FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13400

FusionGeneSummary for FGFR2_C10orf118

check button Fusion gene summary
Fusion gene informationFusion gene name: FGFR2_C10orf118
Fusion gene ID: 13400
HgeneTgene
Gene symbol

FGFR2

C10orf118

Gene ID

2263

55088

Gene namefibroblast growth factor receptor 2coiled-coil domain containing 186
SynonymsBBDS|BEK|BFR-1|CD332|CEK3|CFD1|ECT1|JWS|K-SAM|KGFR|TK14|TK25C10orf118
Cytomap

10q26.13

10q25.3

Type of geneprotein-codingprotein-coding
Descriptionfibroblast growth factor receptor 2BEK fibroblast growth factor receptorbacteria-expressed kinasekeratinocyte growth factor receptorprotein tyrosine kinase, receptor like 14coiled-coil domain-containing protein 186CTCL tumor antigen HD-CL-01/L14-2CTCL tumor antigen L14-2
Modification date2018052720180519
UniProtAcc

P21802

Ensembl transtripts involved in fusion geneENST00000369061, ENST00000357555, 
ENST00000358487, ENST00000356226, 
ENST00000369060, ENST00000369059, 
ENST00000346997, ENST00000457416, 
ENST00000351936, ENST00000360144, 
ENST00000369056, ENST00000490349, 
ENST00000359354, ENST00000478859, 
ENST00000369287, ENST00000543782, 
ENST00000497592, ENST00000369285, 
ENST00000369286, 
Fusion gene scores* DoF score18 X 10 X 9=16201 X 1 X 1=1
# samples 241
** MAII scorelog2(24/1620*10)=-2.75488750216347
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: FGFR2 [Title/Abstract] AND C10orf118 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFGFR2

GO:0008284

positive regulation of cell proliferation

8663044

HgeneFGFR2

GO:0008543

fibroblast growth factor receptor signaling pathway

8663044|15629145

HgeneFGFR2

GO:0018108

peptidyl-tyrosine phosphorylation

15629145|16844695

HgeneFGFR2

GO:0046777

protein autophosphorylation

15629145


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCHOLTCGA-W5-AA2Z-01AFGFR2chr10

123243212

-C10orf118chr10

115910979

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000369061ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369061ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369061ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369061ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369061ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-
Frame-shitENST00000357555ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000357555ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000357555ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000357555ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000357555ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-
Frame-shitENST00000358487ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000358487ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000358487ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000358487ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000358487ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-
Frame-shitENST00000356226ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000356226ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000356226ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000356226ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000356226ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-
Frame-shitENST00000369060ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369060ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369060ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369060ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369060ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-
Frame-shitENST00000369059ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369059ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369059ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369059ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369059ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-
In-frameENST00000346997ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000346997ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000346997ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000346997ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000346997ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-
Frame-shitENST00000457416ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000457416ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000457416ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000457416ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000457416ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-
Frame-shitENST00000351936ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000351936ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000351936ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000351936ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000351936ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-
Frame-shitENST00000360144ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000360144ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000360144ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000360144ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000360144ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-
In-frameENST00000369056ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369056ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369056ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369056ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000369056ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-
intron-3CDSENST00000490349ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
intron-intronENST00000490349ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
intron-intronENST00000490349ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
intron-intronENST00000490349ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
intron-intronENST00000490349ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-
intron-3CDSENST00000359354ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
intron-intronENST00000359354ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
intron-intronENST00000359354ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
intron-intronENST00000359354ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
intron-intronENST00000359354ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-
Frame-shitENST00000478859ENST00000369287FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000478859ENST00000543782FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000478859ENST00000497592FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000478859ENST00000369285FGFR2chr10

