FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1361

FusionGeneSummary for AKAP9_BRAF

check button Fusion gene summary
Fusion gene informationFusion gene name: AKAP9_BRAF
Fusion gene ID: 1361
HgeneTgene
Gene symbol

AKAP9

BRAF

Gene ID

10142

673

Gene nameA-kinase anchoring protein 9B-Raf proto-oncogene, serine/threonine kinase
SynonymsAKAP-9|AKAP350|AKAP450|CG-NAP|HYPERION|LQT11|MU-RMS-40.16A|PPP1R45|PRKA9|YOTIAOB-RAF1|B-raf|BRAF1|NS7|RAFB1
Cytomap

7q21.2

7q34

Type of geneprotein-codingprotein-coding
DescriptionA-kinase anchor protein 9A kinase (PRKA) anchor protein (yotiao) 9A kinase (PRKA) anchor protein 9A-kinase anchor protein 350 kDaA-kinase anchor protein 450 kDaAKAP 120-like proteinAKAP9-BRAF fusion proteincentrosome- and Golgi-localized PKN-associserine/threonine-protein kinase B-raf94 kDa B-raf proteinB-Raf proto-oncogene serine/threonine-protein kinase (p94)B-Raf serine/threonine-proteinmurine sarcoma viral (v-raf) oncogene homolog B1proto-oncogene B-Rafv-raf murine sarcoma viral oncogene
Modification date2018052320180527
UniProtAcc

Q99996

P15056

Ensembl transtripts involved in fusion geneENST00000356239, ENST00000358100, 
ENST00000359028, ENST00000394564, 
ENST00000491695, 
ENST00000288602, 
Fusion gene scores* DoF score12 X 12 X 7=100824 X 11 X 10=2640
# samples 2235
** MAII scorelog2(22/1008*10)=-2.19592020997526
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(35/2640*10)=-2.91511110241349
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: AKAP9 [Title/Abstract] AND BRAF [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneAKAP9

GO:1903358

regulation of Golgi organization

27666745

TgeneBRAF

GO:0006468

protein phosphorylation

17563371

TgeneBRAF

GO:0010828

positive regulation of glucose transmembrane transport

23010278

TgeneBRAF

GO:0033138

positive regulation of peptidyl-serine phosphorylation

19667065

TgeneBRAF

GO:0043066

negative regulation of apoptotic process

19667065

TgeneBRAF

GO:0070374

positive regulation of ERK1 and ERK2 cascade

22065586

TgeneBRAF

GO:0071277

cellular response to calcium ion

18567582

TgeneBRAF

GO:0090150

establishment of protein localization to membrane

23010278


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1AY803272AKAP9chr7

91632550

+BRAFchr7

140487386

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000356239ENST00000288602AKAP9chr7

91632550

+BRAFchr7

140487386

-
In-frameENST00000358100ENST00000288602AKAP9chr7

91632550

+BRAFchr7

140487386

-
In-frameENST00000359028ENST00000288602AKAP9chr7

91632550

+BRAFchr7

140487386

-
intron-3CDSENST00000394564ENST00000288602AKAP9chr7

91632550

+BRAFchr7

140487386

-
intron-3CDSENST00000491695ENST00000288602AKAP9chr7

91632550

+BRAFchr7

140487386

-

Top

FusionProtFeatures for AKAP9_BRAF


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AKAP9

Q99996

BRAF

P15056


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+850152_90211063908Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+850932_101011063908Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+949152_90211183858Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+949932_101011183858Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+950152_90211183912Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+950932_101011183912Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+850191_28011063908Compositional biasNote=Gln-rich
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+850309_99811063908Compositional biasNote=Glu-rich
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+949191_28011183858Compositional biasNote=Gln-rich
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+949309_99811183858Compositional biasNote=Glu-rich
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+950191_28011183912Compositional biasNote=Gln-rich
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+950309_99811183912Compositional biasNote=Glu-rich
TgeneBRAFchr7:91632550chr7:140487386ENST00000288602-718428_432380767Compositional biasNote=Poly-Ser
TgeneBRAFchr7:91632550chr7:140487386ENST00000288602-718457_717380767DomainProtein kinase
TgeneBRAFchr7:91632550chr7:140487386ENST00000288602-718463_471380767Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8501088_117311063908Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8501241_126811063908Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8501324_138011063908Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8501422_144711063908Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8501573_164711063908Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8501845_244311063908Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8502532_254911063908Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8502591_276411063908Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8503061_308811063908Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8503120_346611063908Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8503583_368511063908Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9491088_117311183858Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9491241_126811183858Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9491324_138011183858Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9491422_144711183858Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9491573_164711183858Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9491845_244311183858Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9492532_254911183858Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9492591_276411183858Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9493061_308811183858Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9493120_346611183858Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9493583_368511183858Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9501088_117311183912Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9501241_126811183912Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9501324_138011183912Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9501422_144711183912Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9501573_164711183912Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9501845_244311183912Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9502532_254911183912Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9502591_276411183912Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9503061_308811183912Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9503120_346611183912Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9503583_368511183912Coiled coilOntology_term=ECO:0000255
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8501834_276011063908Compositional biasNote=Glu-rich
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8503722_372611063908Compositional biasNote=Poly-Leu
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9491834_276011183858Compositional biasNote=Glu-rich
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9493722_372611183858Compositional biasNote=Poly-Leu
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9501834_276011183912Compositional biasNote=Glu-rich
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9503722_372611183912Compositional biasNote=Poly-Leu
HgeneAKAP9chr7:91632550chr7:140487386ENST00000356239+8502542_255511063908RegionNote=PKA-RII subunit binding domain
HgeneAKAP9chr7:91632550chr7:140487386ENST00000358100+9492542_255511183858RegionNote=PKA-RII subunit binding domain
HgeneAKAP9chr7:91632550chr7:140487386ENST00000359028+9502542_255511183912RegionNote=PKA-RII subunit binding domain
TgeneBRAFchr7:91632550chr7:140487386ENST00000288602-718122_129380767Compositional biasNote=Poly-Ser
TgeneBRAFchr7:91632550chr7:140487386ENST00000288602-7186_11380767Compositional biasNote=Poly-Gly
TgeneBRAFchr7:91632550chr7:140487386ENST00000288602-718155_227380767DomainRBD
TgeneBRAFchr7:91632550chr7:140487386ENST00000288602-718234_280380767Zinc fingerPhorbol-ester/DAG-type


Top

FusionGeneSequence for AKAP9_BRAF


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AKAP9_ENST00000356239_chr7_91632550_+_BRAF_ENST00000288602_chr7_140487386_-_1493aa
MEDEERQKKLEAGKAKLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHDVSAHHDLNIDQSQCNEMYINSSQRVESTVIPESTIMRTLHSG
EITSHEQGFSVELESEISTTADDCSSEVNGCSFVMRTGKPTNLLREEEFGVDDSTSEQGAQDSPTHLEMMESELAGKQHEIEELNRELEE
MRVTTGTEGLQQLQEFEAAIKQRDGIITQLTANLQQARREKDETMREFLELTEQSQKLQIQFQQLQASETLRNSTHSSTAADLLQAKQQI
LTHQQQLEEQDHLLEDTQKKKEDFTMQISFLQEKIKVTEMEQDKKVENSNKEEIQEKETIIEELNTKIIEEEKKTLELKDKLTTADKLLG
ELQEQIVQKNQEIKNMKLELTNSKQKERQSSEEIKQLMGTVEELQKRNHKDSQFETDIVQRMEQETQRKLEQLRAELDEMTGQQIVQMKQ
ELIRQHMAQMEEMKTRHKGEMENALRSTSNITVNEDQIKLMNVAINELNIKLQDTNSQKEKLKEELGLILEEKCALQRQLEDLVEELSFS
REQIQRARQTIAEQESKLNEAHKSLSTVEDLKAEIVSASESRKELELKHEAEVTNYKIKLEMLEKEKNAVLDRMAESQEAELERLRTQLL
FSHEEELSKLKEDLEIEHRINIEKLKDNLGIHTKQQIDGLQNEMSQKIETMQFEKDNLITKQNQLILEISKLKDLQQSLVNSKSEEMTLQ
INELQKEIEILRQEEKEKGTLEQEVQELQLKTELLEKQMKEKENDLQEKFAQLEAENSILKDEKKTLEDMLKIHTPVSQEERLIFLDSIK
SKSKDSVWEKEIEILIEENEDLKQQCIQLNEEIEKQRNTFSFAEKNFEVNTQELQEETACLLKVKDDLEDSKNKQELETKSKLKALNEEL
HLQRINPTTVKMKSSVFDEDKTFVAETLEMGEVVEKDTTELMEKLEVTKREKLELSQRLSDLSEQLKQKHGEISFLNEEVKSLKQEKEQV
SLRCRELEIIINHNRAENVQSCDTQVSSLLDGVVTMTSRGAEGSVSKVNKSFGEESKIMVEDKVSFENMTVGEESKQEQLILDHLPSVTK
ESSLRATQPSENDKLQKELNVLKSEQDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRR
DSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGTSTKPQLAIVTQWCEG
SSLTHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEV
IRMQDKNPYSFQSDVTAFGIVLTELMTGQLPTSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASI

