FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13578

FusionGeneSummary for FLNB_SLMAP

check button Fusion gene summary
Fusion gene informationFusion gene name: FLNB_SLMAP
Fusion gene ID: 13578
HgeneTgene
Gene symbol

FLNB

SLMAP

Gene ID

2317

7871

Gene namefilamin Bsarcolemma associated protein
SynonymsABP-278|ABP-280|AOI|FH1|FLN-B|FLN1L|LRS1|SCT|TABP|TAPSLAP
Cytomap

3p14.3

3p14.3

Type of geneprotein-codingprotein-coding
Descriptionfilamin-BABP-280 homologLarsen syndrome 1 (autosomal dominant)actin binding protein 278actin-binding-like proteinbeta-filaminfilamin B, betafilamin homolog 1filamin-3thyroid autoantigensarcolemmal membrane-associated protein
Modification date2018052220180522
UniProtAcc

O75369

Q14BN4

Ensembl transtripts involved in fusion geneENST00000490882, ENST00000429972, 
ENST00000295956, ENST00000358537, 
ENST00000357272, ENST00000348383, 
ENST00000493452, ENST00000419752, 
ENST00000484981, 
ENST00000295951, 
ENST00000416870, ENST00000295952, 
ENST00000383718, ENST00000428312, 
ENST00000449503, ENST00000472546, 
ENST00000442599, ENST00000495364, 
ENST00000494088, 
Fusion gene scores* DoF score8 X 11 X 8=7044 X 9 X 8=288
# samples 179
** MAII scorelog2(17/704*10)=-2.0500406824996
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/288*10)=-1.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FLNB [Title/Abstract] AND SLMAP [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-4Z-AA7Q-01AFLNBchr3

57994583

+SLMAPchr3

57908616

+
TCGARVBRCATCGA-A8-A07C-01AFLNBchr3

57994583

+SLMAPchr3

57898108

+
TCGARVCESCTCGA-EA-A556-01AFLNBchr3

57994583

+SLMAPchr3

57902633

+
TCGARVESCATCGA-R6-A8W5-01BFLNBchr3

57994583

+SLMAPchr3

57875768

+
TCGARVLIHCTCGA-XR-A8TG-01AFLNBchr3

57994583

+SLMAPchr3

57913023

+
TCGARVPAADTCGA-LB-A7SX-01AFLNBchr3

58095897

+SLMAPchr3

57843460

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000490882ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000490882ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000490882ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000490882ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000490882ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000490882ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000490882ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000490882ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000490882ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000490882ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57908616

+
Frame-shiftENST00000429972ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000429972ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000429972ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000429972ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000429972ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000429972ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000429972ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000429972ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000429972ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000429972ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57908616

+
Frame-shiftENST00000295956ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000295956ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000295956ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000295956ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000295956ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000295956ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000295956ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000295956ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000295956ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000295956ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57908616

+
Frame-shiftENST00000358537ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000358537ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000358537ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000358537ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000358537ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000358537ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000358537ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000358537ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000358537ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000358537ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57908616

+
Frame-shiftENST00000357272ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000357272ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000357272ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000357272ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000357272ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000357272ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000357272ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000357272ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000357272ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000357272ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57908616

+
Frame-shiftENST00000348383ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000348383ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000348383ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000348383ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000348383ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000348383ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000348383ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000348383ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000348383ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57908616

+
5CDS-intronENST00000348383ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-3CDSENST00000493452ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000493452ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000493452ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000493452ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000493452ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000493452ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000493452ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000493452ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000493452ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000493452ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-3CDSENST00000419752ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000419752ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000419752ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000419752ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000419752ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000419752ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000419752ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000419752ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000419752ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000419752ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-3CDSENST00000484981ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000484981ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000484981ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000484981ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000484981ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000484981ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000484981ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000484981ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000484981ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57908616

+
intron-intronENST00000484981ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57908616

+
In-frameENST00000490882ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000490882ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000490882ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000490882ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000490882ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000490882ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000490882ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000490882ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000490882ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000490882ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000429972ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000429972ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000429972ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000429972ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000429972ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000429972ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000429972ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000429972ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000429972ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000429972ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000295956ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000295956ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000295956ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000295956ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000295956ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000295956ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000295956ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000295956ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000295956ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000295956ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000358537ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000358537ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000358537ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000358537ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000358537ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000358537ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000358537ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000358537ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000358537ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000358537ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000357272ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000357272ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000357272ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000357272ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000357272ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000357272ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000357272ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000357272ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000357272ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000357272ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000348383ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000348383ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57898108

+
In-frameENST00000348383ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000348383ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000348383ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-intronENST00000348383ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000348383ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000348383ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000348383ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57898108

+
5CDS-3UTRENST00000348383ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3CDSENST00000493452ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3CDSENST00000493452ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3CDSENST00000493452ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-intronENST00000493452ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-intronENST00000493452ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-intronENST00000493452ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3UTRENST00000493452ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3UTRENST00000493452ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3UTRENST00000493452ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3UTRENST00000493452ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3CDSENST00000419752ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3CDSENST00000419752ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3CDSENST00000419752ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-intronENST00000419752ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-intronENST00000419752ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-intronENST00000419752ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3UTRENST00000419752ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3UTRENST00000419752ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3UTRENST00000419752ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3UTRENST00000419752ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3CDSENST00000484981ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3CDSENST00000484981ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3CDSENST00000484981ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-intronENST00000484981ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-intronENST00000484981ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-intronENST00000484981ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3UTRENST00000484981ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3UTRENST00000484981ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3UTRENST00000484981ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57898108

+
intron-3UTRENST00000484981ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57898108

+
Frame-shiftENST00000490882ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000490882ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000490882ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000490882ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000490882ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000490882ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000490882ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000490882ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000490882ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000490882ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000429972ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000429972ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000429972ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000429972ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000429972ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000429972ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000429972ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000429972ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000429972ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000429972ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000295956ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000295956ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000295956ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000295956ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000295956ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000295956ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000295956ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000295956ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000295956ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000295956ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000358537ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000358537ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000358537ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000358537ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000358537ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000358537ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000358537ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000358537ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000358537ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000358537ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000357272ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000357272ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000357272ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000357272ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000357272ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000357272ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000357272ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000357272ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000357272ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000357272ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000348383ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000348383ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57902633

+
Frame-shiftENST00000348383ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000348383ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000348383ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000348383ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000348383ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000348383ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000348383ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57902633

+
5CDS-intronENST00000348383ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-3CDSENST00000493452ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-3CDSENST00000493452ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-3CDSENST00000493452ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000493452ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000493452ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000493452ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000493452ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000493452ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000493452ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000493452ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-3CDSENST00000419752ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-3CDSENST00000419752ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-3CDSENST00000419752ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000419752ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000419752ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000419752ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000419752ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000419752ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000419752ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000419752ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-3CDSENST00000484981ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-3CDSENST00000484981ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-3CDSENST00000484981ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000484981ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000484981ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000484981ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000484981ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000484981ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000484981ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57902633

+
intron-intronENST00000484981ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57902633

+
In-frameENST00000490882ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000490882ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000490882ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000490882ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000490882ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000490882ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-3UTRENST00000490882ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000490882ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-intronENST00000490882ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-intronENST00000490882ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57875768

+
In-frameENST00000429972ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000429972ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000429972ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000429972ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000429972ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000429972ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-3UTRENST00000429972ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000429972ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-intronENST00000429972ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-intronENST00000429972ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57875768

+
In-frameENST00000295956ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000295956ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000295956ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000295956ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000295956ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000295956ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-3UTRENST00000295956ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000295956ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-intronENST00000295956ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-intronENST00000295956ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57875768

+
In-frameENST00000358537ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000358537ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000358537ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000358537ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000358537ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000358537ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-3UTRENST00000358537ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000358537ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-intronENST00000358537ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-intronENST00000358537ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57875768

+
In-frameENST00000357272ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000357272ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000357272ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000357272ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000357272ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000357272ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-3UTRENST00000357272ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000357272ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-intronENST00000357272ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-intronENST00000357272ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57875768

+
In-frameENST00000348383ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000348383ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000348383ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000348383ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000348383ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000348383ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-3UTRENST00000348383ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-5UTRENST00000348383ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-intronENST00000348383ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57875768

+
5CDS-intronENST00000348383ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-3CDSENST00000493452ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000493452ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000493452ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000493452ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000493452ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000493452ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-3UTRENST00000493452ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000493452ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-intronENST00000493452ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-intronENST00000493452ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-3CDSENST00000419752ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000419752ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000419752ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000419752ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000419752ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000419752ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-3UTRENST00000419752ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000419752ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-intronENST00000419752ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-intronENST00000419752ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-3CDSENST00000484981ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000484981ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000484981ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000484981ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000484981ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000484981ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-3UTRENST00000484981ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-5UTRENST00000484981ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-intronENST00000484981ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57875768

+
intron-intronENST00000484981ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57875768

+
Frame-shiftENST00000490882ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000490882ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000490882ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000490882ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000490882ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000490882ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000490882ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000490882ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000490882ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-3UTRENST00000490882ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57913023

+
Frame-shiftENST00000429972ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000429972ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000429972ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000429972ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000429972ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000429972ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000429972ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000429972ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000429972ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-3UTRENST00000429972ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57913023

+
Frame-shiftENST00000295956ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000295956ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000295956ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000295956ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000295956ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000295956ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000295956ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000295956ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000295956ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-3UTRENST00000295956ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57913023

+
Frame-shiftENST00000358537ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000358537ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000358537ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000358537ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000358537ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000358537ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000358537ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000358537ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000358537ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-3UTRENST00000358537ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57913023

+
Frame-shiftENST00000357272ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000357272ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000357272ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000357272ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000357272ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000357272ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000357272ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000357272ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000357272ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-3UTRENST00000357272ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57913023

+
Frame-shiftENST00000348383ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000348383ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000348383ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000348383ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000348383ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000348383ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000348383ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000348383ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-intronENST00000348383ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57913023

+
5CDS-3UTRENST00000348383ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-3CDSENST00000493452ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000493452ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000493452ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000493452ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000493452ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000493452ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000493452ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000493452ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000493452ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-3UTRENST00000493452ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-3CDSENST00000419752ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000419752ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000419752ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000419752ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000419752ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000419752ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000419752ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000419752ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000419752ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-3UTRENST00000419752ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-3CDSENST00000484981ENST00000295951FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000484981ENST00000416870FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000484981ENST00000295952FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000484981ENST00000383718FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000484981ENST00000428312FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000484981ENST00000449503FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000484981ENST00000472546FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000484981ENST00000442599FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-intronENST00000484981ENST00000495364FLNBchr3

57994583

+SLMAPchr3

57913023

+
intron-3UTRENST00000484981ENST00000494088FLNBchr3

57994583

+SLMAPchr3

57913023

+
In-frameENST00000490882ENST00000295951FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000490882ENST00000416870FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000490882ENST00000295952FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000490882ENST00000383718FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000490882ENST00000428312FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000490882ENST00000449503FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000490882ENST00000472546FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000490882ENST00000442599FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000490882ENST00000495364FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000490882ENST00000494088FLNBchr3

58095897

+SLMAPchr3

57843460

+
In-frameENST00000429972ENST00000295951FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000429972ENST00000416870FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000429972ENST00000295952FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000429972ENST00000383718FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000429972ENST00000428312FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000429972ENST00000449503FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000429972ENST00000472546FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000429972ENST00000442599FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000429972ENST00000495364FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000429972ENST00000494088FLNBchr3

58095897

+SLMAPchr3

57843460

+
In-frameENST00000295956ENST00000295951FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000295956ENST00000416870FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000295956ENST00000295952FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000295956ENST00000383718FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000295956ENST00000428312FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000295956ENST00000449503FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000295956ENST00000472546FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000295956ENST00000442599FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000295956ENST00000495364FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000295956ENST00000494088FLNBchr3

58095897

+SLMAPchr3

57843460

+
In-frameENST00000358537ENST00000295951FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000358537ENST00000416870FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000358537ENST00000295952FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000358537ENST00000383718FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000358537ENST00000428312FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000358537ENST00000449503FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000358537ENST00000472546FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000358537ENST00000442599FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000358537ENST00000495364FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000358537ENST00000494088FLNBchr3

58095897

+SLMAPchr3

57843460

+
In-frameENST00000357272ENST00000295951FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000357272ENST00000416870FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000357272ENST00000295952FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000357272ENST00000383718FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000357272ENST00000428312FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000357272ENST00000449503FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000357272ENST00000472546FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000357272ENST00000442599FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000357272ENST00000495364FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000357272ENST00000494088FLNBchr3

58095897

+SLMAPchr3

57843460

+
In-frameENST00000348383ENST00000295951FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000348383ENST00000416870FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000348383ENST00000295952FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000348383ENST00000383718FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000348383ENST00000428312FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000348383ENST00000449503FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000348383ENST00000472546FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000348383ENST00000442599FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000348383ENST00000495364FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000348383ENST00000494088FLNBchr3

58095897

+SLMAPchr3

57843460

+
In-frameENST00000493452ENST00000295951FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000493452ENST00000416870FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000493452ENST00000295952FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000493452ENST00000383718FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000493452ENST00000428312FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000493452ENST00000449503FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000493452ENST00000472546FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000493452ENST00000442599FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000493452ENST00000495364FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000493452ENST00000494088FLNBchr3

58095897

+SLMAPchr3

57843460

+
In-frameENST00000419752ENST00000295951FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000419752ENST00000416870FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000419752ENST00000295952FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000419752ENST00000383718FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000419752ENST00000428312FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-5UTRENST00000419752ENST00000449503FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000419752ENST00000472546FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000419752ENST00000442599FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000419752ENST00000495364FLNBchr3