123243212

-C10orf118chr10

115910979

-
5CDS-intronENST00000478859ENST00000369286FGFR2chr10

123243212

-C10orf118chr10

115910979

-

Top

FusionProtFeatures for FGFR2_C10orf118


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FGFR2

P21802

C10orf118

Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFGFR2chr10:123243212chr10:115910979ENST00000346997-1617154_247765820DomainNote=Ig-like C2-type 2
HgeneFGFR2chr10:123243212chr10:115910979ENST00000346997-1617256_358765820DomainNote=Ig-like C2-type 3
HgeneFGFR2chr10:123243212chr10:115910979ENST00000346997-161725_125765820DomainNote=Ig-like C2-type 1
HgeneFGFR2chr10:123243212chr10:115910979ENST00000351936-1718154_247765786DomainNote=Ig-like C2-type 2
HgeneFGFR2chr10:123243212chr10:115910979ENST00000351936-1718256_358765786DomainNote=Ig-like C2-type 3
HgeneFGFR2chr10:123243212chr10:115910979ENST00000351936-171825_125765786DomainNote=Ig-like C2-type 1
HgeneFGFR2chr10:123243212chr10:115910979ENST00000356226-1516154_247650705DomainNote=Ig-like C2-type 2
HgeneFGFR2chr10:123243212chr10:115910979ENST00000356226-1516256_358650705DomainNote=Ig-like C2-type 3
HgeneFGFR2chr10:123243212chr10:115910979ENST00000356226-151625_125650705DomainNote=Ig-like C2-type 1
HgeneFGFR2chr10:123243212chr10:115910979ENST00000357555-1617154_247678708DomainNote=Ig-like C2-type 2
HgeneFGFR2chr10:123243212chr10:115910979ENST00000357555-1617256_358678708DomainNote=Ig-like C2-type 3
HgeneFGFR2chr10:123243212chr10:115910979ENST00000357555-161725_125678708DomainNote=Ig-like C2-type 1
HgeneFGFR2chr10:123243212chr10:115910979ENST00000358487-1718154_247767822DomainNote=Ig-like C2-type 2
HgeneFGFR2chr10:123243212chr10:115910979ENST00000358487-1718256_358767822DomainNote=Ig-like C2-type 3
HgeneFGFR2chr10:123243212chr10:115910979ENST00000358487-171825_125767822DomainNote=Ig-like C2-type 1
HgeneFGFR2chr10:123243212chr10:115910979ENST00000358487-1718481_770767822DomainProtein kinase
HgeneFGFR2chr10:123243212chr10:115910979ENST00000360144-1617154_247679681DomainNote=Ig-like C2-type 2
HgeneFGFR2chr10:123243212chr10:115910979ENST00000360144-1617256_358679681DomainNote=Ig-like C2-type 3
HgeneFGFR2chr10:123243212chr10:115910979ENST00000360144-161725_125679681DomainNote=Ig-like C2-type 1
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369056-1617154_247768770DomainNote=Ig-like C2-type 2
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369056-1617256_358768770DomainNote=Ig-like C2-type 3
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369056-161725_125768770DomainNote=Ig-like C2-type 1
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369056-1617481_770768770DomainProtein kinase
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369060-1516154_247651706DomainNote=Ig-like C2-type 2
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369060-1516256_358651706DomainNote=Ig-like C2-type 3
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369060-151625_125651706DomainNote=Ig-like C2-type 1
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369061-1415154_247655710DomainNote=Ig-like C2-type 2
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369061-1415256_358655710DomainNote=Ig-like C2-type 3
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369061-141525_125655710DomainNote=Ig-like C2-type 1
HgeneFGFR2chr10:123243212chr10:115910979ENST00000457416-1718154_247768823DomainNote=Ig-like C2-type 2
HgeneFGFR2chr10:123243212chr10:115910979ENST00000457416-1718256_358768823DomainNote=Ig-like C2-type 3
HgeneFGFR2chr10:123243212chr10:115910979ENST00000457416-171825_125768823DomainNote=Ig-like C2-type 1
HgeneFGFR2chr10:123243212chr10:115910979ENST00000457416-1718481_770768823DomainProtein kinase
HgeneFGFR2chr10:123243212chr10:115910979ENST00000346997-1617487_495765820Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000346997-1617565_567765820Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000351936-1718487_495765786Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000351936-1718565_567765786Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000356226-1516487_495650705Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000356226-1516565_567650705Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000357555-1617487_495678708Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000357555-1617565_567678708Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000358487-1718487_495767822Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000358487-1718565_567767822Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000360144-1617487_495679681Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000360144-1617565_567679681Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369056-1617487_495768770Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369056-1617565_567768770Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369060-1516487_495651706Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369060-1516565_567651706Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369061-1415487_495655710Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369061-1415565_567655710Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000457416-1718487_495768823Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000457416-1718565_567768823Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000346997-1617161_178765820RegionNote=Heparin-binding
HgeneFGFR2chr10:123243212chr10:115910979ENST00000351936-1718161_178765786RegionNote=Heparin-binding
HgeneFGFR2chr10:123243212chr10:115910979ENST00000356226-1516161_178650705RegionNote=Heparin-binding
HgeneFGFR2chr10:123243212chr10:115910979ENST00000357555-1617161_178678708RegionNote=Heparin-binding
HgeneFGFR2chr10:123243212chr10:115910979ENST00000358487-1718161_178767822RegionNote=Heparin-binding
HgeneFGFR2chr10:123243212chr10:115910979ENST00000360144-1617161_178679681RegionNote=Heparin-binding
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369056-1617161_178768770RegionNote=Heparin-binding
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369060-1516161_178651706RegionNote=Heparin-binding
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369061-1415161_178655710RegionNote=Heparin-binding