>In-frame_AKAP9_ENST00000358100_chr7_91632550_+_BRAF_ENST00000288602_chr7_140487386_-_1505aa
MEDEERQKKLEAGKAKIEELSLAFLVRQLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHDVSAHHDLNIDQSQCNEMYINSSQRVESTVI
PESTIMRTLHSGEITSHEQGFSVELESEISTTADDCSSEVNGCSFVMRTGKPTNLLREEEFGVDDSTSEQGAQDSPTHLEMMESELAGKQ
HEIEELNRELEEMRVTTGTEGLQQLQEFEAAIKQRDGIITQLTANLQQARREKDETMREFLELTEQSQKLQIQFQQLQASETLRNSTHSS
TAADLLQAKQQILTHQQQLEEQDHLLEDTQKKKEDFTMQISFLQEKIKVTEMEQDKKVENSNKEEIQEKETIIEELNTKIIEEEKKTLEL
KDKLTTADKLLGELQEQIVQKNQEIKNMKLELTNSKQKERQSSEEIKQLMGTVEELQKRNHKDSQFETDIVQRMEQETQRKLEQLRAELD
EMTGQQIVQMKQELIRQHMAQMEEMKTRHKGEMENALRSTSNITVNEDQIKLMNVAINELNIKLQDTNSQKEKLKEELGLILEEKCALQR
QLEDLVEELSFSREQIQRARQTIAEQESKLNEAHKSLSTVEDLKAEIVSASESRKELELKHEAEVTNYKIKLEMLEKEKNAVLDRMAESQ
EAELERLRTQLLFSHEEELSKLKEDLEIEHRINIEKLKDNLGIHTKQQIDGLQNEMSQKIETMQFEKDNLITKQNQLILEISKLKDLQQS
LVNSKSEEMTLQINELQKEIEILRQEEKEKGTLEQEVQELQLKTELLEKQMKEKENDLQEKFAQLEAENSILKDEKKTLEDMLKIHTPVS
QEERLIFLDSIKSKSKDSVWEKEIEILIEENEDLKQQCIQLNEEIEKQRNTFSFAEKNFEVNTQELQEETACLLKVKDDLEDSKNKQELE
TKSKLKALNEELHLQRINPTTVKMKSSVFDEDKTFVAETLEMGEVVEKDTTELMEKLEVTKREKLELSQRLSDLSEQLKQKHGEISFLNE
EVKSLKQEKEQVSLRCRELEIIINHNRAENVQSCDTQVSSLLDGVVTMTSRGAEGSVSKVNKSFGEESKIMVEDKVSFENMTVGEESKQE
QLILDHLPSVTKESSLRATQPSENDKLQKELNVLKSEQDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSS
EDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGTSTK
PQLAIVTQWCEGSSLTHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQ
LSGSILWMAPEVIRMQDKNPYSFQSDVTAFGIVLTELMTGQLPTSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRD

>In-frame_AKAP9_ENST00000359028_chr7_91632550_+_BRAF_ENST00000288602_chr7_140487386_-_1505aa
MEDEERQKKLEAGKAKIEELSLAFLVRQLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHDVSAHHDLNIDQSQCNEMYINSSQRVESTVI
PESTIMRTLHSGEITSHEQGFSVELESEISTTADDCSSEVNGCSFVMRTGKPTNLLREEEFGVDDSTSEQGAQDSPTHLEMMESELAGKQ
HEIEELNRELEEMRVTTGTEGLQQLQEFEAAIKQRDGIITQLTANLQQARREKDETMREFLELTEQSQKLQIQFQQLQASETLRNSTHSS
TAADLLQAKQQILTHQQQLEEQDHLLEDTQKKKEDFTMQISFLQEKIKVTEMEQDKKVENSNKEEIQEKETIIEELNTKIIEEEKKTLEL
KDKLTTADKLLGELQEQIVQKNQEIKNMKLELTNSKQKERQSSEEIKQLMGTVEELQKRNHKDSQFETDIVQRMEQETQRKLEQLRAELD
EMTGQQIVQMKQELIRQHMAQMEEMKTRHKGEMENALRSTSNITVNEDQIKLMNVAINELNIKLQDTNSQKEKLKEELGLILEEKCALQR
QLEDLVEELSFSREQIQRARQTIAEQESKLNEAHKSLSTVEDLKAEIVSASESRKELELKHEAEVTNYKIKLEMLEKEKNAVLDRMAESQ
EAELERLRTQLLFSHEEELSKLKEDLEIEHRINIEKLKDNLGIHTKQQIDGLQNEMSQKIETMQFEKDNLITKQNQLILEISKLKDLQQS
LVNSKSEEMTLQINELQKEIEILRQEEKEKGTLEQEVQELQLKTELLEKQMKEKENDLQEKFAQLEAENSILKDEKKTLEDMLKIHTPVS
QEERLIFLDSIKSKSKDSVWEKEIEILIEENEDLKQQCIQLNEEIEKQRNTFSFAEKNFEVNTQELQEETACLLKVKDDLEDSKNKQELE
TKSKLKALNEELHLQRINPTTVKMKSSVFDEDKTFVAETLEMGEVVEKDTTELMEKLEVTKREKLELSQRLSDLSEQLKQKHGEISFLNE
EVKSLKQEKEQVSLRCRELEIIINHNRAENVQSCDTQVSSLLDGVVTMTSRGAEGSVSKVNKSFGEESKIMVEDKVSFENMTVGEESKQE
QLILDHLPSVTKESSLRATQPSENDKLQKELNVLKSEQDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSS
EDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGTSTK
PQLAIVTQWCEGSSLTHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQ
LSGSILWMAPEVIRMQDKNPYSFQSDVTAFGIVLTELMTGQLPTSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AKAP9_ENST00000356239_chr7_91632550_+_BRAF_ENST00000288602_chr7_140487386_-_4479nt
ATGGAGGACGAGGAGAGACAGAAGAAGCTGGAGGCCGGCAAAGCCAAGCTTGCCCAGTTTCGACAAAGAAAAGCTCAGTCGGATGGGCAG
AGTCCTTCCAAGAAGCAGAAAAAAAAGAGAAAAACGTCAAGCAGTAAACATGATGTGTCAGCACACCATGATTTGAATATTGATCAATCA
CAGTGTAATGAAATGTACATAAATAGTTCTCAGAGAGTAGAATCAACTGTGATTCCTGAATCTACAATAATGAGAACTCTACATAGTGGA
GAAATAACCAGTCATGAGCAGGGCTTCTCTGTGGAACTGGAAAGTGAAATTTCAACCACAGCAGATGACTGCAGTTCAGAGGTAAATGGT
TGCAGTTTTGTGATGAGAACAGGAAAGCCTACAAATTTATTAAGGGAAGAAGAATTTGGTGTTGATGATTCTTATTCTGAACAAGGAGCA
CAAGACAGTCCGACTCATCTAGAGATGATGGAAAGTGAGTTGGCTGGGAAGCAGCATGAGATTGAAGAGCTAAACAGAGAGCTGGAAGAA
ATGAGGGTTACCTATGGGACTGAAGGACTGCAGCAGTTACAAGAATTTGAAGCTGCCATTAAACAAAGAGATGGCATTATAACCCAGCTC
ACTGCTAATTTACAACAAGCAAGAAGAGAAAAGGATGAGACAATGAGAGAATTTTTAGAGTTGACAGAACAGAGTCAAAAATTACAGATT
CAATTTCAGCAATTACAGGCTAGTGAAACTCTGAGAAACAGCACTCATAGTAGCACAGCTGCAGACTTACTACAAGCCAAACAACAGATC
CTCACTCATCAACAGCAGCTTGAAGAACAAGACCACTTATTAGAAGATTATCAGAAAAAGAAAGAAGACTTCACAATGCAAATTAGTTTC
TTGCAAGAGAAAATTAAAGTATATGAAATGGAACAAGATAAAAAAGTAGAAAACTCAAATAAAGAAGAAATACAGGAAAAGGAGACAATC
ATTGAAGAATTAAACACAAAAATAATAGAAGAAGAAAAGAAAACTCTTGAGCTAAAGGATAAATTAACAACTGCTGATAAATTACTAGGA
GAATTACAAGAACAGATTGTGCAAAAGAACCAAGAAATAAAAAACATGAAATTAGAGCTGACTAATTCTAAGCAAAAAGAAAGACAGTCT
TCTGAAGAAATAAAACAGTTAATGGGGACAGTCGAAGAACTTCAGAAGAGAAATCATAAAGACAGCCAGTTCGAAACTGATATAGTACAA
CGAATGGAACAAGAAACACAAAGAAAGTTAGAACAACTCCGGGCAGAGCTGGATGAGATGTATGGGCAGCAGATAGTGCAAATGAAACAA
GAATTAATAAGACAACACATGGCACAGATGGAGGAAATGAAAACACGGCATAAGGGAGAAATGGAGAATGCTTTAAGGTCATATTCAAAT
ATTACAGTTAATGAAGATCAGATAAAGTTAATGAATGTGGCAATAAATGAACTGAATATAAAATTGCAAGATACTAACTCTCAAAAGGAA
AAACTCAAGGAAGAACTAGGACTAATTTTAGAAGAAAAGTGTGCTCTACAGAGACAGCTTGAAGACCTTGTTGAAGAATTGAGCTTTTCA
AGGGAACAGATTCAGAGAGCTAGACAGACAATAGCTGAACAAGAAAGTAAACTTAATGAAGCACATAAGTCCCTTAGTACAGTGGAAGAT
TTGAAAGCTGAGATTGTTTCTGCATCTGAATCCAGAAAGGAACTAGAATTAAAACATGAAGCAGAAGTTACAAATTACAAGATAAAACTT
GAAATGTTAGAAAAAGAAAAGAATGCTGTGTTAGACAGAATGGCTGAATCACAAGAAGCTGAATTAGAGAGGCTGAGAACACAGCTTCTA
TTTAGTCACGAAGAAGAGCTTTCCAAACTGAAGGAAGATTTAGAAATTGAACATCGAATAAATATTGAAAAACTTAAAGATAATTTAGGC
ATTCACTATAAACAGCAGATAGATGGTTTACAGAATGAAATGAGTCAAAAGATAGAAACCATGCAGTTTGAAAAGGACAATTTGATAACT
AAGCAGAATCAATTAATTTTGGAAATTTCAAAGCTAAAAGATTTACAGCAGTCTCTTGTAAATTCAAAGTCAGAAGAAATGACTCTTCAA
ATCAATGAACTTCAAAAAGAAATTGAAATACTCAGACAAGAAGAAAAAGAAAAGGGTACACTTGAACAAGAAGTTCAAGAATTACAACTT
AAAACAGAATTGTTAGAAAAACAGATGAAGGAAAAAGAGAATGATCTTCAAGAAAAATTTGCACAACTTGAAGCAGAGAATAGCATTCTT
AAAGATGAAAAGAAAACCCTTGAAGACATGTTGAAAATACATACTCCTGTTAGCCAAGAAGAAAGATTGATTTTCTTAGACTCCATTAAG
TCCAAATCCAAAGACTCTGTGTGGGAAAAAGAAATAGAAATACTTATAGAGGAAAATGAGGACCTCAAACAACAATGTATTCAGCTAAAT
GAAGAGATTGAAAAGCAAAGGAACACTTTTTCATTTGCTGAAAAAAACTTTGAAGTTAACTATCAAGAGTTACAAGAGGAGTATGCTTGC
CTTCTCAAAGTAAAAGATGATTTAGAAGACAGTAAAAATAAACAGGAATTAGAGTATAAAAGTAAACTTAAAGCACTTAATGAAGAGCTT
CATTTGCAAAGAATAAATCCAACTACAGTGAAAATGAAAAGTTCTGTCTTTGATGAAGACAAAACTTTTGTAGCAGAAACATTGGAAATG
GGTGAGGTTGTTGAAAAGGATACAACAGAACTCATGGAAAAACTTGAGGTAACCAAGCGAGAGAAATTAGAGCTGTCACAGAGACTGTCT
GATCTTTCTGAACAATTGAAACAGAAACATGGTGAGATTAGTTTTCTAAATGAAGAAGTTAAATCTTTAAAGCAAGAGAAAGAACAAGTT
TCATTGAGATGTAGAGAGCTAGAAATCATTATTAACCACAACAGGGCAGAAAATGTACAGTCATGTGATACTCAAGTAAGCTCTTTATTA
GATGGAGTTGTGACCATGACAAGCAGGGGTGCTGAAGGATCAGTTTCTAAAGTAAATAAAAGTTTTGGTGAAGAATCAAAAATAATGGTG
GAAGATAAAGTTTCTTTTGAAAATATGACTGTTGGAGAAGAAAGTAAGCAAGAACAGTTGATTTTGGATCACTTACCATCTGTAACAAAG
GAATCATCACTTAGAGCAACTCAACCAAGTGAAAATGATAAACTTCAGAAAGAACTCAATGTACTTAAATCAGAACAGGACTTGATTAGA
GACCAAGGATTTCGTGGTGATGGAGGATCAACCACAGGTTTGTCTGCTACCCCCCCTGCCTCATTACCTGGCTCACTAACTAACGTGAAA
GCCTTACAGAAATCTCCAGGACCTCAGCGAGAAAGGAAGTCATCTTCATCCTCAGAAGACAGGAATCGAATGAAAACACTTGGTAGACGG
GACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGA
AAGTGGCATGGTGATGTGGCAGTGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTA
CTCAGGAAAACACGACATGTGAATATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGC
TCCAGCTTGTATCACCATCTCCATATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATG
GATTACTTACACGCCAAGTCAATCATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGAT
TTTGGTCTAGCTACAGTGAAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTC
ATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTA
CCTTATTCAAACATCAACAACAGGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAAC
TGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATT
GAGCTGCTGGCCCGCTCATTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGT

>In-frame_AKAP9_ENST00000358100_chr7_91632550_+_BRAF_ENST00000288602_chr7_140487386_-_4515nt
ATGGAGGACGAGGAGAGACAGAAGAAGCTGGAGGCCGGCAAAGCCAAGATTGAAGAACTCTCTTTAGCTTTTCTTGTCAGACAGCTTGCC
CAGTTTCGACAAAGAAAAGCTCAGTCGGATGGGCAGAGTCCTTCCAAGAAGCAGAAAAAAAAGAGAAAAACGTCAAGCAGTAAACATGAT
GTGTCAGCACACCATGATTTGAATATTGATCAATCACAGTGTAATGAAATGTACATAAATAGTTCTCAGAGAGTAGAATCAACTGTGATT
CCTGAATCTACAATAATGAGAACTCTACATAGTGGAGAAATAACCAGTCATGAGCAGGGCTTCTCTGTGGAACTGGAAAGTGAAATTTCA
ACCACAGCAGATGACTGCAGTTCAGAGGTAAATGGTTGCAGTTTTGTGATGAGAACAGGAAAGCCTACAAATTTATTAAGGGAAGAAGAA
TTTGGTGTTGATGATTCTTATTCTGAACAAGGAGCACAAGACAGTCCGACTCATCTAGAGATGATGGAAAGTGAGTTGGCTGGGAAGCAG
CATGAGATTGAAGAGCTAAACAGAGAGCTGGAAGAAATGAGGGTTACCTATGGGACTGAAGGACTGCAGCAGTTACAAGAATTTGAAGCT
GCCATTAAACAAAGAGATGGCATTATAACCCAGCTCACTGCTAATTTACAACAAGCAAGAAGAGAAAAGGATGAGACAATGAGAGAATTT
TTAGAGTTGACAGAACAGAGTCAAAAATTACAGATTCAATTTCAGCAATTACAGGCTAGTGAAACTCTGAGAAACAGCACTCATAGTAGC
ACAGCTGCAGACTTACTACAAGCCAAACAACAGATCCTCACTCATCAACAGCAGCTTGAAGAACAAGACCACTTATTAGAAGATTATCAG
AAAAAGAAAGAAGACTTCACAATGCAAATTAGTTTCTTGCAAGAGAAAATTAAAGTATATGAAATGGAACAAGATAAAAAAGTAGAAAAC
TCAAATAAAGAAGAAATACAGGAAAAGGAGACAATCATTGAAGAATTAAACACAAAAATAATAGAAGAAGAAAAGAAAACTCTTGAGCTA
AAGGATAAATTAACAACTGCTGATAAATTACTAGGAGAATTACAAGAACAGATTGTGCAAAAGAACCAAGAAATAAAAAACATGAAATTA
GAGCTGACTAATTCTAAGCAAAAAGAAAGACAGTCTTCTGAAGAAATAAAACAGTTAATGGGGACAGTCGAAGAACTTCAGAAGAGAAAT
CATAAAGACAGCCAGTTCGAAACTGATATAGTACAACGAATGGAACAAGAAACACAAAGAAAGTTAGAACAACTCCGGGCAGAGCTGGAT
GAGATGTATGGGCAGCAGATAGTGCAAATGAAACAAGAATTAATAAGACAACACATGGCACAGATGGAGGAAATGAAAACACGGCATAAG
GGAGAAATGGAGAATGCTTTAAGGTCATATTCAAATATTACAGTTAATGAAGATCAGATAAAGTTAATGAATGTGGCAATAAATGAACTG
AATATAAAATTGCAAGATACTAACTCTCAAAAGGAAAAACTCAAGGAAGAACTAGGACTAATTTTAGAAGAAAAGTGTGCTCTACAGAGA
CAGCTTGAAGACCTTGTTGAAGAATTGAGCTTTTCAAGGGAACAGATTCAGAGAGCTAGACAGACAATAGCTGAACAAGAAAGTAAACTT
AATGAAGCACATAAGTCCCTTAGTACAGTGGAAGATTTGAAAGCTGAGATTGTTTCTGCATCTGAATCCAGAAAGGAACTAGAATTAAAA
CATGAAGCAGAAGTTACAAATTACAAGATAAAACTTGAAATGTTAGAAAAAGAAAAGAATGCTGTGTTAGACAGAATGGCTGAATCACAA
GAAGCTGAATTAGAGAGGCTGAGAACACAGCTTCTATTTAGTCACGAAGAAGAGCTTTCCAAACTGAAGGAAGATTTAGAAATTGAACAT
CGAATAAATATTGAAAAACTTAAAGATAATTTAGGCATTCACTATAAACAGCAGATAGATGGTTTACAGAATGAAATGAGTCAAAAGATA
GAAACCATGCAGTTTGAAAAGGACAATTTGATAACTAAGCAGAATCAATTAATTTTGGAAATTTCAAAGCTAAAAGATTTACAGCAGTCT
CTTGTAAATTCAAAGTCAGAAGAAATGACTCTTCAAATCAATGAACTTCAAAAAGAAATTGAAATACTCAGACAAGAAGAAAAAGAAAAG
GGTACACTTGAACAAGAAGTTCAAGAATTACAACTTAAAACAGAATTGTTAGAAAAACAGATGAAGGAAAAAGAGAATGATCTTCAAGAA
AAATTTGCACAACTTGAAGCAGAGAATAGCATTCTTAAAGATGAAAAGAAAACCCTTGAAGACATGTTGAAAATACATACTCCTGTTAGC
CAAGAAGAAAGATTGATTTTCTTAGACTCCATTAAGTCCAAATCCAAAGACTCTGTGTGGGAAAAAGAAATAGAAATACTTATAGAGGAA
AATGAGGACCTCAAACAACAATGTATTCAGCTAAATGAAGAGATTGAAAAGCAAAGGAACACTTTTTCATTTGCTGAAAAAAACTTTGAA
GTTAACTATCAAGAGTTACAAGAGGAGTATGCTTGCCTTCTCAAAGTAAAAGATGATTTAGAAGACAGTAAAAATAAACAGGAATTAGAG
TATAAAAGTAAACTTAAAGCACTTAATGAAGAGCTTCATTTGCAAAGAATAAATCCAACTACAGTGAAAATGAAAAGTTCTGTCTTTGAT
GAAGACAAAACTTTTGTAGCAGAAACATTGGAAATGGGTGAGGTTGTTGAAAAGGATACAACAGAACTCATGGAAAAACTTGAGGTAACC
AAGCGAGAGAAATTAGAGCTGTCACAGAGACTGTCTGATCTTTCTGAACAATTGAAACAGAAACATGGTGAGATTAGTTTTCTAAATGAA
GAAGTTAAATCTTTAAAGCAAGAGAAAGAACAAGTTTCATTGAGATGTAGAGAGCTAGAAATCATTATTAACCACAACAGGGCAGAAAAT
GTACAGTCATGTGATACTCAAGTAAGCTCTTTATTAGATGGAGTTGTGACCATGACAAGCAGGGGTGCTGAAGGATCAGTTTCTAAAGTA
AATAAAAGTTTTGGTGAAGAATCAAAAATAATGGTGGAAGATAAAGTTTCTTTTGAAAATATGACTGTTGGAGAAGAAAGTAAGCAAGAA
CAGTTGATTTTGGATCACTTACCATCTGTAACAAAGGAATCATCACTTAGAGCAACTCAACCAAGTGAAAATGATAAACTTCAGAAAGAA
CTCAATGTACTTAAATCAGAACAGGACTTGATTAGAGACCAAGGATTTCGTGGTGATGGAGGATCAACCACAGGTTTGTCTGCTACCCCC
CCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAGAAATCTCCAGGACCTCAGCGAGAAAGGAAGTCATCTTCATCCTCA
GAAGACAGGAATCGAATGAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGATTACAGTGGGACAAAGA
ATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTGAAAATGTTGAATGTGACAGCACCTACACCT
CAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAATATCCTACTCTTCATGGGCTATTCCACAAAG
CCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCATATCATTGAGACCAAATTTGAGATGATCAAA
CTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATCATCCACAGAGACCTCAAGAGTAATAATATA
TTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAG
TTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGTCAGATGTATATGCATTT
GGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGGGACCAGATAATTTTTATGGTGGGACGAGGA
TACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGAT
GAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCC
TTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAAACACCCATCCAGGCAGGGGGATATGGTGCG