58095897

+SLMAPchr3

57843460

+
5CDS-intronENST00000419752ENST00000494088FLNBchr3

58095897

+SLMAPchr3

57843460

+
intron-3CDSENST00000484981ENST00000295951FLNBchr3

58095897

+SLMAPchr3

57843460

+
intron-5UTRENST00000484981ENST00000416870FLNBchr3

58095897

+SLMAPchr3

57843460

+
intron-5UTRENST00000484981ENST00000295952FLNBchr3

58095897

+SLMAPchr3

57843460

+
intron-5UTRENST00000484981ENST00000383718FLNBchr3

58095897

+SLMAPchr3

57843460

+
intron-5UTRENST00000484981ENST00000428312FLNBchr3

58095897

+SLMAPchr3

57843460

+
intron-5UTRENST00000484981ENST00000449503FLNBchr3

58095897

+SLMAPchr3

57843460

+
intron-intronENST00000484981ENST00000472546FLNBchr3

58095897

+SLMAPchr3

57843460

+
intron-intronENST00000484981ENST00000442599FLNBchr3

58095897

+SLMAPchr3

57843460

+
intron-intronENST00000484981ENST00000495364FLNBchr3

58095897

+SLMAPchr3

57843460

+
intron-intronENST00000484981ENST00000494088FLNBchr3

58095897

+SLMAPchr3

57843460

+

Top

FusionProtFeatures for FLNB_SLMAP


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FLNB

O75369

SLMAP

Q14BN4


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+1646139_2428282603DomainCalponin-homology (CH) 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+164616_1228282603DomainCalponin-homology (CH) 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+1645139_2428282562DomainCalponin-homology (CH) 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+164516_1228282562DomainCalponin-homology (CH) 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+1647139_2428282603DomainCalponin-homology (CH) 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+164716_1228282603DomainCalponin-homology (CH) 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+1645139_2428282579DomainCalponin-homology (CH) 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+164516_1228282579DomainCalponin-homology (CH) 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+1545139_2426592423DomainCalponin-homology (CH) 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+154516_1226592423DomainCalponin-homology (CH) 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+1646139_2428282592DomainCalponin-homology (CH) 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+164616_1228282592DomainCalponin-homology (CH) 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+1647139_2428282634DomainCalponin-homology (CH) 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+164716_1228282634DomainCalponin-homology (CH) 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16461_2398282603RegionNote=Actin-binding
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16451_2398282562RegionNote=Actin-binding
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16471_2398282603RegionNote=Actin-binding
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16451_2398282579RegionNote=Actin-binding
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15451_2396592423RegionNote=Actin-binding
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16461_2398282592RegionNote=Actin-binding
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16471_2398282634RegionNote=Actin-binding
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+1646249_3478282603RepeatNote=Filamin 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+1646349_4468282603RepeatNote=Filamin 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+1646447_5438282603RepeatNote=Filamin 3
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+1646544_6368282603RepeatNote=Filamin 4
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+1646640_7368282603RepeatNote=Filamin 5
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+1645249_3478282562RepeatNote=Filamin 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+1645349_4468282562RepeatNote=Filamin 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+1645447_5438282562RepeatNote=Filamin 3
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+1645544_6368282562RepeatNote=Filamin 4
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+1645640_7368282562RepeatNote=Filamin 5
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+1647249_3478282603RepeatNote=Filamin 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+1647349_4468282603RepeatNote=Filamin 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+1647447_5438282603RepeatNote=Filamin 3
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+1647544_6368282603RepeatNote=Filamin 4
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+1647640_7368282603RepeatNote=Filamin 5
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+1645249_3478282579RepeatNote=Filamin 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+1645349_4468282579RepeatNote=Filamin 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+1645447_5438282579RepeatNote=Filamin 3
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+1645544_6368282579RepeatNote=Filamin 4
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+1645640_7368282579RepeatNote=Filamin 5
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+1545249_3476592423RepeatNote=Filamin 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+1545349_4466592423RepeatNote=Filamin 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+1545447_5436592423RepeatNote=Filamin 3
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+1545544_6366592423RepeatNote=Filamin 4
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+1646249_3478282592RepeatNote=Filamin 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+1646349_4468282592RepeatNote=Filamin 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+1646447_5438282592RepeatNote=Filamin 3
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+1646544_6368282592RepeatNote=Filamin 4
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+1646640_7368282592RepeatNote=Filamin 5
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+1647249_3478282634RepeatNote=Filamin 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+1647349_4468282634RepeatNote=Filamin 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+1647447_5438282634RepeatNote=Filamin 3
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+1647544_6368282634RepeatNote=Filamin 4
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+1647640_7368282634RepeatNote=Filamin 5
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295951+1122477_799399812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295952+1021477_799399812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000383718+1115477_799412507Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000416870+1018167_202-50272Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000416870+1018230_388-50272Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000416870+1018477_799-50272Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000428312+1122477_799416829Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000449503+920477_799378791Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000383718+015167_202-33507Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000383718+015230_388-33507Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000383718+015477_799-33507Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000416870+1418167_20242272Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000416870+1418230_38842272Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000416870+1418477_79942272Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295951+522230_388173812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295951+522477_799173812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295952+421230_388173812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295952+421477_799173812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000383718+415230_388173507Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000383718+415477_799173507Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000416870+418167_202-276272Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000416870+418230_388-276272Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000416870+418477_799-276272Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000428312+422230_388173829Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000428312+422477_799173829Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000449503+420230_388173791Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000449503+420477_799173791Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000416870+101828_85-50272DomainFHA
TgeneSLMAPchr3:57994583chr3:57898108ENST00000383718+01528_85-33507DomainFHA
TgeneSLMAPchr3:58095897chr3:57843460ENST00000416870+41828_85-276272DomainFHA
TgeneSLMAPchr3:57994583chr3:57875768ENST00000416870+10181_163-50272RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:57994583chr3:57898108ENST00000383718+0151_163-33507RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:58095897chr3:57843460ENST00000416870+4181_163-276272RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295951+1122824_828399812Topological domainExtracellular
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295952+1021824_828399812Topological domainExtracellular
TgeneSLMAPchr3:57994583chr3:57875768ENST00000383718+1115824_828412507Topological domainExtracellular
TgeneSLMAPchr3:57994583chr3:57875768ENST00000416870+10181_802-50272Topological domainCytoplasmic
TgeneSLMAPchr3:57994583chr3:57875768ENST00000416870+1018824_828-50272Topological domainExtracellular
TgeneSLMAPchr3:57994583chr3:57875768ENST00000428312+1122824_828416829Topological domainExtracellular
TgeneSLMAPchr3:57994583chr3:57875768ENST00000449503+920824_828378791Topological domainExtracellular
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295951+1622824_828532812Topological domainExtracellular
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295952+1521824_828532812Topological domainExtracellular
TgeneSLMAPchr3:57994583chr3:57898108ENST00000383718+0151_802-33507Topological domainCytoplasmic
TgeneSLMAPchr3:57994583chr3:57898108ENST00000383718+015824_828-33507Topological domainExtracellular
TgeneSLMAPchr3:57994583chr3:57898108ENST00000416870+1418824_82842272Topological domainExtracellular
TgeneSLMAPchr3:57994583chr3:57898108ENST00000428312+1622824_828549829Topological domainExtracellular
TgeneSLMAPchr3:57994583chr3:57898108ENST00000449503+1420824_828511791Topological domainExtracellular
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295951+522824_828173812Topological domainExtracellular
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295952+421824_828173812Topological domainExtracellular
TgeneSLMAPchr3:58095897chr3:57843460ENST00000383718+415824_828173507Topological domainExtracellular
TgeneSLMAPchr3:58095897chr3:57843460ENST00000416870+4181_802-276272Topological domainCytoplasmic
TgeneSLMAPchr3:58095897chr3:57843460ENST00000416870+418824_828-276272Topological domainExtracellular
TgeneSLMAPchr3:58095897chr3:57843460ENST00000428312+422824_828173829Topological domainExtracellular
TgeneSLMAPchr3:58095897chr3:57843460ENST00000449503+420824_828173791Topological domainExtracellular
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295951+1122803_823399812TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295952+1021803_823399812TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:57994583chr3:57875768ENST00000383718+1115803_823412507TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:57994583chr3:57875768ENST00000416870+1018803_823-50272TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:57994583chr3:57875768ENST00000428312+1122803_823416829TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:57994583chr3:57875768ENST00000449503+920803_823378791TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295951+1622803_823532812TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295952+1521803_823532812TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:57994583chr3:57898108ENST00000383718+015803_823-33507TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:57994583chr3:57898108ENST00000416870+1418803_82342272TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:57994583chr3:57898108ENST00000428312+1622803_823549829TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:57994583chr3:57898108ENST00000449503+1420803_823511791TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295951+522803_823173812TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295952+421803_823173812TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:58095897chr3:57843460ENST00000383718+415803_823173507TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:58095897chr3:57843460ENST00000416870+418803_823-276272TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:58095897chr3:57843460ENST00000428312+422803_823173829TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneSLMAPchr3:58095897chr3:57843460ENST00000449503+420803_823173791TransmembraneHelical%3B Anchor for type IV membrane protein