HgeneFGFR2chr10:123243212chr10:115910979ENST00000457416-1718161_178768823RegionNote=Heparin-binding
HgeneFGFR2chr10:123243212chr10:115910979ENST00000346997-161722_377765820Topological domainExtracellular
HgeneFGFR2chr10:123243212chr10:115910979ENST00000351936-171822_377765786Topological domainExtracellular
HgeneFGFR2chr10:123243212chr10:115910979ENST00000356226-151622_377650705Topological domainExtracellular
HgeneFGFR2chr10:123243212chr10:115910979ENST00000357555-161722_377678708Topological domainExtracellular
HgeneFGFR2chr10:123243212chr10:115910979ENST00000358487-171822_377767822Topological domainExtracellular
HgeneFGFR2chr10:123243212chr10:115910979ENST00000360144-161722_377679681Topological domainExtracellular
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369056-161722_377768770Topological domainExtracellular
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369060-151622_377651706Topological domainExtracellular
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369061-141522_377655710Topological domainExtracellular
HgeneFGFR2chr10:123243212chr10:115910979ENST00000457416-171822_377768823Topological domainExtracellular
HgeneFGFR2chr10:123243212chr10:115910979ENST00000346997-1617378_398765820TransmembraneHelical
HgeneFGFR2chr10:123243212chr10:115910979ENST00000351936-1718378_398765786TransmembraneHelical
HgeneFGFR2chr10:123243212chr10:115910979ENST00000356226-1516378_398650705TransmembraneHelical
HgeneFGFR2chr10:123243212chr10:115910979ENST00000357555-1617378_398678708TransmembraneHelical
HgeneFGFR2chr10:123243212chr10:115910979ENST00000358487-1718378_398767822TransmembraneHelical
HgeneFGFR2chr10:123243212chr10:115910979ENST00000360144-1617378_398679681TransmembraneHelical
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369056-1617378_398768770TransmembraneHelical
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369060-1516378_398651706TransmembraneHelical
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369061-1415378_398655710TransmembraneHelical
HgeneFGFR2chr10:123243212chr10:115910979ENST00000457416-1718378_398768823TransmembraneHelical
TgeneC10orf118chr10:123243212chr10:115910979ENST00000369285-03201_712-125212Coiled coilOntology_term=ECO:0000255
TgeneC10orf118chr10:123243212chr10:115910979ENST00000369285-03759_803-125212Coiled coilOntology_term=ECO:0000255
TgeneC10orf118chr10:123243212chr10:115910979ENST00000369285-03855_894-125212Coiled coilOntology_term=ECO:0000255
TgeneC10orf118chr10:123243212chr10:115910979ENST00000369286-02201_712-89212Coiled coilOntology_term=ECO:0000255
TgeneC10orf118chr10:123243212chr10:115910979ENST00000369286-02759_803-89212Coiled coilOntology_term=ECO:0000255
TgeneC10orf118chr10:123243212chr10:115910979ENST00000369286-02855_894-89212Coiled coilOntology_term=ECO:0000255
TgeneC10orf118chr10:123243212chr10:115910979ENST00000369287-216759_803253899Coiled coilOntology_term=ECO:0000255
TgeneC10orf118chr10:123243212chr10:115910979ENST00000369287-216855_894253899Coiled coilOntology_term=ECO:0000255
TgeneC10orf118chr10:123243212chr10:115910979ENST00000369285-03710_747-125212Compositional biasNote=Ser-rich
TgeneC10orf118chr10:123243212chr10:115910979ENST00000369286-02710_747-89212Compositional biasNote=Ser-rich
TgeneC10orf118chr10:123243212chr10:115910979ENST00000369287-216710_747253899Compositional biasNote=Ser-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFGFR2chr10:123243212chr10:115910979ENST00000346997-1617481_770765820DomainProtein kinase
HgeneFGFR2chr10:123243212chr10:115910979ENST00000351936-1718481_770765786DomainProtein kinase
HgeneFGFR2chr10:123243212chr10:115910979ENST00000356226-1516481_770650705DomainProtein kinase
HgeneFGFR2chr10:123243212chr10:115910979ENST00000357555-1617481_770678708DomainProtein kinase
HgeneFGFR2chr10:123243212chr10:115910979ENST00000359354-17154_247-163255DomainNote=Ig-like C2-type 2
HgeneFGFR2chr10:123243212chr10:115910979ENST00000359354-17256_358-163255DomainNote=Ig-like C2-type 3
HgeneFGFR2chr10:123243212chr10:115910979ENST00000359354-1725_125-163255DomainNote=Ig-like C2-type 1
HgeneFGFR2chr10:123243212chr10:115910979ENST00000359354-17481_770-163255DomainProtein kinase
HgeneFGFR2chr10:123243212chr10:115910979ENST00000360144-1617481_770679681DomainProtein kinase
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369060-1516481_770651706DomainProtein kinase
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369061-1415481_770655710DomainProtein kinase
HgeneFGFR2chr10:123243212chr10:115910979ENST00000359354-17487_495-163255Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000359354-17565_567-163255Nucleotide bindingATP
HgeneFGFR2chr10:123243212chr10:115910979ENST00000359354-17161_178-163255RegionNote=Heparin-binding
HgeneFGFR2chr10:123243212chr10:115910979ENST00000346997-1617399_821765820Topological domainCytoplasmic
HgeneFGFR2chr10:123243212chr10:115910979ENST00000351936-1718399_821765786Topological domainCytoplasmic
HgeneFGFR2chr10:123243212chr10:115910979ENST00000356226-1516399_821650705Topological domainCytoplasmic
HgeneFGFR2chr10:123243212chr10:115910979ENST00000357555-1617399_821678708Topological domainCytoplasmic
HgeneFGFR2chr10:123243212chr10:115910979ENST00000358487-1718399_821767822Topological domainCytoplasmic
HgeneFGFR2chr10:123243212chr10:115910979ENST00000359354-1722_377-163255Topological domainExtracellular
HgeneFGFR2chr10:123243212chr10:115910979ENST00000359354-17399_821-163255Topological domainCytoplasmic
HgeneFGFR2chr10:123243212chr10:115910979ENST00000360144-1617399_821679681Topological domainCytoplasmic
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369056-1617399_821768770Topological domainCytoplasmic
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369060-1516399_821651706Topological domainCytoplasmic
HgeneFGFR2chr10:123243212chr10:115910979ENST00000369061-1415399_821655710Topological domainCytoplasmic
HgeneFGFR2chr10:123243212chr10:115910979ENST00000457416-1718399_821768823Topological domainCytoplasmic
HgeneFGFR2chr10:123243212chr10:115910979ENST00000359354-17378_398-163255TransmembraneHelical
TgeneC10orf118chr10:123243212chr10:115910979ENST00000369287-216201_712253899Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for FGFR2_C10orf118