>In-frame_AKAP9_ENST00000359028_chr7_91632550_+_BRAF_ENST00000288602_chr7_140487386_-_4515nt
ATGGAGGACGAGGAGAGACAGAAGAAGCTGGAGGCCGGCAAAGCCAAGATTGAAGAACTCTCTTTAGCTTTTCTTGTCAGACAGCTTGCC
CAGTTTCGACAAAGAAAAGCTCAGTCGGATGGGCAGAGTCCTTCCAAGAAGCAGAAAAAAAAGAGAAAAACGTCAAGCAGTAAACATGAT
GTGTCAGCACACCATGATTTGAATATTGATCAATCACAGTGTAATGAAATGTACATAAATAGTTCTCAGAGAGTAGAATCAACTGTGATT
CCTGAATCTACAATAATGAGAACTCTACATAGTGGAGAAATAACCAGTCATGAGCAGGGCTTCTCTGTGGAACTGGAAAGTGAAATTTCA
ACCACAGCAGATGACTGCAGTTCAGAGGTAAATGGTTGCAGTTTTGTGATGAGAACAGGAAAGCCTACAAATTTATTAAGGGAAGAAGAA
TTTGGTGTTGATGATTCTTATTCTGAACAAGGAGCACAAGACAGTCCGACTCATCTAGAGATGATGGAAAGTGAGTTGGCTGGGAAGCAG
CATGAGATTGAAGAGCTAAACAGAGAGCTGGAAGAAATGAGGGTTACCTATGGGACTGAAGGACTGCAGCAGTTACAAGAATTTGAAGCT
GCCATTAAACAAAGAGATGGCATTATAACCCAGCTCACTGCTAATTTACAACAAGCAAGAAGAGAAAAGGATGAGACAATGAGAGAATTT
TTAGAGTTGACAGAACAGAGTCAAAAATTACAGATTCAATTTCAGCAATTACAGGCTAGTGAAACTCTGAGAAACAGCACTCATAGTAGC
ACAGCTGCAGACTTACTACAAGCCAAACAACAGATCCTCACTCATCAACAGCAGCTTGAAGAACAAGACCACTTATTAGAAGATTATCAG
AAAAAGAAAGAAGACTTCACAATGCAAATTAGTTTCTTGCAAGAGAAAATTAAAGTATATGAAATGGAACAAGATAAAAAAGTAGAAAAC
TCAAATAAAGAAGAAATACAGGAAAAGGAGACAATCATTGAAGAATTAAACACAAAAATAATAGAAGAAGAAAAGAAAACTCTTGAGCTA
AAGGATAAATTAACAACTGCTGATAAATTACTAGGAGAATTACAAGAACAGATTGTGCAAAAGAACCAAGAAATAAAAAACATGAAATTA
GAGCTGACTAATTCTAAGCAAAAAGAAAGACAGTCTTCTGAAGAAATAAAACAGTTAATGGGGACAGTCGAAGAACTTCAGAAGAGAAAT
CATAAAGACAGCCAGTTCGAAACTGATATAGTACAACGAATGGAACAAGAAACACAAAGAAAGTTAGAACAACTCCGGGCAGAGCTGGAT
GAGATGTATGGGCAGCAGATAGTGCAAATGAAACAAGAATTAATAAGACAACACATGGCACAGATGGAGGAAATGAAAACACGGCATAAG
GGAGAAATGGAGAATGCTTTAAGGTCATATTCAAATATTACAGTTAATGAAGATCAGATAAAGTTAATGAATGTGGCAATAAATGAACTG
AATATAAAATTGCAAGATACTAACTCTCAAAAGGAAAAACTCAAGGAAGAACTAGGACTAATTTTAGAAGAAAAGTGTGCTCTACAGAGA
CAGCTTGAAGACCTTGTTGAAGAATTGAGCTTTTCAAGGGAACAGATTCAGAGAGCTAGACAGACAATAGCTGAACAAGAAAGTAAACTT
AATGAAGCACATAAGTCCCTTAGTACAGTGGAAGATTTGAAAGCTGAGATTGTTTCTGCATCTGAATCCAGAAAGGAACTAGAATTAAAA
CATGAAGCAGAAGTTACAAATTACAAGATAAAACTTGAAATGTTAGAAAAAGAAAAGAATGCTGTGTTAGACAGAATGGCTGAATCACAA
GAAGCTGAATTAGAGAGGCTGAGAACACAGCTTCTATTTAGTCACGAAGAAGAGCTTTCCAAACTGAAGGAAGATTTAGAAATTGAACAT
CGAATAAATATTGAAAAACTTAAAGATAATTTAGGCATTCACTATAAACAGCAGATAGATGGTTTACAGAATGAAATGAGTCAAAAGATA
GAAACCATGCAGTTTGAAAAGGACAATTTGATAACTAAGCAGAATCAATTAATTTTGGAAATTTCAAAGCTAAAAGATTTACAGCAGTCT
CTTGTAAATTCAAAGTCAGAAGAAATGACTCTTCAAATCAATGAACTTCAAAAAGAAATTGAAATACTCAGACAAGAAGAAAAAGAAAAG
GGTACACTTGAACAAGAAGTTCAAGAATTACAACTTAAAACAGAATTGTTAGAAAAACAGATGAAGGAAAAAGAGAATGATCTTCAAGAA
AAATTTGCACAACTTGAAGCAGAGAATAGCATTCTTAAAGATGAAAAGAAAACCCTTGAAGACATGTTGAAAATACATACTCCTGTTAGC
CAAGAAGAAAGATTGATTTTCTTAGACTCCATTAAGTCCAAATCCAAAGACTCTGTGTGGGAAAAAGAAATAGAAATACTTATAGAGGAA
AATGAGGACCTCAAACAACAATGTATTCAGCTAAATGAAGAGATTGAAAAGCAAAGGAACACTTTTTCATTTGCTGAAAAAAACTTTGAA
GTTAACTATCAAGAGTTACAAGAGGAGTATGCTTGCCTTCTCAAAGTAAAAGATGATTTAGAAGACAGTAAAAATAAACAGGAATTAGAG
TATAAAAGTAAACTTAAAGCACTTAATGAAGAGCTTCATTTGCAAAGAATAAATCCAACTACAGTGAAAATGAAAAGTTCTGTCTTTGAT
GAAGACAAAACTTTTGTAGCAGAAACATTGGAAATGGGTGAGGTTGTTGAAAAGGATACAACAGAACTCATGGAAAAACTTGAGGTAACC
AAGCGAGAGAAATTAGAGCTGTCACAGAGACTGTCTGATCTTTCTGAACAATTGAAACAGAAACATGGTGAGATTAGTTTTCTAAATGAA
GAAGTTAAATCTTTAAAGCAAGAGAAAGAACAAGTTTCATTGAGATGTAGAGAGCTAGAAATCATTATTAACCACAACAGGGCAGAAAAT
GTACAGTCATGTGATACTCAAGTAAGCTCTTTATTAGATGGAGTTGTGACCATGACAAGCAGGGGTGCTGAAGGATCAGTTTCTAAAGTA
AATAAAAGTTTTGGTGAAGAATCAAAAATAATGGTGGAAGATAAAGTTTCTTTTGAAAATATGACTGTTGGAGAAGAAAGTAAGCAAGAA
CAGTTGATTTTGGATCACTTACCATCTGTAACAAAGGAATCATCACTTAGAGCAACTCAACCAAGTGAAAATGATAAACTTCAGAAAGAA
CTCAATGTACTTAAATCAGAACAGGACTTGATTAGAGACCAAGGATTTCGTGGTGATGGAGGATCAACCACAGGTTTGTCTGCTACCCCC
CCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAGAAATCTCCAGGACCTCAGCGAGAAAGGAAGTCATCTTCATCCTCA
GAAGACAGGAATCGAATGAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGATTACAGTGGGACAAAGA
ATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTGAAAATGTTGAATGTGACAGCACCTACACCT
CAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAATATCCTACTCTTCATGGGCTATTCCACAAAG
CCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCATATCATTGAGACCAAATTTGAGATGATCAAA
CTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATCATCCACAGAGACCTCAAGAGTAATAATATA
TTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAG
TTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGTCAGATGTATATGCATTT
GGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGGGACCAGATAATTTTTATGGTGGGACGAGGA
TACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGAT
GAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCC
TTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAAACACCCATCCAGGCAGGGGGATATGGTGCG