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+146139_242972603DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+14616_122972603DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+145139_242972562DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+14516_122972562DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+147139_242972603DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+14716_122972603DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+145139_242972579DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+14516_122972579DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+145139_24202423DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+14516_12202423DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+146139_242972592DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+14616_122972592DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+147139_242972634DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+14716_122972634DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+146139_242972603DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+14616_122972603DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+145139_242972562DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+14516_122972562DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+147139_242972603DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+14716_122972603DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+145139_242972579DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+14516_122972579DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+145139_24202423DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+14516_12202423DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+146139_242972592DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+14616_122972592DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+147139_242972634DomainCalponin-homology (CH) 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+14716_122972634DomainCalponin-homology (CH) 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1461705_1728972603RegionHinge 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1461_239972603RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1462472_2506972603RegionHinge 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1462472_2602972603RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1451705_1728972562RegionHinge 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1451_239972562RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1452472_2506972562RegionHinge 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1452472_2602972562RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1471705_1728972603RegionHinge 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1471_239972603RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1472472_2506972603RegionHinge 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1472472_2602972603RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1451705_1728972579RegionHinge 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1451_239972579RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1452472_2506972579RegionHinge 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1452472_2602972579RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1451705_172802423RegionHinge 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1451_23902423RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1452472_250602423RegionHinge 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1452472_260202423RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1461705_1728972592RegionHinge 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1461_239972592RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1462472_2506972592RegionHinge 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1462472_2602972592RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1471705_1728972634RegionHinge 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1471_239972634RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1472472_2506972634RegionHinge 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1472472_2602972634RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1461705_1728972603RegionHinge 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1461_239972603RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1462472_2506972603RegionHinge 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1462472_2602972603RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1451705_1728972562RegionHinge 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1451_239972562RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1452472_2506972562RegionHinge 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1452472_2602972562RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1471705_1728972603RegionHinge 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1471_239972603RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1472472_2506972603RegionHinge 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1472472_2602972603RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1451705_1728972579RegionHinge 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1451_239972579RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1452472_2506972579RegionHinge 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1452472_2602972579RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1451705_172802423RegionHinge 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1451_23902423RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1452472_250602423RegionHinge 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1452472_260202423RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1461705_1728972592RegionHinge 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1461_239972592RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1462472_2506972592RegionHinge 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1462472_2602972592RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1471705_1728972634RegionHinge 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1471_239972634RegionNote=Actin-binding
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1472472_2506972634RegionHinge 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1472472_2602972634RegionSelf-association site%2C tail
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16461705_17288282603RegionHinge 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16462472_25068282603RegionHinge 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16462472_26028282603RegionSelf-association site%2C tail
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16451705_17288282562RegionHinge 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16452472_25068282562RegionHinge 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16452472_26028282562RegionSelf-association site%2C tail
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16471705_17288282603RegionHinge 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16472472_25068282603RegionHinge 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16472472_26028282603RegionSelf-association site%2C tail
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16451705_17288282579RegionHinge 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16452472_25068282579RegionHinge 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16452472_26028282579RegionSelf-association site%2C tail
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15451705_17286592423RegionHinge 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15452472_25066592423RegionHinge 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15452472_26026592423RegionSelf-association site%2C tail
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16461705_17288282592RegionHinge 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16462472_25068282592RegionHinge 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16462472_26028282592RegionSelf-association site%2C tail
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16471705_17288282634RegionHinge 1
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16472472_25068282634RegionHinge 2
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16472472_26028282634RegionSelf-association site%2C tail
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1461035_1127972603RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1461128_1222972603RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1461223_1322972603RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1461323_1415972603RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1461416_1511972603RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1461512_1608972603RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1461609_1704972603RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1461729_1813972603RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1461816_1908972603RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1461919_1994972603RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1461997_2089972603RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1462091_2185972603RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1462188_2280972603RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1462282_2375972603RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1462379_2471972603RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+146249_347972603RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+1462507_2601972603RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+146349_446972603RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+146447_543972603RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+146544_636972603RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+146640_736972603RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+146737_839972603RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+146840_938972603RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57875768ENST00000295956+146939_1034972603RepeatNote=Filamin 8
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1451035_1127972562RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1451128_1222972562RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1451223_1322972562RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1451323_1415972562RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1451416_1511972562RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1451512_1608972562RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1451609_1704972562RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1451729_1813972562RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1451816_1908972562RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1451919_1994972562RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1451997_2089972562RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1452091_2185972562RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1452188_2280972562RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1452282_2375972562RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1452379_2471972562RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+145249_347972562RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+1452507_2601972562RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+145349_446972562RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+145447_543972562RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+145544_636972562RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+145640_736972562RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+145737_839972562RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+145840_938972562RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57875768ENST00000348383+145939_1034972562RepeatNote=Filamin 8
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1471035_1127972603RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1471128_1222972603RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1471223_1322972603RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1471323_1415972603RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1471416_1511972603RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1471512_1608972603RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1471609_1704972603RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1471729_1813972603RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1471816_1908972603RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1471919_1994972603RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1471997_2089972603RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1472091_2185972603RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1472188_2280972603RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1472282_2375972603RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1472379_2471972603RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+147249_347972603RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+1472507_2601972603RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+147349_446972603RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+147447_543972603RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+147544_636972603RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+147640_736972603RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+147737_839972603RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+147840_938972603RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57875768ENST00000357272+147939_1034972603RepeatNote=Filamin 8
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1451035_1127972579RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1451128_1222972579RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1451223_1322972579RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1451323_1415972579RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1451416_1511972579RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1451512_1608972579RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1451609_1704972579RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1451729_1813972579RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1451816_1908972579RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1451919_1994972579RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1451997_2089972579RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1452091_2185972579RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1452188_2280972579RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1452282_2375972579RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1452379_2471972579RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+145249_347972579RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+1452507_2601972579RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+145349_446972579RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+145447_543972579RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+145544_636972579RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+145640_736972579RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+145737_839972579RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+145840_938972579RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57875768ENST00000358537+145939_1034972579RepeatNote=Filamin 8
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1451035_112702423RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1451128_122202423RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1451223_132202423RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1451323_141502423RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1451416_151102423RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1451512_160802423RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1451609_170402423RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1451729_181302423RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1451816_190802423RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1451919_199402423RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1451997_208902423RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1452091_218502423RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1452188_228002423RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1452282_237502423RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1452379_247102423RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+145249_34702423RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+1452507_260102423RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+145349_44602423RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+145447_54302423RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+145544_63602423RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+145640_73602423RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+145737_83902423RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+145840_93802423RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57875768ENST00000419752+145939_103402423RepeatNote=Filamin 8
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1461035_1127972592RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1461128_1222972592RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1461223_1322972592RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1461323_1415972592RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1461416_1511972592RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1461512_1608972592RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1461609_1704972592RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1461729_1813972592RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1461816_1908972592RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1461919_1994972592RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1461997_2089972592RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1462091_2185972592RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1462188_2280972592RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1462282_2375972592RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1462379_2471972592RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+146249_347972592RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+1462507_2601972592RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+146349_446972592RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+146447_543972592RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+146544_636972592RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+146640_736972592RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+146737_839972592RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+146840_938972592RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57875768ENST00000429972+146939_1034972592RepeatNote=Filamin 8
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1471035_1127972634RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1471128_1222972634RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1471223_1322972634RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1471323_1415972634RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1471416_1511972634RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1471512_1608972634RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1471609_1704972634RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1471729_1813972634RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1471816_1908972634RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1471919_1994972634RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1471997_2089972634RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1472091_2185972634RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1472188_2280972634RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1472282_2375972634RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1472379_2471972634RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+147249_347972634RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+1472507_2601972634RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+147349_446972634RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+147447_543972634RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+147544_636972634RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+147640_736972634RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+147737_839972634RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+147840_938972634RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57875768ENST00000490882+147939_1034972634RepeatNote=Filamin 8
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1461035_1127972603RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1461128_1222972603RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1461223_1322972603RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1461323_1415972603RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1461416_1511972603RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1461512_1608972603RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1461609_1704972603RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1461729_1813972603RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1461816_1908972603RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1461919_1994972603RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1461997_2089972603RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1462091_2185972603RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1462188_2280972603RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1462282_2375972603RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1462379_2471972603RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+146249_347972603RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+1462507_2601972603RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+146349_446972603RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+146447_543972603RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+146544_636972603RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+146640_736972603RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+146737_839972603RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+146840_938972603RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57898108ENST00000295956+146939_1034972603RepeatNote=Filamin 8
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1451035_1127972562RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1451128_1222972562RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1451223_1322972562RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1451323_1415972562RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1451416_1511972562RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1451512_1608972562RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1451609_1704972562RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1451729_1813972562RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1451816_1908972562RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1451919_1994972562RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1451997_2089972562RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1452091_2185972562RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1452188_2280972562RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1452282_2375972562RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1452379_2471972562RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+145249_347972562RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+1452507_2601972562RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+145349_446972562RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+145447_543972562RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+145544_636972562RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+145640_736972562RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+145737_839972562RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+145840_938972562RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57898108ENST00000348383+145939_1034972562RepeatNote=Filamin 8
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1471035_1127972603RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1471128_1222972603RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1471223_1322972603RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1471323_1415972603RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1471416_1511972603RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1471512_1608972603RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1471609_1704972603RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1471729_1813972603RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1471816_1908972603RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1471919_1994972603RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1471997_2089972603RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1472091_2185972603RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1472188_2280972603RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1472282_2375972603RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1472379_2471972603RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+147249_347972603RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+1472507_2601972603RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+147349_446972603RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+147447_543972603RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+147544_636972603RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+147640_736972603RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+147737_839972603RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+147840_938972603RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57898108ENST00000357272+147939_1034972603RepeatNote=Filamin 8
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1451035_1127972579RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1451128_1222972579RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1451223_1322972579RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1451323_1415972579RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1451416_1511972579RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1451512_1608972579RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1451609_1704972579RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1451729_1813972579RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1451816_1908972579RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1451919_1994972579RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1451997_2089972579RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1452091_2185972579RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1452188_2280972579RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1452282_2375972579RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1452379_2471972579RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+145249_347972579RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+1452507_2601972579RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+145349_446972579RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+145447_543972579RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+145544_636972579RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+145640_736972579RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+145737_839972579RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+145840_938972579RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57898108ENST00000358537+145939_1034972579RepeatNote=Filamin 8
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1451035_112702423RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1451128_122202423RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1451223_132202423RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1451323_141502423RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1451416_151102423RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1451512_160802423RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1451609_170402423RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1451729_181302423RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1451816_190802423RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1451919_199402423RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1451997_208902423RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1452091_218502423RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1452188_228002423RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1452282_237502423RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1452379_247102423RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+145249_34702423RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+1452507_260102423RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+145349_44602423RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+145447_54302423RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+145544_63602423RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+145640_73602423RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+145737_83902423RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+145840_93802423RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57898108ENST00000419752+145939_103402423RepeatNote=Filamin 8
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1461035_1127972592RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1461128_1222972592RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1461223_1322972592RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1461323_1415972592RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1461416_1511972592RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1461512_1608972592RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1461609_1704972592RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1461729_1813972592RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1461816_1908972592RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1461919_1994972592RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1461997_2089972592RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1462091_2185972592RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1462188_2280972592RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1462282_2375972592RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1462379_2471972592RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+146249_347972592RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+1462507_2601972592RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+146349_446972592RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+146447_543972592RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+146544_636972592RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+146640_736972592RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+146737_839972592RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+146840_938972592RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57898108ENST00000429972+146939_1034972592RepeatNote=Filamin 8
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1471035_1127972634RepeatNote=Filamin 9
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1471128_1222972634RepeatNote=Filamin 10
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1471223_1322972634RepeatNote=Filamin 11
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1471323_1415972634RepeatNote=Filamin 12
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1471416_1511972634RepeatNote=Filamin 13
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1471512_1608972634RepeatNote=Filamin 14
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1471609_1704972634RepeatNote=Filamin 15
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1471729_1813972634RepeatNote=Filamin 16
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1471816_1908972634RepeatNote=Filamin 17
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1471919_1994972634RepeatNote=Filamin 18
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1471997_2089972634RepeatNote=Filamin 19
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1472091_2185972634RepeatNote=Filamin 20
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1472188_2280972634RepeatNote=Filamin 21
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1472282_2375972634RepeatNote=Filamin 22
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1472379_2471972634RepeatNote=Filamin 23
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+147249_347972634RepeatNote=Filamin 1
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+1472507_2601972634RepeatNote=Filamin 24
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+147349_446972634RepeatNote=Filamin 2
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+147447_543972634RepeatNote=Filamin 3
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+147544_636972634RepeatNote=Filamin 4
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+147640_736972634RepeatNote=Filamin 5
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+147737_839972634RepeatNote=Filamin 6
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+147840_938972634RepeatNote=Filamin 7
HgeneFLNBchr3:57994583chr3:57898108ENST00000490882+147939_1034972634RepeatNote=Filamin 8
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16461035_11278282603RepeatNote=Filamin 9
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16461128_12228282603RepeatNote=Filamin 10
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16461223_13228282603RepeatNote=Filamin 11
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16461323_14158282603RepeatNote=Filamin 12
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16461416_15118282603RepeatNote=Filamin 13
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16461512_16088282603RepeatNote=Filamin 14
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16461609_17048282603RepeatNote=Filamin 15
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16461729_18138282603RepeatNote=Filamin 16
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16461816_19088282603RepeatNote=Filamin 17
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16461919_19948282603RepeatNote=Filamin 18
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16461997_20898282603RepeatNote=Filamin 19
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16462091_21858282603RepeatNote=Filamin 20
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16462188_22808282603RepeatNote=Filamin 21
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16462282_23758282603RepeatNote=Filamin 22
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16462379_24718282603RepeatNote=Filamin 23
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+16462507_26018282603RepeatNote=Filamin 24
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+1646737_8398282603RepeatNote=Filamin 6
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+1646840_9388282603RepeatNote=Filamin 7
HgeneFLNBchr3:58095897chr3:57843460ENST00000295956+1646939_10348282603RepeatNote=Filamin 8
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16451035_11278282562RepeatNote=Filamin 9
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16451128_12228282562RepeatNote=Filamin 10
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16451223_13228282562RepeatNote=Filamin 11
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16451323_14158282562RepeatNote=Filamin 12
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16451416_15118282562RepeatNote=Filamin 13
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16451512_16088282562RepeatNote=Filamin 14
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16451609_17048282562RepeatNote=Filamin 15
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16451729_18138282562RepeatNote=Filamin 16
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16451816_19088282562RepeatNote=Filamin 17
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16451919_19948282562RepeatNote=Filamin 18
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16451997_20898282562RepeatNote=Filamin 19
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16452091_21858282562RepeatNote=Filamin 20
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16452188_22808282562RepeatNote=Filamin 21
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16452282_23758282562RepeatNote=Filamin 22
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16452379_24718282562RepeatNote=Filamin 23
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+16452507_26018282562RepeatNote=Filamin 24
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+1645737_8398282562RepeatNote=Filamin 6
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+1645840_9388282562RepeatNote=Filamin 7
HgeneFLNBchr3:58095897chr3:57843460ENST00000348383+1645939_10348282562RepeatNote=Filamin 8
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16471035_11278282603RepeatNote=Filamin 9
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16471128_12228282603RepeatNote=Filamin 10
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16471223_13228282603RepeatNote=Filamin 11
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16471323_14158282603RepeatNote=Filamin 12
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16471416_15118282603RepeatNote=Filamin 13
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16471512_16088282603RepeatNote=Filamin 14
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16471609_17048282603RepeatNote=Filamin 15
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16471729_18138282603RepeatNote=Filamin 16
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16471816_19088282603RepeatNote=Filamin 17
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16471919_19948282603RepeatNote=Filamin 18
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16471997_20898282603RepeatNote=Filamin 19
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16472091_21858282603RepeatNote=Filamin 20
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16472188_22808282603RepeatNote=Filamin 21
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16472282_23758282603RepeatNote=Filamin 22
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16472379_24718282603RepeatNote=Filamin 23
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+16472507_26018282603RepeatNote=Filamin 24
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+1647737_8398282603RepeatNote=Filamin 6
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+1647840_9388282603RepeatNote=Filamin 7
HgeneFLNBchr3:58095897chr3:57843460ENST00000357272+1647939_10348282603RepeatNote=Filamin 8
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16451035_11278282579RepeatNote=Filamin 9
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16451128_12228282579RepeatNote=Filamin 10
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16451223_13228282579RepeatNote=Filamin 11
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16451323_14158282579RepeatNote=Filamin 12
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16451416_15118282579RepeatNote=Filamin 13
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16451512_16088282579RepeatNote=Filamin 14
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16451609_17048282579RepeatNote=Filamin 15
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16451729_18138282579RepeatNote=Filamin 16
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16451816_19088282579RepeatNote=Filamin 17
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16451919_19948282579RepeatNote=Filamin 18
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16451997_20898282579RepeatNote=Filamin 19
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16452091_21858282579RepeatNote=Filamin 20
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16452188_22808282579RepeatNote=Filamin 21
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16452282_23758282579RepeatNote=Filamin 22
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16452379_24718282579RepeatNote=Filamin 23
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+16452507_26018282579RepeatNote=Filamin 24
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+1645737_8398282579RepeatNote=Filamin 6
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+1645840_9388282579RepeatNote=Filamin 7
HgeneFLNBchr3:58095897chr3:57843460ENST00000358537+1645939_10348282579RepeatNote=Filamin 8
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15451035_11276592423RepeatNote=Filamin 9
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15451128_12226592423RepeatNote=Filamin 10
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15451223_13226592423RepeatNote=Filamin 11
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15451323_14156592423RepeatNote=Filamin 12
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15451416_15116592423RepeatNote=Filamin 13
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15451512_16086592423RepeatNote=Filamin 14
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15451609_17046592423RepeatNote=Filamin 15
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15451729_18136592423RepeatNote=Filamin 16
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15451816_19086592423RepeatNote=Filamin 17
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15451919_19946592423RepeatNote=Filamin 18
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15451997_20896592423RepeatNote=Filamin 19
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15452091_21856592423RepeatNote=Filamin 20
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15452188_22806592423RepeatNote=Filamin 21
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15452282_23756592423RepeatNote=Filamin 22
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15452379_24716592423RepeatNote=Filamin 23
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+15452507_26016592423RepeatNote=Filamin 24
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+1545640_7366592423RepeatNote=Filamin 5
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+1545737_8396592423RepeatNote=Filamin 6
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+1545840_9386592423RepeatNote=Filamin 7
HgeneFLNBchr3:58095897chr3:57843460ENST00000419752+1545939_10346592423RepeatNote=Filamin 8
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16461035_11278282592RepeatNote=Filamin 9
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16461128_12228282592RepeatNote=Filamin 10
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16461223_13228282592RepeatNote=Filamin 11
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16461323_14158282592RepeatNote=Filamin 12
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16461416_15118282592RepeatNote=Filamin 13
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16461512_16088282592RepeatNote=Filamin 14
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16461609_17048282592RepeatNote=Filamin 15
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16461729_18138282592RepeatNote=Filamin 16
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16461816_19088282592RepeatNote=Filamin 17
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16461919_19948282592RepeatNote=Filamin 18
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16461997_20898282592RepeatNote=Filamin 19
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16462091_21858282592RepeatNote=Filamin 20
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16462188_22808282592RepeatNote=Filamin 21
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16462282_23758282592RepeatNote=Filamin 22
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16462379_24718282592RepeatNote=Filamin 23
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+16462507_26018282592RepeatNote=Filamin 24
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+1646737_8398282592RepeatNote=Filamin 6
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+1646840_9388282592RepeatNote=Filamin 7
HgeneFLNBchr3:58095897chr3:57843460ENST00000429972+1646939_10348282592RepeatNote=Filamin 8
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16471035_11278282634RepeatNote=Filamin 9
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16471128_12228282634RepeatNote=Filamin 10
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16471223_13228282634RepeatNote=Filamin 11
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16471323_14158282634RepeatNote=Filamin 12
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16471416_15118282634RepeatNote=Filamin 13
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16471512_16088282634RepeatNote=Filamin 14
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16471609_17048282634RepeatNote=Filamin 15
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16471729_18138282634RepeatNote=Filamin 16
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16471816_19088282634RepeatNote=Filamin 17
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16471919_19948282634RepeatNote=Filamin 18
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16471997_20898282634RepeatNote=Filamin 19
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16472091_21858282634RepeatNote=Filamin 20
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16472188_22808282634RepeatNote=Filamin 21
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16472282_23758282634RepeatNote=Filamin 22
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16472379_24718282634RepeatNote=Filamin 23
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+16472507_26018282634RepeatNote=Filamin 24
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+1647737_8398282634RepeatNote=Filamin 6
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+1647840_9388282634RepeatNote=Filamin 7
HgeneFLNBchr3:58095897chr3:57843460ENST00000490882+1647939_10348282634RepeatNote=Filamin 8
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295951+1122167_202399812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295951+1122230_388399812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295952+1021167_202399812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295952+1021230_388399812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000383718+1115167_202412507Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000383718+1115230_388412507Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000428312+1122167_202416829Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000428312+1122230_388416829Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000449503+920167_202378791Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000449503+920230_388378791Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295951+1622167_202532812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295951+1622230_388532812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295951+1622477_799532812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295952+1521167_202532812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295952+1521230_388532812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295952+1521477_799532812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000428312+1622167_202549829Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000428312+1622230_388549829Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000428312+1622477_799549829Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000449503+1420167_202511791Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000449503+1420230_388511791Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57898108ENST00000449503+1420477_799511791Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295951+522167_202173812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295952+421167_202173812Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000383718+415167_202173507Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000428312+422167_202173829Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:58095897chr3:57843460ENST00000449503+420167_202173791Coiled coilOntology_term=ECO:0000255
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295951+112228_85399812DomainFHA
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295952+102128_85399812DomainFHA
TgeneSLMAPchr3:57994583chr3:57875768ENST00000383718+111528_85412507DomainFHA
TgeneSLMAPchr3:57994583chr3:57875768ENST00000428312+112228_85416829DomainFHA
TgeneSLMAPchr3:57994583chr3:57875768ENST00000449503+92028_85378791DomainFHA
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295951+162228_85532812DomainFHA
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295952+152128_85532812DomainFHA
TgeneSLMAPchr3:57994583chr3:57898108ENST00000416870+141828_8542272DomainFHA
TgeneSLMAPchr3:57994583chr3:57898108ENST00000428312+162228_85549829DomainFHA
TgeneSLMAPchr3:57994583chr3:57898108ENST00000449503+142028_85511791DomainFHA
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295951+52228_85173812DomainFHA
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295952+42128_85173812DomainFHA
TgeneSLMAPchr3:58095897chr3:57843460ENST00000383718+41528_85173507DomainFHA
TgeneSLMAPchr3:58095897chr3:57843460ENST00000428312+42228_85173829DomainFHA
TgeneSLMAPchr3:58095897chr3:57843460ENST00000449503+42028_85173791DomainFHA
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295951+11221_163399812RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295952+10211_163399812RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:57994583chr3:57875768ENST00000383718+11151_163412507RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:57994583chr3:57875768ENST00000428312+11221_163416829RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:57994583chr3:57875768ENST00000449503+9201_163378791RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295951+16221_163532812RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295952+15211_163532812RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:57994583chr3:57898108ENST00000416870+14181_16342272RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:57994583chr3:57898108ENST00000428312+16221_163549829RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:57994583chr3:57898108ENST00000449503+14201_163511791RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295951+5221_163173812RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295952+4211_163173812RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:58095897chr3:57843460ENST00000383718+4151_163173507RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:58095897chr3:57843460ENST00000428312+4221_163173829RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:58095897chr3:57843460ENST00000449503+4201_163173791RegionNecessary for targeting to centrosomes
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295951+11221_802399812Topological domainCytoplasmic
TgeneSLMAPchr3:57994583chr3:57875768ENST00000295952+10211_802399812Topological domainCytoplasmic
TgeneSLMAPchr3:57994583chr3:57875768ENST00000383718+11151_802412507Topological domainCytoplasmic
TgeneSLMAPchr3:57994583chr3:57875768ENST00000428312+11221_802416829Topological domainCytoplasmic
TgeneSLMAPchr3:57994583chr3:57875768ENST00000449503+9201_802378791Topological domainCytoplasmic
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295951+16221_802532812Topological domainCytoplasmic
TgeneSLMAPchr3:57994583chr3:57898108ENST00000295952+15211_802532812Topological domainCytoplasmic
TgeneSLMAPchr3:57994583chr3:57898108ENST00000416870+14181_80242272Topological domainCytoplasmic
TgeneSLMAPchr3:57994583chr3:57898108ENST00000428312+16221_802549829Topological domainCytoplasmic
TgeneSLMAPchr3:57994583chr3:57898108ENST00000449503+14201_802511791Topological domainCytoplasmic
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295951+5221_802173812Topological domainCytoplasmic
TgeneSLMAPchr3:58095897chr3:57843460ENST00000295952+4211_802173812Topological domainCytoplasmic
TgeneSLMAPchr3:58095897chr3:57843460ENST00000383718+4151_802173507Topological domainCytoplasmic
TgeneSLMAPchr3:58095897chr3:57843460ENST00000428312+4221_802173829Topological domainCytoplasmic
TgeneSLMAPchr3:58095897chr3:57843460ENST00000449503+4201_802173791Topological domainCytoplasmic