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FGFR2_ENST00000369061_chr10_123243212_-_C10orf118_ENST00000369287_chr10_115910979_-_1301aa
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE
YLQIKGATPRDSGLTACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP
AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNTTCVVENEYGSINHTYHLDVVAPGREKEITASPDYLEIAIYC
IGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSETELPEDP
KWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLTV
IVETASKGNLREYLRARRPPGMEYSTDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDIN
NIDTYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHA
VPSQRPTFKQLVEDLDRILTLTTNELESRIEELNKEVKASRDQLIAQDVTAKNAVQQLHKEMAQRMEQANKKCEEARQEKEAMVMKTVRG
EKESLDLRKEKETLEKKLRDANKELEKNTNKIKQLSQEKGRLHQLTETKEGETTRLIREIDKLKEDINSHVIKVKWAQNKLKAEMDSHKE
TKDKLKETTTKLTQAKEEADQIRKNCQDMIKTTQESEEIKSNELDAKLRVTKGELEKQMQEKSDQLEMHHAKIKELEDLKRTFKEGMDEL
RTLRTKVKCLEDERLRTEDELSKTKEIINRQKAEIQNLLDKVKTADQLQEQLQRGKQEIENLKEEVESLNSLINDLQKDIEGSRKRESEL
LLFTERLTSKNAQLQSESNSLQSQFDKVSCSESQLQSQCEQMKQTNINLESRLLKEEELRKEEVQTLQAELACRQTEVKALSTQVEELKD
ELVTQRRKHASSIKDLTKQLQQARRKLDQVESGSTDKEVSSMGSRSSSSGSLNARSSAEDRSPENTGSSVAVDNFPQVDKAMLIERIVRL
QKAHARKNEKIEFMEDHIKQLVEEIRKKTKIIQSTILREESGTLSSEASDFNKVHLSRRGGIMASLTTSHPADNGLTLELSLEINRKLQA