* Fusion transcript sequences (Full-length transcript).
>In-frame_AKAP9_ENST00000356239_chr7_91632550_+_BRAF_ENST00000288602_chr7_140487386_-_4830nt
TACGTGGAGACGAAGATGGCGGCGGCGGCGGCGGTGACGGCGCTTCCCGTGCGGCTGAGGACGATCCGCCAGTGAGCGCGGAGACTGCTT
CCACTTCGGGCGGGGGAGCGCCGGACCGAATCGGCTCTCTAGGCCGTGGAGCTTGCCGTCCCACCTCCGTCCAAATCGACCTTTCCTTTC
TATCCCCAACCACCCCTCAACCCCTGTTTTCCCCTGCCTTCCTTGCAGAGGCCATGGAGGACGAGGAGAGACAGAAGAAGCTGGAGGCCG
GCAAAGCCAAGCTTGCCCAGTTTCGACAAAGAAAAGCTCAGTCGGATGGGCAGAGTCCTTCCAAGAAGCAGAAAAAAAAGAGAAAAACGT
CAAGCAGTAAACATGATGTGTCAGCACACCATGATTTGAATATTGATCAATCACAGTGTAATGAAATGTACATAAATAGTTCTCAGAGAG
TAGAATCAACTGTGATTCCTGAATCTACAATAATGAGAACTCTACATAGTGGAGAAATAACCAGTCATGAGCAGGGCTTCTCTGTGGAAC
TGGAAAGTGAAATTTCAACCACAGCAGATGACTGCAGTTCAGAGGTAAATGGTTGCAGTTTTGTGATGAGAACAGGAAAGCCTACAAATT
TATTAAGGGAAGAAGAATTTGGTGTTGATGATTCTTATTCTGAACAAGGAGCACAAGACAGTCCGACTCATCTAGAGATGATGGAAAGTG
AGTTGGCTGGGAAGCAGCATGAGATTGAAGAGCTAAACAGAGAGCTGGAAGAAATGAGGGTTACCTATGGGACTGAAGGACTGCAGCAGT
TACAAGAATTTGAAGCTGCCATTAAACAAAGAGATGGCATTATAACCCAGCTCACTGCTAATTTACAACAAGCAAGAAGAGAAAAGGATG
AGACAATGAGAGAATTTTTAGAGTTGACAGAACAGAGTCAAAAATTACAGATTCAATTTCAGCAATTACAGGCTAGTGAAACTCTGAGAA
ACAGCACTCATAGTAGCACAGCTGCAGACTTACTACAAGCCAAACAACAGATCCTCACTCATCAACAGCAGCTTGAAGAACAAGACCACT
TATTAGAAGATTATCAGAAAAAGAAAGAAGACTTCACAATGCAAATTAGTTTCTTGCAAGAGAAAATTAAAGTATATGAAATGGAACAAG
ATAAAAAAGTAGAAAACTCAAATAAAGAAGAAATACAGGAAAAGGAGACAATCATTGAAGAATTAAACACAAAAATAATAGAAGAAGAAA
AGAAAACTCTTGAGCTAAAGGATAAATTAACAACTGCTGATAAATTACTAGGAGAATTACAAGAACAGATTGTGCAAAAGAACCAAGAAA
TAAAAAACATGAAATTAGAGCTGACTAATTCTAAGCAAAAAGAAAGACAGTCTTCTGAAGAAATAAAACAGTTAATGGGGACAGTCGAAG
AACTTCAGAAGAGAAATCATAAAGACAGCCAGTTCGAAACTGATATAGTACAACGAATGGAACAAGAAACACAAAGAAAGTTAGAACAAC
TCCGGGCAGAGCTGGATGAGATGTATGGGCAGCAGATAGTGCAAATGAAACAAGAATTAATAAGACAACACATGGCACAGATGGAGGAAA
TGAAAACACGGCATAAGGGAGAAATGGAGAATGCTTTAAGGTCATATTCAAATATTACAGTTAATGAAGATCAGATAAAGTTAATGAATG
TGGCAATAAATGAACTGAATATAAAATTGCAAGATACTAACTCTCAAAAGGAAAAACTCAAGGAAGAACTAGGACTAATTTTAGAAGAAA
AGTGTGCTCTACAGAGACAGCTTGAAGACCTTGTTGAAGAATTGAGCTTTTCAAGGGAACAGATTCAGAGAGCTAGACAGACAATAGCTG
AACAAGAAAGTAAACTTAATGAAGCACATAAGTCCCTTAGTACAGTGGAAGATTTGAAAGCTGAGATTGTTTCTGCATCTGAATCCAGAA
AGGAACTAGAATTAAAACATGAAGCAGAAGTTACAAATTACAAGATAAAACTTGAAATGTTAGAAAAAGAAAAGAATGCTGTGTTAGACA
GAATGGCTGAATCACAAGAAGCTGAATTAGAGAGGCTGAGAACACAGCTTCTATTTAGTCACGAAGAAGAGCTTTCCAAACTGAAGGAAG
ATTTAGAAATTGAACATCGAATAAATATTGAAAAACTTAAAGATAATTTAGGCATTCACTATAAACAGCAGATAGATGGTTTACAGAATG
AAATGAGTCAAAAGATAGAAACCATGCAGTTTGAAAAGGACAATTTGATAACTAAGCAGAATCAATTAATTTTGGAAATTTCAAAGCTAA
AAGATTTACAGCAGTCTCTTGTAAATTCAAAGTCAGAAGAAATGACTCTTCAAATCAATGAACTTCAAAAAGAAATTGAAATACTCAGAC
AAGAAGAAAAAGAAAAGGGTACACTTGAACAAGAAGTTCAAGAATTACAACTTAAAACAGAATTGTTAGAAAAACAGATGAAGGAAAAAG
AGAATGATCTTCAAGAAAAATTTGCACAACTTGAAGCAGAGAATAGCATTCTTAAAGATGAAAAGAAAACCCTTGAAGACATGTTGAAAA
TACATACTCCTGTTAGCCAAGAAGAAAGATTGATTTTCTTAGACTCCATTAAGTCCAAATCCAAAGACTCTGTGTGGGAAAAAGAAATAG
AAATACTTATAGAGGAAAATGAGGACCTCAAACAACAATGTATTCAGCTAAATGAAGAGATTGAAAAGCAAAGGAACACTTTTTCATTTG
CTGAAAAAAACTTTGAAGTTAACTATCAAGAGTTACAAGAGGAGTATGCTTGCCTTCTCAAAGTAAAAGATGATTTAGAAGACAGTAAAA
ATAAACAGGAATTAGAGTATAAAAGTAAACTTAAAGCACTTAATGAAGAGCTTCATTTGCAAAGAATAAATCCAACTACAGTGAAAATGA
AAAGTTCTGTCTTTGATGAAGACAAAACTTTTGTAGCAGAAACATTGGAAATGGGTGAGGTTGTTGAAAAGGATACAACAGAACTCATGG
AAAAACTTGAGGTAACCAAGCGAGAGAAATTAGAGCTGTCACAGAGACTGTCTGATCTTTCTGAACAATTGAAACAGAAACATGGTGAGA
TTAGTTTTCTAAATGAAGAAGTTAAATCTTTAAAGCAAGAGAAAGAACAAGTTTCATTGAGATGTAGAGAGCTAGAAATCATTATTAACC
ACAACAGGGCAGAAAATGTACAGTCATGTGATACTCAAGTAAGCTCTTTATTAGATGGAGTTGTGACCATGACAAGCAGGGGTGCTGAAG
GATCAGTTTCTAAAGTAAATAAAAGTTTTGGTGAAGAATCAAAAATAATGGTGGAAGATAAAGTTTCTTTTGAAAATATGACTGTTGGAG
AAGAAAGTAAGCAAGAACAGTTGATTTTGGATCACTTACCATCTGTAACAAAGGAATCATCACTTAGAGCAACTCAACCAAGTGAAAATG
ATAAACTTCAGAAAGAACTCAATGTACTTAAATCAGAACAGGACTTGATTAGAGACCAAGGATTTCGTGGTGATGGAGGATCAACCACAG
GTTTGTCTGCTACCCCCCCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAGAAATCTCCAGGACCTCAGCGAGAAAGGA
AGTCATCTTCATCCTCAGAAGACAGGAATCGAATGAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGA
TTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTGAAAATGTTGAATG
TGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAATATCCTACTCTTCA
TGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCATATCATTGAGACCA
AATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATCATCCACAGAGACC
TCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCTCGATGGAGTGGGT
CCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGT
CAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGGGACCAGATAATTT
TTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCC
TCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCAAAAATTCACCGCA
GTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAAACACCCATCCAGG
CAGGGGGATATGGTGCGTTTCCTGTCCACTGAAACAAATGAGTGAGAGAGTTCAGGAGAGTAGCAACAAAAGGAAAATAAATGAACATAT