Top

FusionGeneSequence for FLNB_SLMAP


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FLNB_ENST00000490882_chr3_57994583_+_SLMAP_ENST00000295951_chr3_57875768_+_510aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRE
SIKLVSIEKLIVEGHLTKAVEETKLSKENQTRAKESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEI
QHLRKELIEAQELARTSKQKCFELQALLEEERKAYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQ
AAAKVASERDTDIASLQEELKKVRAELERWRKAASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRE
NVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFE

>In-frame_FLNB_ENST00000429972_chr3_57994583_+_SLMAP_ENST00000295951_chr3_57875768_+_510aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRE
SIKLVSIEKLIVEGHLTKAVEETKLSKENQTRAKESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEI
QHLRKELIEAQELARTSKQKCFELQALLEEERKAYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQ
AAAKVASERDTDIASLQEELKKVRAELERWRKAASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRE
NVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFE

>In-frame_FLNB_ENST00000295956_chr3_57994583_+_SLMAP_ENST00000295951_chr3_57875768_+_510aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRE
SIKLVSIEKLIVEGHLTKAVEETKLSKENQTRAKESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEI
QHLRKELIEAQELARTSKQKCFELQALLEEERKAYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQ
AAAKVASERDTDIASLQEELKKVRAELERWRKAASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRE
NVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFE

>In-frame_FLNB_ENST00000358537_chr3_57994583_+_SLMAP_ENST00000295951_chr3_57875768_+_510aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRE
SIKLVSIEKLIVEGHLTKAVEETKLSKENQTRAKESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEI
QHLRKELIEAQELARTSKQKCFELQALLEEERKAYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQ
AAAKVASERDTDIASLQEELKKVRAELERWRKAASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRE
NVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFE

>In-frame_FLNB_ENST00000357272_chr3_57994583_+_SLMAP_ENST00000295951_chr3_57875768_+_510aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRE
SIKLVSIEKLIVEGHLTKAVEETKLSKENQTRAKESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEI
QHLRKELIEAQELARTSKQKCFELQALLEEERKAYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQ
AAAKVASERDTDIASLQEELKKVRAELERWRKAASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRE
NVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFE

>In-frame_FLNB_ENST00000348383_chr3_57994583_+_SLMAP_ENST00000295951_chr3_57875768_+_510aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRE
SIKLVSIEKLIVEGHLTKAVEETKLSKENQTRAKESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEI
QHLRKELIEAQELARTSKQKCFELQALLEEERKAYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQ
AAAKVASERDTDIASLQEELKKVRAELERWRKAASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRE
NVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFE

>In-frame_FLNB_ENST00000490882_chr3_58095897_+_SLMAP_ENST00000295951_chr3_57843460_+_1467aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRE
SIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNM
VKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEAC
NPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDS
PYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVK
YVPPAAGRYTIKVLFASQEALHREQMLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGNQLQACSKNQTEDSLRKELIALQE
DKHNYETTAKESLRRVLQEKIEVVRKLSEVERSLSNTEDECTHLKEMNERTQEELRELANKYNGAVNEIKDLSDKLKVAEGKQEEIQQKG
QAEKKELQHKIDEMEEKEQELQAKIEALQADNDFTNERLTALQEHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKAVEETKLSKENQTRA
KESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEIQHLRKELIEAQELARTSKQKCFELQALLEEERK
AYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQAAAKVASERDTDIASLQEELKKVRAELERWRKA
ASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQ
MSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREKGNNKPWP

>In-frame_FLNB_ENST00000429972_chr3_58095897_+_SLMAP_ENST00000295951_chr3_57843460_+_1467aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRE
SIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNM
VKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEAC
NPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDS
PYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVK
YVPPAAGRYTIKVLFASQEALHREQMLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGNQLQACSKNQTEDSLRKELIALQE
DKHNYETTAKESLRRVLQEKIEVVRKLSEVERSLSNTEDECTHLKEMNERTQEELRELANKYNGAVNEIKDLSDKLKVAEGKQEEIQQKG
QAEKKELQHKIDEMEEKEQELQAKIEALQADNDFTNERLTALQEHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKAVEETKLSKENQTRA
KESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEIQHLRKELIEAQELARTSKQKCFELQALLEEERK
AYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQAAAKVASERDTDIASLQEELKKVRAELERWRKA
ASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQ
MSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREKGNNKPWP

>In-frame_FLNB_ENST00000295956_chr3_58095897_+_SLMAP_ENST00000295951_chr3_57843460_+_1467aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRE
SIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNM
VKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEAC
NPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDS
PYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVK
YVPPAAGRYTIKVLFASQEALHREQMLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGNQLQACSKNQTEDSLRKELIALQE
DKHNYETTAKESLRRVLQEKIEVVRKLSEVERSLSNTEDECTHLKEMNERTQEELRELANKYNGAVNEIKDLSDKLKVAEGKQEEIQQKG
QAEKKELQHKIDEMEEKEQELQAKIEALQADNDFTNERLTALQEHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKAVEETKLSKENQTRA
KESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEIQHLRKELIEAQELARTSKQKCFELQALLEEERK
AYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQAAAKVASERDTDIASLQEELKKVRAELERWRKA
ASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQ
MSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREKGNNKPWP

>In-frame_FLNB_ENST00000358537_chr3_58095897_+_SLMAP_ENST00000295951_chr3_57843460_+_1467aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRE
SIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNM
VKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEAC
NPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDS
PYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVK
YVPPAAGRYTIKVLFASQEALHREQMLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGNQLQACSKNQTEDSLRKELIALQE
DKHNYETTAKESLRRVLQEKIEVVRKLSEVERSLSNTEDECTHLKEMNERTQEELRELANKYNGAVNEIKDLSDKLKVAEGKQEEIQQKG
QAEKKELQHKIDEMEEKEQELQAKIEALQADNDFTNERLTALQEHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKAVEETKLSKENQTRA
KESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEIQHLRKELIEAQELARTSKQKCFELQALLEEERK
AYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQAAAKVASERDTDIASLQEELKKVRAELERWRKA
ASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQ
MSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREKGNNKPWP

>In-frame_FLNB_ENST00000357272_chr3_58095897_+_SLMAP_ENST00000295951_chr3_57843460_+_1467aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRE
SIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNM
VKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEAC
NPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDS
PYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVK
YVPPAAGRYTIKVLFASQEALHREQMLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGNQLQACSKNQTEDSLRKELIALQE
DKHNYETTAKESLRRVLQEKIEVVRKLSEVERSLSNTEDECTHLKEMNERTQEELRELANKYNGAVNEIKDLSDKLKVAEGKQEEIQQKG
QAEKKELQHKIDEMEEKEQELQAKIEALQADNDFTNERLTALQEHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKAVEETKLSKENQTRA
KESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEIQHLRKELIEAQELARTSKQKCFELQALLEEERK
AYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQAAAKVASERDTDIASLQEELKKVRAELERWRKA
ASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQ
MSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREKGNNKPWP

>In-frame_FLNB_ENST00000348383_chr3_58095897_+_SLMAP_ENST00000295951_chr3_57843460_+_1467aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRE
SIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNM
VKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEAC
NPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDS
PYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVK
YVPPAAGRYTIKVLFASQEALHREQMLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGNQLQACSKNQTEDSLRKELIALQE
DKHNYETTAKESLRRVLQEKIEVVRKLSEVERSLSNTEDECTHLKEMNERTQEELRELANKYNGAVNEIKDLSDKLKVAEGKQEEIQQKG
QAEKKELQHKIDEMEEKEQELQAKIEALQADNDFTNERLTALQEHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKAVEETKLSKENQTRA
KESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEIQHLRKELIEAQELARTSKQKCFELQALLEEERK
AYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQAAAKVASERDTDIASLQEELKKVRAELERWRKA
ASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQ
MSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREKGNNKPWP

>In-frame_FLNB_ENST00000493452_chr3_58095897_+_SLMAP_ENST00000295951_chr3_57843460_+_1298aa
MQEHSTRRRSLSLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARA
YGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDK
AQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPK
SPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITW
GGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVH
IMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYT
PVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDI
IHNANDTFTVKYVPPAAGRYTIKVLFASQEALHREQMLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGNQLQACSKNQTED
SLRKELIALQEDKHNYETTAKESLRRVLQEKIEVVRKLSEVERSLSNTEDECTHLKEMNERTQEELRELANKYNGAVNEIKDLSDKLKVA
EGKQEEIQQKGQAEKKELQHKIDEMEEKEQELQAKIEALQADNDFTNERLTALQEHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKAVEE
TKLSKENQTRAKESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEIQHLRKELIEAQELARTSKQKCF
ELQALLEEERKAYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQAAAKVASERDTDIASLQEELKK
VRAELERWRKAASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQS
LELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKL

>In-frame_FLNB_ENST00000419752_chr3_58095897_+_SLMAP_ENST00000295951_chr3_57843460_+_1298aa
MQEHSTRRRSLSLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARA
YGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDK
AQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPK
SPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITW
GGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVH
IMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYT
PVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDI
IHNANDTFTVKYVPPAAGRYTIKVLFASQEALHREQMLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGNQLQACSKNQTED
SLRKELIALQEDKHNYETTAKESLRRVLQEKIEVVRKLSEVERSLSNTEDECTHLKEMNERTQEELRELANKYNGAVNEIKDLSDKLKVA
EGKQEEIQQKGQAEKKELQHKIDEMEEKEQELQAKIEALQADNDFTNERLTALQEHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKAVEE
TKLSKENQTRAKESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEIQHLRKELIEAQELARTSKQKCF
ELQALLEEERKAYRNQVEESTKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQAAAKVASERDTDIASLQEELKK
VRAELERWRKAASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQS
LELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FLNB_ENST00000490882_chr3_57994583_+_SLMAP_ENST00000295951_chr3_57875768_+_1530nt
ATGCCGGTAACCGAGAAGGATCTAGCTGAGGACGCGCCTTGGAAGAAGATCCAGCAGAACACGTTCACACGCTGGTGCAACGAGCACCTC
AAGTGCGTGAACAAACGCATCGGCAACCTGCAGACCGACCTGAGCGACGGGCTGCGGCTCATCGCGCTGCTCGAGGTGCTCAGCCAGAAG
CGCATGTACCGCAAGTACCATCAGCGGCCCACCTTTCGCCAGATGCAGCTCGAGAATGTGTCCGTGGCGCTCGAGTTCCTGGACCGTGAG
AGCATCAAGCTCGTGTCCATCGAGAAGCTGATCGTCGAAGGGCATCTAACCAAAGCGGTAGAAGAAACAAAGCTTTCAAAAGAAAATCAG
ACAAGAGCAAAAGAATCTGATTTTTCAGATACTCTGAGTCCAAGCAAGGAAAAAAGCAGTGACGACACTACAGACGCCCAAATGGATGAG
CAAGACCTAAATGAGCCTCTTGCCAAAGTGTCCCTTTTAAAAGATGACTTGCAGGGTGCACAGTCAGAAATTGAGGCAAAGCAAGAAATA
CAGCATCTTCGAAAGGAATTGATCGAAGCCCAGGAGCTAGCTAGAACAAGTAAACAAAAATGCTTTGAACTTCAAGCTCTTTTGGAAGAA
GAAAGAAAAGCCTATCGAAATCAAGTTGAGGAATCCACTAAACAAATACAGGTTCTTCAAGCCCAATTGCAGAGGTTACACATCGATACT
GAGAATCTCCGGGAGGAGAAGGACAGTGAAATCACAAGTACTAGAGATGAATTGCTTAGTGCCCGAGATGAAATTTTGCTCCTTCATCAA
GCAGCAGCAAAGGTTGCCTCTGAGCGGGACACTGACATTGCTTCTTTACAAGAAGAGCTTAAGAAGGTGAGAGCTGAGCTTGAGCGGTGG
CGGAAAGCAGCGTCTGAATATGAGAAAGAAATCACAAGTCTGCAAAACAGTTTTCAGCTTAGATGTCAACAGTGTGAGGACCAGCAGAGA
GAAGAAGCAACAAGGTTGCAAGGTGAACTAGAGAAGTTGAGAAAGGAATGGAATGCATTGGAAACCGAATGCCATTCTCTAAAAAGGGAA
AATGTTTTGCTATCATCAGAACTGCAACGGCAAGAAAAAGAATTGCACAATTCTCAGAAGCAGAGTTTAGAGCTTACCAGTGATCTCAGC
ATCCTTCAAATGTCTAGGAAAGAACTTGAGAATCAAGTGGGATCCTTGAAAGAACAGCATCTTCGGGATTCAGCTGATTTAAAAACTCTT
CTCAGTAAGGCAGAAAACCAAGCAAAGGATGTGCAGAAAGAGTATGAAAAGACACAGACTGTACTCTCAGAACTGAAGTTGAAGTTTGAA
ATGACTGAGCAGGAAAAGCAGTCAATCACAGATGAGCTCAAACAGTGTAAAAACAACCTGAAGCTGCTCCGAGAGAAAGGAAATAATAAA
CCCTGGCCCTGGATGCCCATGTTGGCTGCCCTGGTTGCAGTAACAGCCATCGTGCTGTACGTGCCAGGTCTGGCCAGAGCTTCTCCATGA