>In-frame_FGFR2_ENST00000346997_chr10_123243212_-_C10orf118_ENST00000369287_chr10_115910979_-_1411aa
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE
YLQIKGATPRDSGLTACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP
AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNTTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVV
GGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLTIRNVTFEDAGETTCLAGNSIGISFHSAWLTVL
PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVSAESSSSMNSNTPLVRITTRLS
STADTPMLAGVSETELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIG
KHKNIINLLGACTQDGPLTVIVETASKGNLREYLRARRPPGMEYSTDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNV
LVTENNVMKIADFGLARDINNIDTYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRM
DKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNELESRIEELNKEVKASRDQLIAQDVTAKNAVQQLHKEMAQRMEQAN
KKCEEARQEKEAMVMKTVRGEKESLDLRKEKETLEKKLRDANKELEKNTNKIKQLSQEKGRLHQLTETKEGETTRLIREIDKLKEDINSH
VIKVKWAQNKLKAEMDSHKETKDKLKETTTKLTQAKEEADQIRKNCQDMIKTTQESEEIKSNELDAKLRVTKGELEKQMQEKSDQLEMHH
AKIKELEDLKRTFKEGMDELRTLRTKVKCLEDERLRTEDELSKTKEIINRQKAEIQNLLDKVKTADQLQEQLQRGKQEIENLKEEVESLN
SLINDLQKDIEGSRKRESELLLFTERLTSKNAQLQSESNSLQSQFDKVSCSESQLQSQCEQMKQTNINLESRLLKEEELRKEEVQTLQAE
LACRQTEVKALSTQVEELKDELVTQRRKHASSIKDLTKQLQQARRKLDQVESGSTDKEVSSMGSRSSSSGSLNARSSAEDRSPENTGSSV
AVDNFPQVDKAMLIERIVRLQKAHARKNEKIEFMEDHIKQLVEEIRKKTKIIQSTILREESGTLSSEASDFNKVHLSRRGGIMASLTTSH