>In-frame_AKAP9_ENST00000358100_chr7_91632550_+_BRAF_ENST00000288602_chr7_140487386_-_4858nt
GACGAAGATGGCGGCGGCGGCGGCGGTGACGGCGCTTCCCGTGCGGCTGAGGACGATCCGCCAGTGAGCGCGGAGACTGCTTCCACTTCG
GGCGGGGGAGCGCCGGACCGAATCGGCTCTCTAGGCCGTGGAGCTTGCCGTCCCACCTCCGTCCAAATCGACCTTTCCTTTCTATCCCCA
ACCACCCCTCAACCCCTGTTTTCCCCTGCCTTCCTTGCAGAGGCCATGGAGGACGAGGAGAGACAGAAGAAGCTGGAGGCCGGCAAAGCC
AAGATTGAAGAACTCTCTTTAGCTTTTCTTGTCAGACAGCTTGCCCAGTTTCGACAAAGAAAAGCTCAGTCGGATGGGCAGAGTCCTTCC
AAGAAGCAGAAAAAAAAGAGAAAAACGTCAAGCAGTAAACATGATGTGTCAGCACACCATGATTTGAATATTGATCAATCACAGTGTAAT
GAAATGTACATAAATAGTTCTCAGAGAGTAGAATCAACTGTGATTCCTGAATCTACAATAATGAGAACTCTACATAGTGGAGAAATAACC
AGTCATGAGCAGGGCTTCTCTGTGGAACTGGAAAGTGAAATTTCAACCACAGCAGATGACTGCAGTTCAGAGGTAAATGGTTGCAGTTTT
GTGATGAGAACAGGAAAGCCTACAAATTTATTAAGGGAAGAAGAATTTGGTGTTGATGATTCTTATTCTGAACAAGGAGCACAAGACAGT
CCGACTCATCTAGAGATGATGGAAAGTGAGTTGGCTGGGAAGCAGCATGAGATTGAAGAGCTAAACAGAGAGCTGGAAGAAATGAGGGTT
ACCTATGGGACTGAAGGACTGCAGCAGTTACAAGAATTTGAAGCTGCCATTAAACAAAGAGATGGCATTATAACCCAGCTCACTGCTAAT
TTACAACAAGCAAGAAGAGAAAAGGATGAGACAATGAGAGAATTTTTAGAGTTGACAGAACAGAGTCAAAAATTACAGATTCAATTTCAG
CAATTACAGGCTAGTGAAACTCTGAGAAACAGCACTCATAGTAGCACAGCTGCAGACTTACTACAAGCCAAACAACAGATCCTCACTCAT
CAACAGCAGCTTGAAGAACAAGACCACTTATTAGAAGATTATCAGAAAAAGAAAGAAGACTTCACAATGCAAATTAGTTTCTTGCAAGAG
AAAATTAAAGTATATGAAATGGAACAAGATAAAAAAGTAGAAAACTCAAATAAAGAAGAAATACAGGAAAAGGAGACAATCATTGAAGAA
TTAAACACAAAAATAATAGAAGAAGAAAAGAAAACTCTTGAGCTAAAGGATAAATTAACAACTGCTGATAAATTACTAGGAGAATTACAA
GAACAGATTGTGCAAAAGAACCAAGAAATAAAAAACATGAAATTAGAGCTGACTAATTCTAAGCAAAAAGAAAGACAGTCTTCTGAAGAA
ATAAAACAGTTAATGGGGACAGTCGAAGAACTTCAGAAGAGAAATCATAAAGACAGCCAGTTCGAAACTGATATAGTACAACGAATGGAA
CAAGAAACACAAAGAAAGTTAGAACAACTCCGGGCAGAGCTGGATGAGATGTATGGGCAGCAGATAGTGCAAATGAAACAAGAATTAATA
AGACAACACATGGCACAGATGGAGGAAATGAAAACACGGCATAAGGGAGAAATGGAGAATGCTTTAAGGTCATATTCAAATATTACAGTT
AATGAAGATCAGATAAAGTTAATGAATGTGGCAATAAATGAACTGAATATAAAATTGCAAGATACTAACTCTCAAAAGGAAAAACTCAAG
GAAGAACTAGGACTAATTTTAGAAGAAAAGTGTGCTCTACAGAGACAGCTTGAAGACCTTGTTGAAGAATTGAGCTTTTCAAGGGAACAG
ATTCAGAGAGCTAGACAGACAATAGCTGAACAAGAAAGTAAACTTAATGAAGCACATAAGTCCCTTAGTACAGTGGAAGATTTGAAAGCT
GAGATTGTTTCTGCATCTGAATCCAGAAAGGAACTAGAATTAAAACATGAAGCAGAAGTTACAAATTACAAGATAAAACTTGAAATGTTA
GAAAAAGAAAAGAATGCTGTGTTAGACAGAATGGCTGAATCACAAGAAGCTGAATTAGAGAGGCTGAGAACACAGCTTCTATTTAGTCAC
GAAGAAGAGCTTTCCAAACTGAAGGAAGATTTAGAAATTGAACATCGAATAAATATTGAAAAACTTAAAGATAATTTAGGCATTCACTAT
AAACAGCAGATAGATGGTTTACAGAATGAAATGAGTCAAAAGATAGAAACCATGCAGTTTGAAAAGGACAATTTGATAACTAAGCAGAAT
CAATTAATTTTGGAAATTTCAAAGCTAAAAGATTTACAGCAGTCTCTTGTAAATTCAAAGTCAGAAGAAATGACTCTTCAAATCAATGAA
CTTCAAAAAGAAATTGAAATACTCAGACAAGAAGAAAAAGAAAAGGGTACACTTGAACAAGAAGTTCAAGAATTACAACTTAAAACAGAA
TTGTTAGAAAAACAGATGAAGGAAAAAGAGAATGATCTTCAAGAAAAATTTGCACAACTTGAAGCAGAGAATAGCATTCTTAAAGATGAA
AAGAAAACCCTTGAAGACATGTTGAAAATACATACTCCTGTTAGCCAAGAAGAAAGATTGATTTTCTTAGACTCCATTAAGTCCAAATCC
AAAGACTCTGTGTGGGAAAAAGAAATAGAAATACTTATAGAGGAAAATGAGGACCTCAAACAACAATGTATTCAGCTAAATGAAGAGATT
GAAAAGCAAAGGAACACTTTTTCATTTGCTGAAAAAAACTTTGAAGTTAACTATCAAGAGTTACAAGAGGAGTATGCTTGCCTTCTCAAA
GTAAAAGATGATTTAGAAGACAGTAAAAATAAACAGGAATTAGAGTATAAAAGTAAACTTAAAGCACTTAATGAAGAGCTTCATTTGCAA
AGAATAAATCCAACTACAGTGAAAATGAAAAGTTCTGTCTTTGATGAAGACAAAACTTTTGTAGCAGAAACATTGGAAATGGGTGAGGTT
GTTGAAAAGGATACAACAGAACTCATGGAAAAACTTGAGGTAACCAAGCGAGAGAAATTAGAGCTGTCACAGAGACTGTCTGATCTTTCT
GAACAATTGAAACAGAAACATGGTGAGATTAGTTTTCTAAATGAAGAAGTTAAATCTTTAAAGCAAGAGAAAGAACAAGTTTCATTGAGA
TGTAGAGAGCTAGAAATCATTATTAACCACAACAGGGCAGAAAATGTACAGTCATGTGATACTCAAGTAAGCTCTTTATTAGATGGAGTT
GTGACCATGACAAGCAGGGGTGCTGAAGGATCAGTTTCTAAAGTAAATAAAAGTTTTGGTGAAGAATCAAAAATAATGGTGGAAGATAAA
GTTTCTTTTGAAAATATGACTGTTGGAGAAGAAAGTAAGCAAGAACAGTTGATTTTGGATCACTTACCATCTGTAACAAAGGAATCATCA
CTTAGAGCAACTCAACCAAGTGAAAATGATAAACTTCAGAAAGAACTCAATGTACTTAAATCAGAACAGGACTTGATTAGAGACCAAGGA
TTTCGTGGTGATGGAGGATCAACCACAGGTTTGTCTGCTACCCCCCCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAG
AAATCTCCAGGACCTCAGCGAGAAAGGAAGTCATCTTCATCCTCAGAAGACAGGAATCGAATGAAAACACTTGGTAGACGGGACTCGAGT
GATGATTGGGAGATTCCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCAT
GGTGATGTGGCAGTGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAA
ACACGACATGTGAATATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTG
TATCACCATCTCCATATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTA
CACGCCAAGTCAATCATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTA
GCTACAGTGAAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATG
CAAGATAAAAATCCATACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCA
AACATCAACAACAGGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAA
GCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTG
GCCCGCTCATTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCT
TGTGCTTCTCCAAAAACACCCATCCAGGCAGGGGGATATGGTGCGTTTCCTGTCCACTGAAACAAATGAGTGAGAGAGTTCAGGAGAGTA