>In-frame_FLNB_ENST00000429972_chr3_57994583_+_SLMAP_ENST00000295951_chr3_57875768_+_1530nt
ATGCCGGTAACCGAGAAGGATCTAGCTGAGGACGCGCCTTGGAAGAAGATCCAGCAGAACACGTTCACACGCTGGTGCAACGAGCACCTC
AAGTGCGTGAACAAACGCATCGGCAACCTGCAGACCGACCTGAGCGACGGGCTGCGGCTCATCGCGCTGCTCGAGGTGCTCAGCCAGAAG
CGCATGTACCGCAAGTACCATCAGCGGCCCACCTTTCGCCAGATGCAGCTCGAGAATGTGTCCGTGGCGCTCGAGTTCCTGGACCGTGAG
AGCATCAAGCTCGTGTCCATCGAGAAGCTGATCGTCGAAGGGCATCTAACCAAAGCGGTAGAAGAAACAAAGCTTTCAAAAGAAAATCAG
ACAAGAGCAAAAGAATCTGATTTTTCAGATACTCTGAGTCCAAGCAAGGAAAAAAGCAGTGACGACACTACAGACGCCCAAATGGATGAG
CAAGACCTAAATGAGCCTCTTGCCAAAGTGTCCCTTTTAAAAGATGACTTGCAGGGTGCACAGTCAGAAATTGAGGCAAAGCAAGAAATA
CAGCATCTTCGAAAGGAATTGATCGAAGCCCAGGAGCTAGCTAGAACAAGTAAACAAAAATGCTTTGAACTTCAAGCTCTTTTGGAAGAA
GAAAGAAAAGCCTATCGAAATCAAGTTGAGGAATCCACTAAACAAATACAGGTTCTTCAAGCCCAATTGCAGAGGTTACACATCGATACT
GAGAATCTCCGGGAGGAGAAGGACAGTGAAATCACAAGTACTAGAGATGAATTGCTTAGTGCCCGAGATGAAATTTTGCTCCTTCATCAA
GCAGCAGCAAAGGTTGCCTCTGAGCGGGACACTGACATTGCTTCTTTACAAGAAGAGCTTAAGAAGGTGAGAGCTGAGCTTGAGCGGTGG
CGGAAAGCAGCGTCTGAATATGAGAAAGAAATCACAAGTCTGCAAAACAGTTTTCAGCTTAGATGTCAACAGTGTGAGGACCAGCAGAGA
GAAGAAGCAACAAGGTTGCAAGGTGAACTAGAGAAGTTGAGAAAGGAATGGAATGCATTGGAAACCGAATGCCATTCTCTAAAAAGGGAA
AATGTTTTGCTATCATCAGAACTGCAACGGCAAGAAAAAGAATTGCACAATTCTCAGAAGCAGAGTTTAGAGCTTACCAGTGATCTCAGC
ATCCTTCAAATGTCTAGGAAAGAACTTGAGAATCAAGTGGGATCCTTGAAAGAACAGCATCTTCGGGATTCAGCTGATTTAAAAACTCTT
CTCAGTAAGGCAGAAAACCAAGCAAAGGATGTGCAGAAAGAGTATGAAAAGACACAGACTGTACTCTCAGAACTGAAGTTGAAGTTTGAA
ATGACTGAGCAGGAAAAGCAGTCAATCACAGATGAGCTCAAACAGTGTAAAAACAACCTGAAGCTGCTCCGAGAGAAAGGAAATAATAAA
CCCTGGCCCTGGATGCCCATGTTGGCTGCCCTGGTTGCAGTAACAGCCATCGTGCTGTACGTGCCAGGTCTGGCCAGAGCTTCTCCATGA

>In-frame_FLNB_ENST00000295956_chr3_57994583_+_SLMAP_ENST00000295951_chr3_57875768_+_1530nt
ATGCCGGTAACCGAGAAGGATCTAGCTGAGGACGCGCCTTGGAAGAAGATCCAGCAGAACACGTTCACACGCTGGTGCAACGAGCACCTC
AAGTGCGTGAACAAACGCATCGGCAACCTGCAGACCGACCTGAGCGACGGGCTGCGGCTCATCGCGCTGCTCGAGGTGCTCAGCCAGAAG
CGCATGTACCGCAAGTACCATCAGCGGCCCACCTTTCGCCAGATGCAGCTCGAGAATGTGTCCGTGGCGCTCGAGTTCCTGGACCGTGAG
AGCATCAAGCTCGTGTCCATCGAGAAGCTGATCGTCGAAGGGCATCTAACCAAAGCGGTAGAAGAAACAAAGCTTTCAAAAGAAAATCAG
ACAAGAGCAAAAGAATCTGATTTTTCAGATACTCTGAGTCCAAGCAAGGAAAAAAGCAGTGACGACACTACAGACGCCCAAATGGATGAG
CAAGACCTAAATGAGCCTCTTGCCAAAGTGTCCCTTTTAAAAGATGACTTGCAGGGTGCACAGTCAGAAATTGAGGCAAAGCAAGAAATA
CAGCATCTTCGAAAGGAATTGATCGAAGCCCAGGAGCTAGCTAGAACAAGTAAACAAAAATGCTTTGAACTTCAAGCTCTTTTGGAAGAA
GAAAGAAAAGCCTATCGAAATCAAGTTGAGGAATCCACTAAACAAATACAGGTTCTTCAAGCCCAATTGCAGAGGTTACACATCGATACT
GAGAATCTCCGGGAGGAGAAGGACAGTGAAATCACAAGTACTAGAGATGAATTGCTTAGTGCCCGAGATGAAATTTTGCTCCTTCATCAA
GCAGCAGCAAAGGTTGCCTCTGAGCGGGACACTGACATTGCTTCTTTACAAGAAGAGCTTAAGAAGGTGAGAGCTGAGCTTGAGCGGTGG
CGGAAAGCAGCGTCTGAATATGAGAAAGAAATCACAAGTCTGCAAAACAGTTTTCAGCTTAGATGTCAACAGTGTGAGGACCAGCAGAGA
GAAGAAGCAACAAGGTTGCAAGGTGAACTAGAGAAGTTGAGAAAGGAATGGAATGCATTGGAAACCGAATGCCATTCTCTAAAAAGGGAA
AATGTTTTGCTATCATCAGAACTGCAACGGCAAGAAAAAGAATTGCACAATTCTCAGAAGCAGAGTTTAGAGCTTACCAGTGATCTCAGC
ATCCTTCAAATGTCTAGGAAAGAACTTGAGAATCAAGTGGGATCCTTGAAAGAACAGCATCTTCGGGATTCAGCTGATTTAAAAACTCTT
CTCAGTAAGGCAGAAAACCAAGCAAAGGATGTGCAGAAAGAGTATGAAAAGACACAGACTGTACTCTCAGAACTGAAGTTGAAGTTTGAA
ATGACTGAGCAGGAAAAGCAGTCAATCACAGATGAGCTCAAACAGTGTAAAAACAACCTGAAGCTGCTCCGAGAGAAAGGAAATAATAAA
CCCTGGCCCTGGATGCCCATGTTGGCTGCCCTGGTTGCAGTAACAGCCATCGTGCTGTACGTGCCAGGTCTGGCCAGAGCTTCTCCATGA

>In-frame_FLNB_ENST00000358537_chr3_57994583_+_SLMAP_ENST00000295951_chr3_57875768_+_1530nt
ATGCCGGTAACCGAGAAGGATCTAGCTGAGGACGCGCCTTGGAAGAAGATCCAGCAGAACACGTTCACACGCTGGTGCAACGAGCACCTC
AAGTGCGTGAACAAACGCATCGGCAACCTGCAGACCGACCTGAGCGACGGGCTGCGGCTCATCGCGCTGCTCGAGGTGCTCAGCCAGAAG
CGCATGTACCGCAAGTACCATCAGCGGCCCACCTTTCGCCAGATGCAGCTCGAGAATGTGTCCGTGGCGCTCGAGTTCCTGGACCGTGAG
AGCATCAAGCTCGTGTCCATCGAGAAGCTGATCGTCGAAGGGCATCTAACCAAAGCGGTAGAAGAAACAAAGCTTTCAAAAGAAAATCAG
ACAAGAGCAAAAGAATCTGATTTTTCAGATACTCTGAGTCCAAGCAAGGAAAAAAGCAGTGACGACACTACAGACGCCCAAATGGATGAG
CAAGACCTAAATGAGCCTCTTGCCAAAGTGTCCCTTTTAAAAGATGACTTGCAGGGTGCACAGTCAGAAATTGAGGCAAAGCAAGAAATA
CAGCATCTTCGAAAGGAATTGATCGAAGCCCAGGAGCTAGCTAGAACAAGTAAACAAAAATGCTTTGAACTTCAAGCTCTTTTGGAAGAA
GAAAGAAAAGCCTATCGAAATCAAGTTGAGGAATCCACTAAACAAATACAGGTTCTTCAAGCCCAATTGCAGAGGTTACACATCGATACT
GAGAATCTCCGGGAGGAGAAGGACAGTGAAATCACAAGTACTAGAGATGAATTGCTTAGTGCCCGAGATGAAATTTTGCTCCTTCATCAA
GCAGCAGCAAAGGTTGCCTCTGAGCGGGACACTGACATTGCTTCTTTACAAGAAGAGCTTAAGAAGGTGAGAGCTGAGCTTGAGCGGTGG
CGGAAAGCAGCGTCTGAATATGAGAAAGAAATCACAAGTCTGCAAAACAGTTTTCAGCTTAGATGTCAACAGTGTGAGGACCAGCAGAGA
GAAGAAGCAACAAGGTTGCAAGGTGAACTAGAGAAGTTGAGAAAGGAATGGAATGCATTGGAAACCGAATGCCATTCTCTAAAAAGGGAA
AATGTTTTGCTATCATCAGAACTGCAACGGCAAGAAAAAGAATTGCACAATTCTCAGAAGCAGAGTTTAGAGCTTACCAGTGATCTCAGC
ATCCTTCAAATGTCTAGGAAAGAACTTGAGAATCAAGTGGGATCCTTGAAAGAACAGCATCTTCGGGATTCAGCTGATTTAAAAACTCTT
CTCAGTAAGGCAGAAAACCAAGCAAAGGATGTGCAGAAAGAGTATGAAAAGACACAGACTGTACTCTCAGAACTGAAGTTGAAGTTTGAA
ATGACTGAGCAGGAAAAGCAGTCAATCACAGATGAGCTCAAACAGTGTAAAAACAACCTGAAGCTGCTCCGAGAGAAAGGAAATAATAAA
CCCTGGCCCTGGATGCCCATGTTGGCTGCCCTGGTTGCAGTAACAGCCATCGTGCTGTACGTGCCAGGTCTGGCCAGAGCTTCTCCATGA

>In-frame_FLNB_ENST00000357272_chr3_57994583_+_SLMAP_ENST00000295951_chr3_57875768_+_1530nt
ATGCCGGTAACCGAGAAGGATCTAGCTGAGGACGCGCCTTGGAAGAAGATCCAGCAGAACACGTTCACACGCTGGTGCAACGAGCACCTC
AAGTGCGTGAACAAACGCATCGGCAACCTGCAGACCGACCTGAGCGACGGGCTGCGGCTCATCGCGCTGCTCGAGGTGCTCAGCCAGAAG
CGCATGTACCGCAAGTACCATCAGCGGCCCACCTTTCGCCAGATGCAGCTCGAGAATGTGTCCGTGGCGCTCGAGTTCCTGGACCGTGAG
AGCATCAAGCTCGTGTCCATCGAGAAGCTGATCGTCGAAGGGCATCTAACCAAAGCGGTAGAAGAAACAAAGCTTTCAAAAGAAAATCAG
ACAAGAGCAAAAGAATCTGATTTTTCAGATACTCTGAGTCCAAGCAAGGAAAAAAGCAGTGACGACACTACAGACGCCCAAATGGATGAG
CAAGACCTAAATGAGCCTCTTGCCAAAGTGTCCCTTTTAAAAGATGACTTGCAGGGTGCACAGTCAGAAATTGAGGCAAAGCAAGAAATA
CAGCATCTTCGAAAGGAATTGATCGAAGCCCAGGAGCTAGCTAGAACAAGTAAACAAAAATGCTTTGAACTTCAAGCTCTTTTGGAAGAA
GAAAGAAAAGCCTATCGAAATCAAGTTGAGGAATCCACTAAACAAATACAGGTTCTTCAAGCCCAATTGCAGAGGTTACACATCGATACT
GAGAATCTCCGGGAGGAGAAGGACAGTGAAATCACAAGTACTAGAGATGAATTGCTTAGTGCCCGAGATGAAATTTTGCTCCTTCATCAA
GCAGCAGCAAAGGTTGCCTCTGAGCGGGACACTGACATTGCTTCTTTACAAGAAGAGCTTAAGAAGGTGAGAGCTGAGCTTGAGCGGTGG
CGGAAAGCAGCGTCTGAATATGAGAAAGAAATCACAAGTCTGCAAAACAGTTTTCAGCTTAGATGTCAACAGTGTGAGGACCAGCAGAGA
GAAGAAGCAACAAGGTTGCAAGGTGAACTAGAGAAGTTGAGAAAGGAATGGAATGCATTGGAAACCGAATGCCATTCTCTAAAAAGGGAA
AATGTTTTGCTATCATCAGAACTGCAACGGCAAGAAAAAGAATTGCACAATTCTCAGAAGCAGAGTTTAGAGCTTACCAGTGATCTCAGC
ATCCTTCAAATGTCTAGGAAAGAACTTGAGAATCAAGTGGGATCCTTGAAAGAACAGCATCTTCGGGATTCAGCTGATTTAAAAACTCTT
CTCAGTAAGGCAGAAAACCAAGCAAAGGATGTGCAGAAAGAGTATGAAAAGACACAGACTGTACTCTCAGAACTGAAGTTGAAGTTTGAA
ATGACTGAGCAGGAAAAGCAGTCAATCACAGATGAGCTCAAACAGTGTAAAAACAACCTGAAGCTGCTCCGAGAGAAAGGAAATAATAAA
CCCTGGCCCTGGATGCCCATGTTGGCTGCCCTGGTTGCAGTAACAGCCATCGTGCTGTACGTGCCAGGTCTGGCCAGAGCTTCTCCATGA

>In-frame_FLNB_ENST00000348383_chr3_57994583_+_SLMAP_ENST00000295951_chr3_57875768_+_1530nt
ATGCCGGTAACCGAGAAGGATCTAGCTGAGGACGCGCCTTGGAAGAAGATCCAGCAGAACACGTTCACACGCTGGTGCAACGAGCACCTC
AAGTGCGTGAACAAACGCATCGGCAACCTGCAGACCGACCTGAGCGACGGGCTGCGGCTCATCGCGCTGCTCGAGGTGCTCAGCCAGAAG
CGCATGTACCGCAAGTACCATCAGCGGCCCACCTTTCGCCAGATGCAGCTCGAGAATGTGTCCGTGGCGCTCGAGTTCCTGGACCGTGAG
AGCATCAAGCTCGTGTCCATCGAGAAGCTGATCGTCGAAGGGCATCTAACCAAAGCGGTAGAAGAAACAAAGCTTTCAAAAGAAAATCAG
ACAAGAGCAAAAGAATCTGATTTTTCAGATACTCTGAGTCCAAGCAAGGAAAAAAGCAGTGACGACACTACAGACGCCCAAATGGATGAG
CAAGACCTAAATGAGCCTCTTGCCAAAGTGTCCCTTTTAAAAGATGACTTGCAGGGTGCACAGTCAGAAATTGAGGCAAAGCAAGAAATA
CAGCATCTTCGAAAGGAATTGATCGAAGCCCAGGAGCTAGCTAGAACAAGTAAACAAAAATGCTTTGAACTTCAAGCTCTTTTGGAAGAA
GAAAGAAAAGCCTATCGAAATCAAGTTGAGGAATCCACTAAACAAATACAGGTTCTTCAAGCCCAATTGCAGAGGTTACACATCGATACT
GAGAATCTCCGGGAGGAGAAGGACAGTGAAATCACAAGTACTAGAGATGAATTGCTTAGTGCCCGAGATGAAATTTTGCTCCTTCATCAA
GCAGCAGCAAAGGTTGCCTCTGAGCGGGACACTGACATTGCTTCTTTACAAGAAGAGCTTAAGAAGGTGAGAGCTGAGCTTGAGCGGTGG
CGGAAAGCAGCGTCTGAATATGAGAAAGAAATCACAAGTCTGCAAAACAGTTTTCAGCTTAGATGTCAACAGTGTGAGGACCAGCAGAGA
GAAGAAGCAACAAGGTTGCAAGGTGAACTAGAGAAGTTGAGAAAGGAATGGAATGCATTGGAAACCGAATGCCATTCTCTAAAAAGGGAA
AATGTTTTGCTATCATCAGAACTGCAACGGCAAGAAAAAGAATTGCACAATTCTCAGAAGCAGAGTTTAGAGCTTACCAGTGATCTCAGC
ATCCTTCAAATGTCTAGGAAAGAACTTGAGAATCAAGTGGGATCCTTGAAAGAACAGCATCTTCGGGATTCAGCTGATTTAAAAACTCTT
CTCAGTAAGGCAGAAAACCAAGCAAAGGATGTGCAGAAAGAGTATGAAAAGACACAGACTGTACTCTCAGAACTGAAGTTGAAGTTTGAA
ATGACTGAGCAGGAAAAGCAGTCAATCACAGATGAGCTCAAACAGTGTAAAAACAACCTGAAGCTGCTCCGAGAGAAAGGAAATAATAAA
CCCTGGCCCTGGATGCCCATGTTGGCTGCCCTGGTTGCAGTAACAGCCATCGTGCTGTACGTGCCAGGTCTGGCCAGAGCTTCTCCATGA