>In-frame_FGFR2_ENST00000369056_chr10_123243212_-_C10orf118_ENST00000369287_chr10_115910979_-_1414aa
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE
YLQIKGATPRDSGLTACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP
AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNTTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVV
GGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGETICKVSNTIGQANQSAWLTVLPK
QQAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITT
RLSSTADTPMLAGVSETELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMK
MIGKHKNIINLLGACTQDGPLTVIVETASKGNLREYLRARRPPGMEYSTDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAA
RNVLVTENNVMKIADFGLARDINNIDTYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEG
HRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNELESRIEELNKEVKASRDQLIAQDVTAKNAVQQLHKEMAQRME
QANKKCEEARQEKEAMVMKTVRGEKESLDLRKEKETLEKKLRDANKELEKNTNKIKQLSQEKGRLHQLTETKEGETTRLIREIDKLKEDI
NSHVIKVKWAQNKLKAEMDSHKETKDKLKETTTKLTQAKEEADQIRKNCQDMIKTTQESEEIKSNELDAKLRVTKGELEKQMQEKSDQLE
MHHAKIKELEDLKRTFKEGMDELRTLRTKVKCLEDERLRTEDELSKTKEIINRQKAEIQNLLDKVKTADQLQEQLQRGKQEIENLKEEVE
SLNSLINDLQKDIEGSRKRESELLLFTERLTSKNAQLQSESNSLQSQFDKVSCSESQLQSQCEQMKQTNINLESRLLKEEELRKEEVQTL
QAELACRQTEVKALSTQVEELKDELVTQRRKHASSIKDLTKQLQQARRKLDQVESGSTDKEVSSMGSRSSSSGSLNARSSAEDRSPENTG
SSVAVDNFPQVDKAMLIERIVRLQKAHARKNEKIEFMEDHIKQLVEEIRKKTKIIQSTILREESGTLSSEASDFNKVHLSRRGGIMASLT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FGFR2_ENST00000369061_chr10_123243212_-_C10orf118_ENST00000369287_chr10_115910979_-_3903nt
ATGGTCAGCTGGGGTCGTTTCATCTGCCTGGTCGTGGTCACCATGGCAACCTTGTCCCTGGCCCGGCCCTCCTTCAGTTTAGTTGAGGAT
ACCACATTAGAGCCAGAAGAGCCACCAACCAAATACCAAATCTCTCAACCAGAAGTGTACGTGGCTGCGCCAGGGGAGTCGCTAGAGGTG
CGCTGCCTGTTGAAAGATGCCGCCGTGATCAGTTGGACTAAGGATGGGGTGCACTTGGGGCCCAACAATAGGACAGTGCTTATTGGGGAG
TACTTGCAGATAAAGGGCGCCACGCCTAGAGACTCCGGCCTCTATGCTTGTACTGCCAGTAGGACTGTAGACAGTGAAACTTGGTACTTC
ATGGTGAATGTCACAGATGCCATCTCATCCGGAGATGATGAGGATGACACCGATGGTGCGGAAGATTTTGTCAGTGAGAACAGTAACAAC
AAGAGAGCACCATACTGGACCAACACAGAAAAGATGGAAAAGCGGCTCCATGCTGTGCCTGCGGCCAACACTGTCAAGTTTCGCTGCCCA
GCCGGGGGGAACCCAATGCCAACCATGCGGTGGCTGAAAAACGGGAAGGAGTTTAAGCAGGAGCATCGCATTGGAGGCTACAAGGTACGA
AACCAGCACTGGAGCCTCATTATGGAAAGTGTGGTCCCATCTGACAAGGGAAATTATACCTGTGTAGTGGAGAATGAATACGGGTCCATC
AATCACACGTACCACCTGGATGTTGTGGCGCCTGGAAGAGAAAAGGAGATTACAGCTTCCCCAGACTACCTGGAGATAGCCATTTACTGC
ATAGGGGTCTTCTTAATCGCCTGTATGGTGGTAACAGTCATCCTGTGCCGAATGAAGAACACGACCAAGAAGCCAGACTTCAGCAGCCAG
CCGGCTGTGCACAAGCTGACCAAACGTATCCCCCTGCGGAGACAGGTAACAGTTTCGGCTGAGTCCAGCTCCTCCATGAACTCCAACACC
CCGCTGGTGAGGATAACAACACGCCTCTCTTCAACGGCAGACACCCCCATGCTGGCAGGGGTCTCCGAGTATGAACTTCCAGAGGACCCA
AAATGGGAGTTTCCAAGAGATAAGCTGACACTGGGCAAGCCCCTGGGAGAAGGTTGCTTTGGGCAAGTGGTCATGGCGGAAGCAGTGGGA
