAAAACTTGTCCTTAATAAAGAAATACATTGACGGCCAAAAAAAAAAGTGTGG
AGAAGAAAGACGGAGAGTAAACCAATTCCTAGACTACCTGCAAGAGTTTCTTGGTGTAATGAACACCGAGTGGATAATAGAAAGTTGAGA
CTAAACTGGTTTGTTGCAGCCAAAGATTTTGGAGGAGAAGGACATTTTACTGCAGTGAGAATGAGGGCCAAGAAAGAGTCAGGCCTTAAT
TTTCAGTATAATTTAACTTCAGAGGGAAAGTAAATATTTCAGGCATACTGACACTTTGCCAGAAAGCATAAAATTCTTAAAATATATTTC
AGATATCAGAATCATTGAAGTATTTTCCTCCAGGCAAAATTGATATACTTTTTTCTTATTTAACTTAACATTCTGTAAAATGTCTGTTAA
CTTAATAGTATTTATGAAATGGTTAAGAATTTGGTAAATTAGTATTTATTTAATGTTATGTTGTGTTCTAATAAAACAAAAATAGACAAC


Top

FusionGenePPI for FNIP1_IL5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FNIP1HSP90AA1, PRKAA1, PRKAB1, PRKAG1, FLCN, PRKAA2, FBXW11, COPS5, BTRC, HSPA5, GABARAP, HSPA1B, STIP1, CDC37, PTGES3, NR3C1, CDK4, BRAF, FNIP1, FNIP2, TRIM25IL5IL5RA, IL5


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneFNIP1chr5:131132523chr5:131878818ENST00000307968-117929_1166301139HSP90AA1
HgeneFNIP1chr5:131132523chr5:131878818ENST00000510461-118929_1166301167HSP90AA1
HgeneFNIP1chr5:131132523chr5:131878818ENST00000511848-113929_116630509HSP90AA1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FNIP1_IL5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneIL5P05113DB01411PranlukastInterleukin-5small moleculeapproved|investigational
TgeneIL5P05113DB06602ReslizumabInterleukin-5biotechapproved|investigational
TgeneIL5P05113DB06612MepolizumabInterleukin-5biotechapproved|investigational

Top

RelatedDiseases for FNIP1_IL5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneIL5C0004096Asthma2CTD_human
TgeneIL5C0011615Dermatitis, Atopic2CTD_human
TgeneIL5C0014457Eosinophilia2CTD_human
TgeneIL5C0004352Autistic Disorder1CTD_human
TgeneIL5C0014324Entamoebiasis1CTD_human
TgeneIL5C0034069Pulmonary Fibrosis1CTD_human
TgeneIL5C0162820Dermatitis, Allergic Contact1CTD_human
TgeneIL5C0241910Hepatitis, Autoimmune1CTD_human