>In-frame_FLNB_ENST00000490882_chr3_58095897_+_SLMAP_ENST00000295951_chr3_57843460_+_4401nt
ATGCCGGTAACCGAGAAGGATCTAGCTGAGGACGCGCCTTGGAAGAAGATCCAGCAGAACACGTTCACACGCTGGTGCAACGAGCACCTC
AAGTGCGTGAACAAACGCATCGGCAACCTGCAGACCGACCTGAGCGACGGGCTGCGGCTCATCGCGCTGCTCGAGGTGCTCAGCCAGAAG
CGCATGTACCGCAAGTACCATCAGCGGCCCACCTTTCGCCAGATGCAGCTCGAGAATGTGTCCGTGGCGCTCGAGTTCCTGGACCGTGAG
AGCATCAAGCTCGTGTCCATCGATAGCAAAGCCATTGTGGATGGGAACCTGAAGCTCATCTTGGGTCTGGTGTGGACGCTGATCCTCCAC
TACTCCATCTCCATGCCCGTGTGGGAGGATGAAGGGGATGATGATGCCAAGAAGCAGACGCCAAAGCAGAGGCTGCTGGGGTGGATTCAG
AACAAGATCCCCTACTTGCCCATCACCAACTTTAACCAGAACTGGCAAGACGGCAAAGCCCTGGGAGCCCTGGTAGACAGCTGTGCTCCA
GGTCTGTGCCCAGACTGGGAATCCTGGGACCCGCAGAAGCCTGTGGATAATGCACGAGAAGCCATGCAGCAGGCAGATGACTGGCTGGGT
GTCCCACAGGTCATCACTCCTGAAGAAATCATTCACCCGGATGTGGACGAGCACTCAGTTATGACTTACCTGTCCCAGTTCCCCAAAGCC
AAGCTCAAGCCGGGGGCTCCTCTCAAACCCAAACTCAACCCGAAGAAAGCCAGGGCCTATGGCAGAGGAATCGAGCCCACTGGAAACATG
GTGAAGCAGCCAGCCAAGTTCACTGTGGACACCATCAGCGCCGGGCAAGGAGACGTGATGGTGTTTGTTGAGGACCCAGAAGGGAACAAA
GAGGAGGCACAAGTGACCCCTGACAGTGACAAGAACAAGACATACTCTGTGGAGTATCTGCCCAAGGTCACCGGGCTACACAAAGTCACA
GTCCTCTTTGCAGGACAGCACATCTCCAAGAGCCCATTTGAAGTGAGTGTTGACAAGGCCCAGGGAGATGCCAGTAAAGTCACTGCAAAA
GGTCCAGGGTTGGAAGCTGTAGGGAACATCGCCAATAAGCCCACCTACTTTGACATCTATACGGCAGGAGCTGGTGTGGGTGACATTGGT
GTGGAGGTGGAAGATCCCCAGGGGAAGAACACCGTGGAGTTGCTCGTGGAAGACAAAGGAAACCAGGTGTATCGATGTGTGTACAAACCC
ATGCAGCCTGGCCCTCACGTGGTCAAGATCTTCTTTGCTGGGGACACTATTCCTAAGAGTCCCTTCGTTGTGCAGGTTGGGGAAGCCTGC
AATCCAAATGCCTGCCGGGCCAGTGGCCGAGGCCTACAACCCAAAGGCGTCCGTATCCGGGAGACCACAGATTTCAAGGTTGACACCAAA
GCTGCAGGAAGTGGGGAGCTCGGTGTAACCATGAAGGGTCCTAAGGGTCTGGAGGAGCTGGTGAAGCAGAAAGACTTTCTGGATGGGGTC
TACGCATTCGAGTATTACCCCAGCACCCCGGGGAGATACAGCATTGCCATCACATGGGGGGGACACCACATTCCAAAGAGCCCCTTTGAA
GTTCAAGTTGGCCCTGAAGCGGGTATGCAGAAAGTCCGTGCTTGGGGCCCTGGGCTCCATGGTGGGATTGTCGGGCGGTCAGCGGACTTC
GTGGTAGAATCCATTGGCTCTGAAGTGGGGTCTCTGGGGTTTGCCATTGAAGGCCCCTCTCAGGCAAAGATTGAGTACAACGACCAGAAT
GATGGATCGTGTGATGTCAAATACTGGCCCAAGGAGCCTGGCGAATATGCTGTTCACATCATGTGTGACGACGAAGACATCAAGGACAGC
CCGTACATGGCCTTCATCCACCCAGCCACGGGAGGCTACAACCCTGATCTGGTTCGAGCATACGGGCCAGGTTTGGAGAAATCTGGATGC
ATTGTCAACAACCTGGCCGAGTTCACTGTGGATCCTAAGGATGCTGGAAAAGCTCCCTTAAAGATATTTGCTCAGGATGGGGAAGGCCAA
CGCATTGACATCCAGATGAAGAACCGGATGGACGGCACATATGCATGCTCATACACCCCGGTGAAGGCCATCAAGCACACCATTGCTGTG
GTCTGGGGAGGCGTGAACATCCCGCACAGCCCCTACAGGGTCAACATCGGGCAAGGTAGCCATCCTCAGAAGGTCAAAGTGTTTGGGCCA
GGTGTGGAGAGAAGTGGTCTGAAGGCAAATGAACCTACACACTTCACGGTGGACTGTACTGAGGCTGGGGAAGGTGATGTCAGTGTTGGC
ATTAAGTGTGATGCCCGGGTGTTAAGTGAAGATGAGGAAGACGTGGATTTTGACATTATTCACAATGCCAATGATACGTTCACAGTCAAA
TATGTGCCTCCTGCTGCTGGGCGATACACTATCAAAGTTCTCTTTGCATCTCAGGAGGCCTTACATCGGGAACAAATGTTGGAACAGAAG
TTAGCCACGCTTCAGCGGCTACTAGCCATCACCCAAGAGGCTTCAGATACCAGTTGGCAGGCTTTAATAGATGAAGATAGACTCTTATCA
CGGTTAGAAGTTATGGGAAACCAATTACAGGCATGCTCCAAAAATCAAACAGAAGATAGTTTACGAAAGGAACTTATAGCATTACAAGAG
GATAAACATAACTATGAGACAACAGCCAAAGAGTCCCTGAGGCGGGTTCTTCAGGAGAAAATTGAAGTGGTTAGAAAACTTTCAGAAGTT
GAGCGAAGTCTGAGTAATACTGAAGATGAATGTACCCATCTGAAAGAAATGAATGAAAGGACTCAGGAAGAATTAAGAGAATTAGCCAAC
AAATATAATGGAGCAGTTAATGAGATTAAAGATTTATCTGATAAATTAAAGGTAGCAGAGGGAAAACAAGAGGAAATCCAACAGAAGGGA
CAGGCTGAGAAAAAAGAATTACAACATAAAATAGATGAAATGGAAGAAAAAGAACAGGAGCTCCAGGCAAAAATAGAAGCTTTGCAAGCT
GATAATGATTTCACCAATGAAAGGCTAACAGCTTTACAAGAGCACTTGCTTTCAAAGAGTGGCGGGGACTGCACTTTTATTCATCAATTC
ATAGAATGCCAGAAGAAGCTGATCGTCGAAGGGCATCTAACCAAAGCGGTAGAAGAAACAAAGCTTTCAAAAGAAAATCAGACAAGAGCA
AAAGAATCTGATTTTTCAGATACTCTGAGTCCAAGCAAGGAAAAAAGCAGTGACGACACTACAGACGCCCAAATGGATGAGCAAGACCTA
AATGAGCCTCTTGCCAAAGTGTCCCTTTTAAAAGATGACTTGCAGGGTGCACAGTCAGAAATTGAGGCAAAGCAAGAAATACAGCATCTT
CGAAAGGAATTGATCGAAGCCCAGGAGCTAGCTAGAACAAGTAAACAAAAATGCTTTGAACTTCAAGCTCTTTTGGAAGAAGAAAGAAAA
GCCTATCGAAATCAAGTTGAGGAATCCACTAAACAAATACAGGTTCTTCAAGCCCAATTGCAGAGGTTACACATCGATACTGAGAATCTC
CGGGAGGAGAAGGACAGTGAAATCACAAGTACTAGAGATGAATTGCTTAGTGCCCGAGATGAAATTTTGCTCCTTCATCAAGCAGCAGCA
AAGGTTGCCTCTGAGCGGGACACTGACATTGCTTCTTTACAAGAAGAGCTTAAGAAGGTGAGAGCTGAGCTTGAGCGGTGGCGGAAAGCA
GCGTCTGAATATGAGAAAGAAATCACAAGTCTGCAAAACAGTTTTCAGCTTAGATGTCAACAGTGTGAGGACCAGCAGAGAGAAGAAGCA
ACAAGGTTGCAAGGTGAACTAGAGAAGTTGAGAAAGGAATGGAATGCATTGGAAACCGAATGCCATTCTCTAAAAAGGGAAAATGTTTTG
CTATCATCAGAACTGCAACGGCAAGAAAAAGAATTGCACAATTCTCAGAAGCAGAGTTTAGAGCTTACCAGTGATCTCAGCATCCTTCAA
ATGTCTAGGAAAGAACTTGAGAATCAAGTGGGATCCTTGAAAGAACAGCATCTTCGGGATTCAGCTGATTTAAAAACTCTTCTCAGTAAG
GCAGAAAACCAAGCAAAGGATGTGCAGAAAGAGTATGAAAAGACACAGACTGTACTCTCAGAACTGAAGTTGAAGTTTGAAATGACTGAG
CAGGAAAAGCAGTCAATCACAGATGAGCTCAAACAGTGTAAAAACAACCTGAAGCTGCTCCGAGAGAAAGGAAATAATAAACCCTGGCCC