ATTGACAAAGACAAGCCCAAGGAGGCGGTCACCGTGGCCGTGAAGATGTTGAAAGATGATGCCACAGAGAAAGACCTTTCTGATCTGGTG
TCAGAGATGGAGATGATGAAGATGATTGGGAAACACAAGAATATCATAAATCTTCTTGGAGCCTGCACACAGGATGGGCCTCTCTATGTC
ATAGTTGAGTATGCCTCTAAAGGCAACCTCCGAGAATACCTCCGAGCCCGGAGGCCACCCGGGATGGAGTACTCCTATGACATTAACCGT
GTTCCTGAGGAGCAGATGACCTTCAAGGACTTGGTGTCATGCACCTACCAGCTGGCCAGAGGCATGGAGTACTTGGCTTCCCAAAAATGT
ATTCATCGAGATTTAGCAGCCAGAAATGTTTTGGTAACAGAAAACAATGTGATGAAAATAGCAGACTTTGGACTCGCCAGAGATATCAAC
AATATAGACTATTACAAAAAGACCACCAATGGGCGGCTTCCAGTCAAGTGGATGGCTCCAGAAGCCCTGTTTGATAGAGTATACACTCAT
CAGAGTGATGTCTGGTCCTTCGGGGTGTTAATGTGGGAGATCTTCACTTTAGGGGGCTCGCCCTACCCAGGGATTCCCGTGGAGGAACTT
TTTAAGCTGCTGAAGGAAGGACACAGAATGGATAAGCCAGCCAACTGCACCAACGAACTGTACATGATGATGAGGGACTGTTGGCATGCA
GTGCCCTCCCAGAGACCAACGTTCAAGCAGTTGGTAGAAGACTTGGATCGAATTCTCACTCTCACAACCAATGAGTTAGAATCAAGAATA
GAAGAACTTAATAAAGAAGTTAAAGCTTCCAGAGATCAACTAATAGCTCAAGACGTTACAGCTAAAAATGCAGTTCAGCAGTTACACAAA
GAGATGGCCCAACGGATGGAACAGGCCAACAAGAAATGTGAAGAGGCACGCCAAGAAAAAGAAGCAATGGTAATGAAATATGTAAGAGGT
GAGAAGGAATCTTTAGATCTTCGAAAGGAAAAAGAGACACTTGAGAAAAAACTTAGAGATGCAAATAAGGAACTTGAGAAAAACACTAAC
AAAATTAAGCAGCTTTCTCAGGAGAAAGGACGGTTGCACCAGCTGTATGAAACTAAGGAAGGCGAAACGACTAGACTCATCAGAGAAATA
GACAAATTAAAGGAAGACATTAACTCTCACGTCATCAAAGTAAAGTGGGCACAAAACAAATTAAAAGCTGAAATGGATTCACACAAGGAA
ACCAAAGATAAACTCAAAGAAACAACAACAAAATTAACACAAGCAAAGGAAGAAGCAGATCAGATACGAAAAAACTGTCAGGATATGATA
AAAACATATCAGGAGTCAGAAGAAATTAAATCAAATGAGCTTGATGCAAAGCTTAGAGTCACAAAAGGAGAACTTGAAAAACAAATGCAA
GAAAAATCTGACCAGCTAGAGATGCATCATGCCAAAATAAAGGAACTAGAAGATCTGAAGAGAACATTTAAGGAGGGTATGGATGAGTTA
AGAACACTGAGAACAAAGGTGAAATGTCTAGAAGATGAACGATTAAGAACAGAAGATGAATTATCAAAATATAAGGAAATTATTAATCGC
CAAAAAGCTGAAATTCAGAATTTATTGGACAAGGTGAAAACTGCAGATCAGCTACAGGAGCAGCTTCAAAGAGGTAAGCAAGAAATTGAA
AATTTGAAAGAAGAAGTGGAAAGTCTTAATTCTTTGATTAATGACCTACAAAAAGACATCGAAGGCAGTAGGAAAAGAGAATCTGAGCTG
CTGCTGTTTACAGAAAGGCTCACTAGTAAGAATGCACAGCTTCAGTCTGAATCCAATTCTTTGCAGTCACAATTTGATAAAGTTTCCTGT
AGTGAAAGTCAGTTACAAAGCCAGTGTGAACAAATGAAACAGACAAATATTAATTTGGAAAGTAGGTTGTTGAAAGAGGAAGAACTGCGA
AAAGAGGAAGTCCAAACTCTGCAAGCTGAACTCGCTTGTAGACAAACAGAAGTTAAAGCATTGAGTACCCAGGTAGAAGAATTAAAAGAT
GAGTTAGTAACTCAGAGACGTAAACATGCCTCTAGTATCAAGGATCTCACCAAACAACTTCAGCAAGCACGAAGAAAATTAGATCAGGTT
GAGAGTGGAAGCTATGACAAAGAAGTCAGCAGCATGGGAAGTCGTTCTAGTTCATCAGGGTCCCTGAATGCTCGAAGCAGTGCAGAAGAT
CGATCTCCAGAAAATACTGGGTCCTCAGTAGCTGTGGATAACTTTCCACAAGTAGATAAGGCCATGTTGATTGAGAGAATAGTTAGGCTG
CAAAAAGCACATGCCCGGAAAAATGAAAAGATAGAATTTATGGAGGACCACATCAAACAACTGGTGGAAGAAATTAGGAAAAAAACAAAA
ATAATTCAAAGTTATATTTTACGAGAAGAATCAGGCACACTTTCTTCAGAGGCATCTGATTTTAACAAAGTTCATTTAAGTAGACGGGGT
GGCATCATGGCATCTTTATATACATCCCATCCAGCTGACAATGGATTAACATTGGAGCTCTCTTTGGAAATCAACCGAAAATTACAGGCT
GTTTTGGAGGATACGTTACTAAAAAATATTACTTTGAAGGAAAATCTACAAACACTTGGAACAGAAATAGAACGTCTTATTAAACACCAG