>In-frame_AKAP9_ENST00000359028_chr7_91632550_+_BRAF_ENST00000288602_chr7_140487386_-_4858nt
GACGAAGATGGCGGCGGCGGCGGCGGTGACGGCGCTTCCCGTGCGGCTGAGGACGATCCGCCAGTGAGCGCGGAGACTGCTTCCACTTCG
GGCGGGGGAGCGCCGGACCGAATCGGCTCTCTAGGCCGTGGAGCTTGCCGTCCCACCTCCGTCCAAATCGACCTTTCCTTTCTATCCCCA
ACCACCCCTCAACCCCTGTTTTCCCCTGCCTTCCTTGCAGAGGCCATGGAGGACGAGGAGAGACAGAAGAAGCTGGAGGCCGGCAAAGCC
AAGATTGAAGAACTCTCTTTAGCTTTTCTTGTCAGACAGCTTGCCCAGTTTCGACAAAGAAAAGCTCAGTCGGATGGGCAGAGTCCTTCC
AAGAAGCAGAAAAAAAAGAGAAAAACGTCAAGCAGTAAACATGATGTGTCAGCACACCATGATTTGAATATTGATCAATCACAGTGTAAT
GAAATGTACATAAATAGTTCTCAGAGAGTAGAATCAACTGTGATTCCTGAATCTACAATAATGAGAACTCTACATAGTGGAGAAATAACC
AGTCATGAGCAGGGCTTCTCTGTGGAACTGGAAAGTGAAATTTCAACCACAGCAGATGACTGCAGTTCAGAGGTAAATGGTTGCAGTTTT
GTGATGAGAACAGGAAAGCCTACAAATTTATTAAGGGAAGAAGAATTTGGTGTTGATGATTCTTATTCTGAACAAGGAGCACAAGACAGT
CCGACTCATCTAGAGATGATGGAAAGTGAGTTGGCTGGGAAGCAGCATGAGATTGAAGAGCTAAACAGAGAGCTGGAAGAAATGAGGGTT
ACCTATGGGACTGAAGGACTGCAGCAGTTACAAGAATTTGAAGCTGCCATTAAACAAAGAGATGGCATTATAACCCAGCTCACTGCTAAT
TTACAACAAGCAAGAAGAGAAAAGGATGAGACAATGAGAGAATTTTTAGAGTTGACAGAACAGAGTCAAAAATTACAGATTCAATTTCAG
CAATTACAGGCTAGTGAAACTCTGAGAAACAGCACTCATAGTAGCACAGCTGCAGACTTACTACAAGCCAAACAACAGATCCTCACTCAT
CAACAGCAGCTTGAAGAACAAGACCACTTATTAGAAGATTATCAGAAAAAGAAAGAAGACTTCACAATGCAAATTAGTTTCTTGCAAGAG
AAAATTAAAGTATATGAAATGGAACAAGATAAAAAAGTAGAAAACTCAAATAAAGAAGAAATACAGGAAAAGGAGACAATCATTGAAGAA
TTAAACACAAAAATAATAGAAGAAGAAAAGAAAACTCTTGAGCTAAAGGATAAATTAACAACTGCTGATAAATTACTAGGAGAATTACAA
GAACAGATTGTGCAAAAGAACCAAGAAATAAAAAACATGAAATTAGAGCTGACTAATTCTAAGCAAAAAGAAAGACAGTCTTCTGAAGAA
ATAAAACAGTTAATGGGGACAGTCGAAGAACTTCAGAAGAGAAATCATAAAGACAGCCAGTTCGAAACTGATATAGTACAACGAATGGAA
CAAGAAACACAAAGAAAGTTAGAACAACTCCGGGCAGAGCTGGATGAGATGTATGGGCAGCAGATAGTGCAAATGAAACAAGAATTAATA
AGACAACACATGGCACAGATGGAGGAAATGAAAACACGGCATAAGGGAGAAATGGAGAATGCTTTAAGGTCATATTCAAATATTACAGTT
AATGAAGATCAGATAAAGTTAATGAATGTGGCAATAAATGAACTGAATATAAAATTGCAAGATACTAACTCTCAAAAGGAAAAACTCAAG
GAAGAACTAGGACTAATTTTAGAAGAAAAGTGTGCTCTACAGAGACAGCTTGAAGACCTTGTTGAAGAATTGAGCTTTTCAAGGGAACAG
ATTCAGAGAGCTAGACAGACAATAGCTGAACAAGAAAGTAAACTTAATGAAGCACATAAGTCCCTTAGTACAGTGGAAGATTTGAAAGCT
GAGATTGTTTCTGCATCTGAATCCAGAAAGGAACTAGAATTAAAACATGAAGCAGAAGTTACAAATTACAAGATAAAACTTGAAATGTTA
GAAAAAGAAAAGAATGCTGTGTTAGACAGAATGGCTGAATCACAAGAAGCTGAATTAGAGAGGCTGAGAACACAGCTTCTATTTAGTCAC
GAAGAAGAGCTTTCCAAACTGAAGGAAGATTTAGAAATTGAACATCGAATAAATATTGAAAAACTTAAAGATAATTTAGGCATTCACTAT
AAACAGCAGATAGATGGTTTACAGAATGAAATGAGTCAAAAGATAGAAACCATGCAGTTTGAAAAGGACAATTTGATAACTAAGCAGAAT
CAATTAATTTTGGAAATTTCAAAGCTAAAAGATTTACAGCAGTCTCTTGTAAATTCAAAGTCAGAAGAAATGACTCTTCAAATCAATGAA
CTTCAAAAAGAAATTGAAATACTCAGACAAGAAGAAAAAGAAAAGGGTACACTTGAACAAGAAGTTCAAGAATTACAACTTAAAACAGAA
TTGTTAGAAAAACAGATGAAGGAAAAAGAGAATGATCTTCAAGAAAAATTTGCACAACTTGAAGCAGAGAATAGCATTCTTAAAGATGAA
AAGAAAACCCTTGAAGACATGTTGAAAATACATACTCCTGTTAGCCAAGAAGAAAGATTGATTTTCTTAGACTCCATTAAGTCCAAATCC
AAAGACTCTGTGTGGGAAAAAGAAATAGAAATACTTATAGAGGAAAATGAGGACCTCAAACAACAATGTATTCAGCTAAATGAAGAGATT
GAAAAGCAAAGGAACACTTTTTCATTTGCTGAAAAAAACTTTGAAGTTAACTATCAAGAGTTACAAGAGGAGTATGCTTGCCTTCTCAAA
GTAAAAGATGATTTAGAAGACAGTAAAAATAAACAGGAATTAGAGTATAAAAGTAAACTTAAAGCACTTAATGAAGAGCTTCATTTGCAA
AGAATAAATCCAACTACAGTGAAAATGAAAAGTTCTGTCTTTGATGAAGACAAAACTTTTGTAGCAGAAACATTGGAAATGGGTGAGGTT
GTTGAAAAGGATACAACAGAACTCATGGAAAAACTTGAGGTAACCAAGCGAGAGAAATTAGAGCTGTCACAGAGACTGTCTGATCTTTCT
GAACAATTGAAACAGAAACATGGTGAGATTAGTTTTCTAAATGAAGAAGTTAAATCTTTAAAGCAAGAGAAAGAACAAGTTTCATTGAGA
TGTAGAGAGCTAGAAATCATTATTAACCACAACAGGGCAGAAAATGTACAGTCATGTGATACTCAAGTAAGCTCTTTATTAGATGGAGTT
GTGACCATGACAAGCAGGGGTGCTGAAGGATCAGTTTCTAAAGTAAATAAAAGTTTTGGTGAAGAATCAAAAATAATGGTGGAAGATAAA
GTTTCTTTTGAAAATATGACTGTTGGAGAAGAAAGTAAGCAAGAACAGTTGATTTTGGATCACTTACCATCTGTAACAAAGGAATCATCA
CTTAGAGCAACTCAACCAAGTGAAAATGATAAACTTCAGAAAGAACTCAATGTACTTAAATCAGAACAGGACTTGATTAGAGACCAAGGA
TTTCGTGGTGATGGAGGATCAACCACAGGTTTGTCTGCTACCCCCCCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAG
AAATCTCCAGGACCTCAGCGAGAAAGGAAGTCATCTTCATCCTCAGAAGACAGGAATCGAATGAAAACACTTGGTAGACGGGACTCGAGT
GATGATTGGGAGATTCCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCAT
GGTGATGTGGCAGTGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAA
ACACGACATGTGAATATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTG
TATCACCATCTCCATATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTA
CACGCCAAGTCAATCATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTA
GCTACAGTGAAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATG
CAAGATAAAAATCCATACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCA
AACATCAACAACAGGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAA
GCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTG
GCCCGCTCATTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCT
TGTGCTTCTCCAAAAACACCCATCCAGGCAGGGGGATATGGTGCGTTTCCTGTCCACTGAAACAAATGAGTGAGAGAGTTCAGGAGAGTA