>In-frame_FLNB_ENST00000429972_chr3_58095897_+_SLMAP_ENST00000295951_chr3_57843460_+_4401nt
ATGCCGGTAACCGAGAAGGATCTAGCTGAGGACGCGCCTTGGAAGAAGATCCAGCAGAACACGTTCACACGCTGGTGCAACGAGCACCTC
AAGTGCGTGAACAAACGCATCGGCAACCTGCAGACCGACCTGAGCGACGGGCTGCGGCTCATCGCGCTGCTCGAGGTGCTCAGCCAGAAG
CGCATGTACCGCAAGTACCATCAGCGGCCCACCTTTCGCCAGATGCAGCTCGAGAATGTGTCCGTGGCGCTCGAGTTCCTGGACCGTGAG
AGCATCAAGCTCGTGTCCATCGATAGCAAAGCCATTGTGGATGGGAACCTGAAGCTCATCTTGGGTCTGGTGTGGACGCTGATCCTCCAC
TACTCCATCTCCATGCCCGTGTGGGAGGATGAAGGGGATGATGATGCCAAGAAGCAGACGCCAAAGCAGAGGCTGCTGGGGTGGATTCAG
AACAAGATCCCCTACTTGCCCATCACCAACTTTAACCAGAACTGGCAAGACGGCAAAGCCCTGGGAGCCCTGGTAGACAGCTGTGCTCCA
GGTCTGTGCCCAGACTGGGAATCCTGGGACCCGCAGAAGCCTGTGGATAATGCACGAGAAGCCATGCAGCAGGCAGATGACTGGCTGGGT
GTCCCACAGGTCATCACTCCTGAAGAAATCATTCACCCGGATGTGGACGAGCACTCAGTTATGACTTACCTGTCCCAGTTCCCCAAAGCC
AAGCTCAAGCCGGGGGCTCCTCTCAAACCCAAACTCAACCCGAAGAAAGCCAGGGCCTATGGCAGAGGAATCGAGCCCACTGGAAACATG
GTGAAGCAGCCAGCCAAGTTCACTGTGGACACCATCAGCGCCGGGCAAGGAGACGTGATGGTGTTTGTTGAGGACCCAGAAGGGAACAAA
GAGGAGGCACAAGTGACCCCTGACAGTGACAAGAACAAGACATACTCTGTGGAGTATCTGCCCAAGGTCACCGGGCTACACAAAGTCACA
GTCCTCTTTGCAGGACAGCACATCTCCAAGAGCCCATTTGAAGTGAGTGTTGACAAGGCCCAGGGAGATGCCAGTAAAGTCACTGCAAAA
GGTCCAGGGTTGGAAGCTGTAGGGAACATCGCCAATAAGCCCACCTACTTTGACATCTATACGGCAGGAGCTGGTGTGGGTGACATTGGT
GTGGAGGTGGAAGATCCCCAGGGGAAGAACACCGTGGAGTTGCTCGTGGAAGACAAAGGAAACCAGGTGTATCGATGTGTGTACAAACCC
ATGCAGCCTGGCCCTCACGTGGTCAAGATCTTCTTTGCTGGGGACACTATTCCTAAGAGTCCCTTCGTTGTGCAGGTTGGGGAAGCCTGC
AATCCAAATGCCTGCCGGGCCAGTGGCCGAGGCCTACAACCCAAAGGCGTCCGTATCCGGGAGACCACAGATTTCAAGGTTGACACCAAA
GCTGCAGGAAGTGGGGAGCTCGGTGTAACCATGAAGGGTCCTAAGGGTCTGGAGGAGCTGGTGAAGCAGAAAGACTTTCTGGATGGGGTC
TACGCATTCGAGTATTACCCCAGCACCCCGGGGAGATACAGCATTGCCATCACATGGGGGGGACACCACATTCCAAAGAGCCCCTTTGAA
GTTCAAGTTGGCCCTGAAGCGGGTATGCAGAAAGTCCGTGCTTGGGGCCCTGGGCTCCATGGTGGGATTGTCGGGCGGTCAGCGGACTTC
GTGGTAGAATCCATTGGCTCTGAAGTGGGGTCTCTGGGGTTTGCCATTGAAGGCCCCTCTCAGGCAAAGATTGAGTACAACGACCAGAAT
GATGGATCGTGTGATGTCAAATACTGGCCCAAGGAGCCTGGCGAATATGCTGTTCACATCATGTGTGACGACGAAGACATCAAGGACAGC
CCGTACATGGCCTTCATCCACCCAGCCACGGGAGGCTACAACCCTGATCTGGTTCGAGCATACGGGCCAGGTTTGGAGAAATCTGGATGC
ATTGTCAACAACCTGGCCGAGTTCACTGTGGATCCTAAGGATGCTGGAAAAGCTCCCTTAAAGATATTTGCTCAGGATGGGGAAGGCCAA
CGCATTGACATCCAGATGAAGAACCGGATGGACGGCACATATGCATGCTCATACACCCCGGTGAAGGCCATCAAGCACACCATTGCTGTG
GTCTGGGGAGGCGTGAACATCCCGCACAGCCCCTACAGGGTCAACATCGGGCAAGGTAGCCATCCTCAGAAGGTCAAAGTGTTTGGGCCA
GGTGTGGAGAGAAGTGGTCTGAAGGCAAATGAACCTACACACTTCACGGTGGACTGTACTGAGGCTGGGGAAGGTGATGTCAGTGTTGGC
ATTAAGTGTGATGCCCGGGTGTTAAGTGAAGATGAGGAAGACGTGGATTTTGACATTATTCACAATGCCAATGATACGTTCACAGTCAAA
TATGTGCCTCCTGCTGCTGGGCGATACACTATCAAAGTTCTCTTTGCATCTCAGGAGGCCTTACATCGGGAACAAATGTTGGAACAGAAG
TTAGCCACGCTTCAGCGGCTACTAGCCATCACCCAAGAGGCTTCAGATACCAGTTGGCAGGCTTTAATAGATGAAGATAGACTCTTATCA
CGGTTAGAAGTTATGGGAAACCAATTACAGGCATGCTCCAAAAATCAAACAGAAGATAGTTTACGAAAGGAACTTATAGCATTACAAGAG
GATAAACATAACTATGAGACAACAGCCAAAGAGTCCCTGAGGCGGGTTCTTCAGGAGAAAATTGAAGTGGTTAGAAAACTTTCAGAAGTT
GAGCGAAGTCTGAGTAATACTGAAGATGAATGTACCCATCTGAAAGAAATGAATGAAAGGACTCAGGAAGAATTAAGAGAATTAGCCAAC
AAATATAATGGAGCAGTTAATGAGATTAAAGATTTATCTGATAAATTAAAGGTAGCAGAGGGAAAACAAGAGGAAATCCAACAGAAGGGA
CAGGCTGAGAAAAAAGAATTACAACATAAAATAGATGAAATGGAAGAAAAAGAACAGGAGCTCCAGGCAAAAATAGAAGCTTTGCAAGCT
GATAATGATTTCACCAATGAAAGGCTAACAGCTTTACAAGAGCACTTGCTTTCAAAGAGTGGCGGGGACTGCACTTTTATTCATCAATTC
ATAGAATGCCAGAAGAAGCTGATCGTCGAAGGGCATCTAACCAAAGCGGTAGAAGAAACAAAGCTTTCAAAAGAAAATCAGACAAGAGCA
AAAGAATCTGATTTTTCAGATACTCTGAGTCCAAGCAAGGAAAAAAGCAGTGACGACACTACAGACGCCCAAATGGATGAGCAAGACCTA
AATGAGCCTCTTGCCAAAGTGTCCCTTTTAAAAGATGACTTGCAGGGTGCACAGTCAGAAATTGAGGCAAAGCAAGAAATACAGCATCTT
CGAAAGGAATTGATCGAAGCCCAGGAGCTAGCTAGAACAAGTAAACAAAAATGCTTTGAACTTCAAGCTCTTTTGGAAGAAGAAAGAAAA
GCCTATCGAAATCAAGTTGAGGAATCCACTAAACAAATACAGGTTCTTCAAGCCCAATTGCAGAGGTTACACATCGATACTGAGAATCTC
CGGGAGGAGAAGGACAGTGAAATCACAAGTACTAGAGATGAATTGCTTAGTGCCCGAGATGAAATTTTGCTCCTTCATCAAGCAGCAGCA
AAGGTTGCCTCTGAGCGGGACACTGACATTGCTTCTTTACAAGAAGAGCTTAAGAAGGTGAGAGCTGAGCTTGAGCGGTGGCGGAAAGCA
GCGTCTGAATATGAGAAAGAAATCACAAGTCTGCAAAACAGTTTTCAGCTTAGATGTCAACAGTGTGAGGACCAGCAGAGAGAAGAAGCA
ACAAGGTTGCAAGGTGAACTAGAGAAGTTGAGAAAGGAATGGAATGCATTGGAAACCGAATGCCATTCTCTAAAAAGGGAAAATGTTTTG
CTATCATCAGAACTGCAACGGCAAGAAAAAGAATTGCACAATTCTCAGAAGCAGAGTTTAGAGCTTACCAGTGATCTCAGCATCCTTCAA
ATGTCTAGGAAAGAACTTGAGAATCAAGTGGGATCCTTGAAAGAACAGCATCTTCGGGATTCAGCTGATTTAAAAACTCTTCTCAGTAAG
GCAGAAAACCAAGCAAAGGATGTGCAGAAAGAGTATGAAAAGACACAGACTGTACTCTCAGAACTGAAGTTGAAGTTTGAAATGACTGAG
CAGGAAAAGCAGTCAATCACAGATGAGCTCAAACAGTGTAAAAACAACCTGAAGCTGCTCCGAGAGAAAGGAAATAATAAACCCTGGCCC

>In-frame_FLNB_ENST00000295956_chr3_58095897_+_SLMAP_ENST00000295951_chr3_57843460_+_4401nt
ATGCCGGTAACCGAGAAGGATCTAGCTGAGGACGCGCCTTGGAAGAAGATCCAGCAGAACACGTTCACACGCTGGTGCAACGAGCACCTC
AAGTGCGTGAACAAACGCATCGGCAACCTGCAGACCGACCTGAGCGACGGGCTGCGGCTCATCGCGCTGCTCGAGGTGCTCAGCCAGAAG
CGCATGTACCGCAAGTACCATCAGCGGCCCACCTTTCGCCAGATGCAGCTCGAGAATGTGTCCGTGGCGCTCGAGTTCCTGGACCGTGAG
AGCATCAAGCTCGTGTCCATCGATAGCAAAGCCATTGTGGATGGGAACCTGAAGCTCATCTTGGGTCTGGTGTGGACGCTGATCCTCCAC
TACTCCATCTCCATGCCCGTGTGGGAGGATGAAGGGGATGATGATGCCAAGAAGCAGACGCCAAAGCAGAGGCTGCTGGGGTGGATTCAG
AACAAGATCCCCTACTTGCCCATCACCAACTTTAACCAGAACTGGCAAGACGGCAAAGCCCTGGGAGCCCTGGTAGACAGCTGTGCTCCA
GGTCTGTGCCCAGACTGGGAATCCTGGGACCCGCAGAAGCCTGTGGATAATGCACGAGAAGCCATGCAGCAGGCAGATGACTGGCTGGGT
GTCCCACAGGTCATCACTCCTGAAGAAATCATTCACCCGGATGTGGACGAGCACTCAGTTATGACTTACCTGTCCCAGTTCCCCAAAGCC
AAGCTCAAGCCGGGGGCTCCTCTCAAACCCAAACTCAACCCGAAGAAAGCCAGGGCCTATGGCAGAGGAATCGAGCCCACTGGAAACATG
GTGAAGCAGCCAGCCAAGTTCACTGTGGACACCATCAGCGCCGGGCAAGGAGACGTGATGGTGTTTGTTGAGGACCCAGAAGGGAACAAA
GAGGAGGCACAAGTGACCCCTGACAGTGACAAGAACAAGACATACTCTGTGGAGTATCTGCCCAAGGTCACCGGGCTACACAAAGTCACA
GTCCTCTTTGCAGGACAGCACATCTCCAAGAGCCCATTTGAAGTGAGTGTTGACAAGGCCCAGGGAGATGCCAGTAAAGTCACTGCAAAA
GGTCCAGGGTTGGAAGCTGTAGGGAACATCGCCAATAAGCCCACCTACTTTGACATCTATACGGCAGGAGCTGGTGTGGGTGACATTGGT
GTGGAGGTGGAAGATCCCCAGGGGAAGAACACCGTGGAGTTGCTCGTGGAAGACAAAGGAAACCAGGTGTATCGATGTGTGTACAAACCC
ATGCAGCCTGGCCCTCACGTGGTCAAGATCTTCTTTGCTGGGGACACTATTCCTAAGAGTCCCTTCGTTGTGCAGGTTGGGGAAGCCTGC
AATCCAAATGCCTGCCGGGCCAGTGGCCGAGGCCTACAACCCAAAGGCGTCCGTATCCGGGAGACCACAGATTTCAAGGTTGACACCAAA
GCTGCAGGAAGTGGGGAGCTCGGTGTAACCATGAAGGGTCCTAAGGGTCTGGAGGAGCTGGTGAAGCAGAAAGACTTTCTGGATGGGGTC
TACGCATTCGAGTATTACCCCAGCACCCCGGGGAGATACAGCATTGCCATCACATGGGGGGGACACCACATTCCAAAGAGCCCCTTTGAA
GTTCAAGTTGGCCCTGAAGCGGGTATGCAGAAAGTCCGTGCTTGGGGCCCTGGGCTCCATGGTGGGATTGTCGGGCGGTCAGCGGACTTC
GTGGTAGAATCCATTGGCTCTGAAGTGGGGTCTCTGGGGTTTGCCATTGAAGGCCCCTCTCAGGCAAAGATTGAGTACAACGACCAGAAT
GATGGATCGTGTGATGTCAAATACTGGCCCAAGGAGCCTGGCGAATATGCTGTTCACATCATGTGTGACGACGAAGACATCAAGGACAGC
CCGTACATGGCCTTCATCCACCCAGCCACGGGAGGCTACAACCCTGATCTGGTTCGAGCATACGGGCCAGGTTTGGAGAAATCTGGATGC
ATTGTCAACAACCTGGCCGAGTTCACTGTGGATCCTAAGGATGCTGGAAAAGCTCCCTTAAAGATATTTGCTCAGGATGGGGAAGGCCAA
CGCATTGACATCCAGATGAAGAACCGGATGGACGGCACATATGCATGCTCATACACCCCGGTGAAGGCCATCAAGCACACCATTGCTGTG
GTCTGGGGAGGCGTGAACATCCCGCACAGCCCCTACAGGGTCAACATCGGGCAAGGTAGCCATCCTCAGAAGGTCAAAGTGTTTGGGCCA
GGTGTGGAGAGAAGTGGTCTGAAGGCAAATGAACCTACACACTTCACGGTGGACTGTACTGAGGCTGGGGAAGGTGATGTCAGTGTTGGC
ATTAAGTGTGATGCCCGGGTGTTAAGTGAAGATGAGGAAGACGTGGATTTTGACATTATTCACAATGCCAATGATACGTTCACAGTCAAA
TATGTGCCTCCTGCTGCTGGGCGATACACTATCAAAGTTCTCTTTGCATCTCAGGAGGCCTTACATCGGGAACAAATGTTGGAACAGAAG
TTAGCCACGCTTCAGCGGCTACTAGCCATCACCCAAGAGGCTTCAGATACCAGTTGGCAGGCTTTAATAGATGAAGATAGACTCTTATCA
CGGTTAGAAGTTATGGGAAACCAATTACAGGCATGCTCCAAAAATCAAACAGAAGATAGTTTACGAAAGGAACTTATAGCATTACAAGAG
GATAAACATAACTATGAGACAACAGCCAAAGAGTCCCTGAGGCGGGTTCTTCAGGAGAAAATTGAAGTGGTTAGAAAACTTTCAGAAGTT
GAGCGAAGTCTGAGTAATACTGAAGATGAATGTACCCATCTGAAAGAAATGAATGAAAGGACTCAGGAAGAATTAAGAGAATTAGCCAAC
AAATATAATGGAGCAGTTAATGAGATTAAAGATTTATCTGATAAATTAAAGGTAGCAGAGGGAAAACAAGAGGAAATCCAACAGAAGGGA
CAGGCTGAGAAAAAAGAATTACAACATAAAATAGATGAAATGGAAGAAAAAGAACAGGAGCTCCAGGCAAAAATAGAAGCTTTGCAAGCT
GATAATGATTTCACCAATGAAAGGCTAACAGCTTTACAAGAGCACTTGCTTTCAAAGAGTGGCGGGGACTGCACTTTTATTCATCAATTC
ATAGAATGCCAGAAGAAGCTGATCGTCGAAGGGCATCTAACCAAAGCGGTAGAAGAAACAAAGCTTTCAAAAGAAAATCAGACAAGAGCA
AAAGAATCTGATTTTTCAGATACTCTGAGTCCAAGCAAGGAAAAAAGCAGTGACGACACTACAGACGCCCAAATGGATGAGCAAGACCTA
AATGAGCCTCTTGCCAAAGTGTCCCTTTTAAAAGATGACTTGCAGGGTGCACAGTCAGAAATTGAGGCAAAGCAAGAAATACAGCATCTT
CGAAAGGAATTGATCGAAGCCCAGGAGCTAGCTAGAACAAGTAAACAAAAATGCTTTGAACTTCAAGCTCTTTTGGAAGAAGAAAGAAAA
GCCTATCGAAATCAAGTTGAGGAATCCACTAAACAAATACAGGTTCTTCAAGCCCAATTGCAGAGGTTACACATCGATACTGAGAATCTC
CGGGAGGAGAAGGACAGTGAAATCACAAGTACTAGAGATGAATTGCTTAGTGCCCGAGATGAAATTTTGCTCCTTCATCAAGCAGCAGCA
AAGGTTGCCTCTGAGCGGGACACTGACATTGCTTCTTTACAAGAAGAGCTTAAGAAGGTGAGAGCTGAGCTTGAGCGGTGGCGGAAAGCA
GCGTCTGAATATGAGAAAGAAATCACAAGTCTGCAAAACAGTTTTCAGCTTAGATGTCAACAGTGTGAGGACCAGCAGAGAGAAGAAGCA
ACAAGGTTGCAAGGTGAACTAGAGAAGTTGAGAAAGGAATGGAATGCATTGGAAACCGAATGCCATTCTCTAAAAAGGGAAAATGTTTTG
CTATCATCAGAACTGCAACGGCAAGAAAAAGAATTGCACAATTCTCAGAAGCAGAGTTTAGAGCTTACCAGTGATCTCAGCATCCTTCAA
ATGTCTAGGAAAGAACTTGAGAATCAAGTGGGATCCTTGAAAGAACAGCATCTTCGGGATTCAGCTGATTTAAAAACTCTTCTCAGTAAG
GCAGAAAACCAAGCAAAGGATGTGCAGAAAGAGTATGAAAAGACACAGACTGTACTCTCAGAACTGAAGTTGAAGTTTGAAATGACTGAG
CAGGAAAAGCAGTCAATCACAGATGAGCTCAAACAGTGTAAAAACAACCTGAAGCTGCTCCGAGAGAAAGGAAATAATAAACCCTGGCCC

>In-frame_FLNB_ENST00000358537_chr3_58095897_+_SLMAP_ENST00000295951_chr3_57843460_+_4401nt
ATGCCGGTAACCGAGAAGGATCTAGCTGAGGACGCGCCTTGGAAGAAGATCCAGCAGAACACGTTCACACGCTGGTGCAACGAGCACCTC
AAGTGCGTGAACAAACGCATCGGCAACCTGCAGACCGACCTGAGCGACGGGCTGCGGCTCATCGCGCTGCTCGAGGTGCTCAGCCAGAAG
CGCATGTACCGCAAGTACCATCAGCGGCCCACCTTTCGCCAGATGCAGCTCGAGAATGTGTCCGTGGCGCTCGAGTTCCTGGACCGTGAG
AGCATCAAGCTCGTGTCCATCGATAGCAAAGCCATTGTGGATGGGAACCTGAAGCTCATCTTGGGTCTGGTGTGGACGCTGATCCTCCAC
TACTCCATCTCCATGCCCGTGTGGGAGGATGAAGGGGATGATGATGCCAAGAAGCAGACGCCAAAGCAGAGGCTGCTGGGGTGGATTCAG
AACAAGATCCCCTACTTGCCCATCACCAACTTTAACCAGAACTGGCAAGACGGCAAAGCCCTGGGAGCCCTGGTAGACAGCTGTGCTCCA
GGTCTGTGCCCAGACTGGGAATCCTGGGACCCGCAGAAGCCTGTGGATAATGCACGAGAAGCCATGCAGCAGGCAGATGACTGGCTGGGT
GTCCCACAGGTCATCACTCCTGAAGAAATCATTCACCCGGATGTGGACGAGCACTCAGTTATGACTTACCTGTCCCAGTTCCCCAAAGCC
AAGCTCAAGCCGGGGGCTCCTCTCAAACCCAAACTCAACCCGAAGAAAGCCAGGGCCTATGGCAGAGGAATCGAGCCCACTGGAAACATG
GTGAAGCAGCCAGCCAAGTTCACTGTGGACACCATCAGCGCCGGGCAAGGAGACGTGATGGTGTTTGTTGAGGACCCAGAAGGGAACAAA
GAGGAGGCACAAGTGACCCCTGACAGTGACAAGAACAAGACATACTCTGTGGAGTATCTGCCCAAGGTCACCGGGCTACACAAAGTCACA
GTCCTCTTTGCAGGACAGCACATCTCCAAGAGCCCATTTGAAGTGAGTGTTGACAAGGCCCAGGGAGATGCCAGTAAAGTCACTGCAAAA
GGTCCAGGGTTGGAAGCTGTAGGGAACATCGCCAATAAGCCCACCTACTTTGACATCTATACGGCAGGAGCTGGTGTGGGTGACATTGGT
GTGGAGGTGGAAGATCCCCAGGGGAAGAACACCGTGGAGTTGCTCGTGGAAGACAAAGGAAACCAGGTGTATCGATGTGTGTACAAACCC
ATGCAGCCTGGCCCTCACGTGGTCAAGATCTTCTTTGCTGGGGACACTATTCCTAAGAGTCCCTTCGTTGTGCAGGTTGGGGAAGCCTGC
AATCCAAATGCCTGCCGGGCCAGTGGCCGAGGCCTACAACCCAAAGGCGTCCGTATCCGGGAGACCACAGATTTCAAGGTTGACACCAAA
GCTGCAGGAAGTGGGGAGCTCGGTGTAACCATGAAGGGTCCTAAGGGTCTGGAGGAGCTGGTGAAGCAGAAAGACTTTCTGGATGGGGTC
TACGCATTCGAGTATTACCCCAGCACCCCGGGGAGATACAGCATTGCCATCACATGGGGGGGACACCACATTCCAAAGAGCCCCTTTGAA
GTTCAAGTTGGCCCTGAAGCGGGTATGCAGAAAGTCCGTGCTTGGGGCCCTGGGCTCCATGGTGGGATTGTCGGGCGGTCAGCGGACTTC
GTGGTAGAATCCATTGGCTCTGAAGTGGGGTCTCTGGGGTTTGCCATTGAAGGCCCCTCTCAGGCAAAGATTGAGTACAACGACCAGAAT
GATGGATCGTGTGATGTCAAATACTGGCCCAAGGAGCCTGGCGAATATGCTGTTCACATCATGTGTGACGACGAAGACATCAAGGACAGC
CCGTACATGGCCTTCATCCACCCAGCCACGGGAGGCTACAACCCTGATCTGGTTCGAGCATACGGGCCAGGTTTGGAGAAATCTGGATGC
ATTGTCAACAACCTGGCCGAGTTCACTGTGGATCCTAAGGATGCTGGAAAAGCTCCCTTAAAGATATTTGCTCAGGATGGGGAAGGCCAA
CGCATTGACATCCAGATGAAGAACCGGATGGACGGCACATATGCATGCTCATACACCCCGGTGAAGGCCATCAAGCACACCATTGCTGTG
GTCTGGGGAGGCGTGAACATCCCGCACAGCCCCTACAGGGTCAACATCGGGCAAGGTAGCCATCCTCAGAAGGTCAAAGTGTTTGGGCCA
GGTGTGGAGAGAAGTGGTCTGAAGGCAAATGAACCTACACACTTCACGGTGGACTGTACTGAGGCTGGGGAAGGTGATGTCAGTGTTGGC
ATTAAGTGTGATGCCCGGGTGTTAAGTGAAGATGAGGAAGACGTGGATTTTGACATTATTCACAATGCCAATGATACGTTCACAGTCAAA
TATGTGCCTCCTGCTGCTGGGCGATACACTATCAAAGTTCTCTTTGCATCTCAGGAGGCCTTACATCGGGAACAAATGTTGGAACAGAAG
TTAGCCACGCTTCAGCGGCTACTAGCCATCACCCAAGAGGCTTCAGATACCAGTTGGCAGGCTTTAATAGATGAAGATAGACTCTTATCA
CGGTTAGAAGTTATGGGAAACCAATTACAGGCATGCTCCAAAAATCAAACAGAAGATAGTTTACGAAAGGAACTTATAGCATTACAAGAG
GATAAACATAACTATGAGACAACAGCCAAAGAGTCCCTGAGGCGGGTTCTTCAGGAGAAAATTGAAGTGGTTAGAAAACTTTCAGAAGTT
GAGCGAAGTCTGAGTAATACTGAAGATGAATGTACCCATCTGAAAGAAATGAATGAAAGGACTCAGGAAGAATTAAGAGAATTAGCCAAC
AAATATAATGGAGCAGTTAATGAGATTAAAGATTTATCTGATAAATTAAAGGTAGCAGAGGGAAAACAAGAGGAAATCCAACAGAAGGGA
CAGGCTGAGAAAAAAGAATTACAACATAAAATAGATGAAATGGAAGAAAAAGAACAGGAGCTCCAGGCAAAAATAGAAGCTTTGCAAGCT
GATAATGATTTCACCAATGAAAGGCTAACAGCTTTACAAGAGCACTTGCTTTCAAAGAGTGGCGGGGACTGCACTTTTATTCATCAATTC
ATAGAATGCCAGAAGAAGCTGATCGTCGAAGGGCATCTAACCAAAGCGGTAGAAGAAACAAAGCTTTCAAAAGAAAATCAGACAAGAGCA
AAAGAATCTGATTTTTCAGATACTCTGAGTCCAAGCAAGGAAAAAAGCAGTGACGACACTACAGACGCCCAAATGGATGAGCAAGACCTA
AATGAGCCTCTTGCCAAAGTGTCCCTTTTAAAAGATGACTTGCAGGGTGCACAGTCAGAAATTGAGGCAAAGCAAGAAATACAGCATCTT
CGAAAGGAATTGATCGAAGCCCAGGAGCTAGCTAGAACAAGTAAACAAAAATGCTTTGAACTTCAAGCTCTTTTGGAAGAAGAAAGAAAA
GCCTATCGAAATCAAGTTGAGGAATCCACTAAACAAATACAGGTTCTTCAAGCCCAATTGCAGAGGTTACACATCGATACTGAGAATCTC
CGGGAGGAGAAGGACAGTGAAATCACAAGTACTAGAGATGAATTGCTTAGTGCCCGAGATGAAATTTTGCTCCTTCATCAAGCAGCAGCA
AAGGTTGCCTCTGAGCGGGACACTGACATTGCTTCTTTACAAGAAGAGCTTAAGAAGGTGAGAGCTGAGCTTGAGCGGTGGCGGAAAGCA
GCGTCTGAATATGAGAAAGAAATCACAAGTCTGCAAAACAGTTTTCAGCTTAGATGTCAACAGTGTGAGGACCAGCAGAGAGAAGAAGCA
ACAAGGTTGCAAGGTGAACTAGAGAAGTTGAGAAAGGAATGGAATGCATTGGAAACCGAATGCCATTCTCTAAAAAGGGAAAATGTTTTG
CTATCATCAGAACTGCAACGGCAAGAAAAAGAATTGCACAATTCTCAGAAGCAGAGTTTAGAGCTTACCAGTGATCTCAGCATCCTTCAA
ATGTCTAGGAAAGAACTTGAGAATCAAGTGGGATCCTTGAAAGAACAGCATCTTCGGGATTCAGCTGATTTAAAAACTCTTCTCAGTAAG
GCAGAAAACCAAGCAAAGGATGTGCAGAAAGAGTATGAAAAGACACAGACTGTACTCTCAGAACTGAAGTTGAAGTTTGAAATGACTGAG
CAGGAAAAGCAGTCAATCACAGATGAGCTCAAACAGTGTAAAAACAACCTGAAGCTGCTCCGAGAGAAAGGAAATAATAAACCCTGGCCC

>In-frame_FLNB_ENST00000357272_chr3_58095897_+_SLMAP_ENST00000295951_chr3_57843460_+_4401nt
ATGCCGGTAACCGAGAAGGATCTAGCTGAGGACGCGCCTTGGAAGAAGATCCAGCAGAACACGTTCACACGCTGGTGCAACGAGCACCTC
AAGTGCGTGAACAAACGCATCGGCAACCTGCAGACCGACCTGAGCGACGGGCTGCGGCTCATCGCGCTGCTCGAGGTGCTCAGCCAGAAG
CGCATGTACCGCAAGTACCATCAGCGGCCCACCTTTCGCCAGATGCAGCTCGAGAATGTGTCCGTGGCGCTCGAGTTCCTGGACCGTGAG
AGCATCAAGCTCGTGTCCATCGATAGCAAAGCCATTGTGGATGGGAACCTGAAGCTCATCTTGGGTCTGGTGTGGACGCTGATCCTCCAC
TACTCCATCTCCATGCCCGTGTGGGAGGATGAAGGGGATGATGATGCCAAGAAGCAGACGCCAAAGCAGAGGCTGCTGGGGTGGATTCAG
AACAAGATCCCCTACTTGCCCATCACCAACTTTAACCAGAACTGGCAAGACGGCAAAGCCCTGGGAGCCCTGGTAGACAGCTGTGCTCCA
GGTCTGTGCCCAGACTGGGAATCCTGGGACCCGCAGAAGCCTGTGGATAATGCACGAGAAGCCATGCAGCAGGCAGATGACTGGCTGGGT
GTCCCACAGGTCATCACTCCTGAAGAAATCATTCACCCGGATGTGGACGAGCACTCAGTTATGACTTACCTGTCCCAGTTCCCCAAAGCC
AAGCTCAAGCCGGGGGCTCCTCTCAAACCCAAACTCAACCCGAAGAAAGCCAGGGCCTATGGCAGAGGAATCGAGCCCACTGGAAACATG
GTGAAGCAGCCAGCCAAGTTCACTGTGGACACCATCAGCGCCGGGCAAGGAGACGTGATGGTGTTTGTTGAGGACCCAGAAGGGAACAAA
GAGGAGGCACAAGTGACCCCTGACAGTGACAAGAACAAGACATACTCTGTGGAGTATCTGCCCAAGGTCACCGGGCTACACAAAGTCACA
GTCCTCTTTGCAGGACAGCACATCTCCAAGAGCCCATTTGAAGTGAGTGTTGACAAGGCCCAGGGAGATGCCAGTAAAGTCACTGCAAAA
GGTCCAGGGTTGGAAGCTGTAGGGAACATCGCCAATAAGCCCACCTACTTTGACATCTATACGGCAGGAGCTGGTGTGGGTGACATTGGT
GTGGAGGTGGAAGATCCCCAGGGGAAGAACACCGTGGAGTTGCTCGTGGAAGACAAAGGAAACCAGGTGTATCGATGTGTGTACAAACCC
ATGCAGCCTGGCCCTCACGTGGTCAAGATCTTCTTTGCTGGGGACACTATTCCTAAGAGTCCCTTCGTTGTGCAGGTTGGGGAAGCCTGC
AATCCAAATGCCTGCCGGGCCAGTGGCCGAGGCCTACAACCCAAAGGCGTCCGTATCCGGGAGACCACAGATTTCAAGGTTGACACCAAA
GCTGCAGGAAGTGGGGAGCTCGGTGTAACCATGAAGGGTCCTAAGGGTCTGGAGGAGCTGGTGAAGCAGAAAGACTTTCTGGATGGGGTC
TACGCATTCGAGTATTACCCCAGCACCCCGGGGAGATACAGCATTGCCATCACATGGGGGGGACACCACATTCCAAAGAGCCCCTTTGAA
GTTCAAGTTGGCCCTGAAGCGGGTATGCAGAAAGTCCGTGCTTGGGGCCCTGGGCTCCATGGTGGGATTGTCGGGCGGTCAGCGGACTTC
GTGGTAGAATCCATTGGCTCTGAAGTGGGGTCTCTGGGGTTTGCCATTGAAGGCCCCTCTCAGGCAAAGATTGAGTACAACGACCAGAAT
GATGGATCGTGTGATGTCAAATACTGGCCCAAGGAGCCTGGCGAATATGCTGTTCACATCATGTGTGACGACGAAGACATCAAGGACAGC
CCGTACATGGCCTTCATCCACCCAGCCACGGGAGGCTACAACCCTGATCTGGTTCGAGCATACGGGCCAGGTTTGGAGAAATCTGGATGC
ATTGTCAACAACCTGGCCGAGTTCACTGTGGATCCTAAGGATGCTGGAAAAGCTCCCTTAAAGATATTTGCTCAGGATGGGGAAGGCCAA
CGCATTGACATCCAGATGAAGAACCGGATGGACGGCACATATGCATGCTCATACACCCCGGTGAAGGCCATCAAGCACACCATTGCTGTG
GTCTGGGGAGGCGTGAACATCCCGCACAGCCCCTACAGGGTCAACATCGGGCAAGGTAGCCATCCTCAGAAGGTCAAAGTGTTTGGGCCA
GGTGTGGAGAGAAGTGGTCTGAAGGCAAATGAACCTACACACTTCACGGTGGACTGTACTGAGGCTGGGGAAGGTGATGTCAGTGTTGGC
ATTAAGTGTGATGCCCGGGTGTTAAGTGAAGATGAGGAAGACGTGGATTTTGACATTATTCA