Top

FusionGenePPI for AKAP9_BRAF


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AKAP9TACC3, FNBP1, TRIP10, PRKAR2A, KCNQ1, CLIC1, CALM2, CALM1, TUBGCP3, PKN1, CSNK1D, PMS1, CDC5L, DISC1, TNIK, CEBPA, CCNE1, TSG101, CDK5RAP2, KDM1A, TDP2, PCNT, GSK3A, RASSF2, SUV39H2, PRKACA, PRKACB, MAGEA6, HNRNPM, SSX2, BLZF1, USO1, MAGED1, IKZF3, WAC, THAP1, PRDM14, USHBP1, C1orf94, SAMD3, SUZ12, RNF2, BMI1, ROPN1L, MAPRE1, CEP170, CCDC68, PRKAR2B, HERC2, GPC4, DYNLL1, HUWE1, FGFR1OP, THOC2, CEP170P1, PCGF1, NANOG, ATOH1, TPTE2, PDE4DIP, PRKACG, C1orf87, DNAJC10, BIRC6, TPM2, HEY1BRAFYWHAB, YWHAG, YWHAQ, YWHAZ, SFN, HRAS, AKT1, MAPK3, RAP1GAP, RAF1, MRAS, RAP1A, PAK2, TERF1, CCDC88A, NEDD4L, MAP2K1, RNF149, KSR1, BRAP, PRKCE, RPS6KB2, HSP90AA1, BRAF, YWHAE, HSPA5, MAP2K2, HSPA1A, HSPA8, YWHAH, HSPA9, ARAF, CDC37, HSP90AB1, PHKB, LIMK1, IQGAP1, MAPK1, BAD, LIPF, MUS81, FBXW7, FGFR2, BRCA2, VHL, FNTA, HDAC2, PIK3CA, EGFR, PTEN, FNIP1, FNIP2, RAB3GAP1, KRAS, KIAA0141, FKBPL, ARMCX3, KCNC4, RPTOR, CYLD, NRAS


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AKAP9_BRAF


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneBRAFP15056DB08881VemurafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved
TgeneBRAFP15056DB08896RegorafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved
TgeneBRAFP15056DB00398SorafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved|investigational
TgeneBRAFP15056DB08912DabrafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved|investigational

Top

RelatedDiseases for AKAP9_BRAF


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneAKAP9C0037274Dermatologic disorders1CTD_human
HgeneAKAP9C0311375Arsenic Poisoning1CTD_human
HgeneAKAP9C2678483Long Qt Syndrome 111CTD_human;UNIPROT
TgeneBRAFC0025202melanoma21CTD_human
TgeneBRAFC1527249Colorectal Cancer8UNIPROT
TgeneBRAFC1275081Cardio-facio-cutaneous syndrome6CTD_human;ORPHANET;UNIPROT
TgeneBRAFC0009404Colorectal Neoplasms4CTD_human
TgeneBRAFC0040136Thyroid Neoplasm4CTD_human
TgeneBRAFC0024305Lymphoma, Non-Hodgkin3UNIPROT
TgeneBRAFC0684249Carcinoma of lung3UNIPROT
TgeneBRAFC3150970NOONAN SYNDROME 73CTD_human;UNIPROT
TgeneBRAFC0152013Adenocarcinoma of lung (disorder)2CTD_human
TgeneBRAFC0002448Ameloblastoma1CTD_human
TgeneBRAFC0004114Astrocytoma1CTD_human
TgeneBRAFC0010276Craniopharyngioma1CTD_human;ORPHANET
TgeneBRAFC0017638Glioma1CTD_human
TgeneBRAFC0022665Kidney Neoplasm1CTD_human
TgeneBRAFC0023903Liver neoplasms1CTD_human
TgeneBRAFC0024694Mandibular Neoplasms1CTD_human
TgeneBRAFC0028326Noonan Syndrome1CTD_human;ORPHANET
TgeneBRAFC0033578Prostatic Neoplasms1CTD_human
TgeneBRAFC0036920Sezary Syndrome1CTD_human
TgeneBRAFC0079773Lymphoma, T-Cell, Cutaneous1CTD_human
TgeneBRAFC0206686Adrenocortical carcinoma1CTD_human
TgeneBRAFC0206754Neuroendocrine Tumors1CTD_human
TgeneBRAFC0238463Papillary thyroid carcinoma1CTD_human;ORPHANET
TgeneBRAFC0587248Costello syndrome (disorder)1CTD_human
TgeneBRAFC0596263Carcinogenesis1CTD_human
TgeneBRAFC0920269Microsatellite Instability1CTD_human
TgeneBRAFC2239176Liver carcinoma1CTD_human