>In-frame_FGFR2_ENST00000346997_chr10_123243212_-_C10orf118_ENST00000369287_chr10_115910979_-_4233nt
ATGGTCAGCTGGGGTCGTTTCATCTGCCTGGTCGTGGTCACCATGGCAACCTTGTCCCTGGCCCGGCCCTCCTTCAGTTTAGTTGAGGAT
ACCACATTAGAGCCAGAAGAGCCACCAACCAAATACCAAATCTCTCAACCAGAAGTGTACGTGGCTGCGCCAGGGGAGTCGCTAGAGGTG
CGCTGCCTGTTGAAAGATGCCGCCGTGATCAGTTGGACTAAGGATGGGGTGCACTTGGGGCCCAACAATAGGACAGTGCTTATTGGGGAG
TACTTGCAGATAAAGGGCGCCACGCCTAGAGACTCCGGCCTCTATGCTTGTACTGCCAGTAGGACTGTAGACAGTGAAACTTGGTACTTC
ATGGTGAATGTCACAGATGCCATCTCATCCGGAGATGATGAGGATGACACCGATGGTGCGGAAGATTTTGTCAGTGAGAACAGTAACAAC
AAGAGAGCACCATACTGGACCAACACAGAAAAGATGGAAAAGCGGCTCCATGCTGTGCCTGCGGCCAACACTGTCAAGTTTCGCTGCCCA
GCCGGGGGGAACCCAATGCCAACCATGCGGTGGCTGAAAAACGGGAAGGAGTTTAAGCAGGAGCATCGCATTGGAGGCTACAAGGTACGA
AACCAGCACTGGAGCCTCATTATGGAAAGTGTGGTCCCATCTGACAAGGGAAATTATACCTGTGTAGTGGAGAATGAATACGGGTCCATC
AATCACACGTACCACCTGGATGTTGTGGAGCGATCGCCTCACCGGCCCATCCTCCAAGCCGGACTGCCGGCAAATGCCTCCACAGTGGTC
GGAGGAGACGTAGAGTTTGTCTGCAAGGTTTACAGTGATGCCCAGCCCCACATCCAGTGGATCAAGCACGTGGAAAAGAACGGCAGTAAA
TACGGGCCCGACGGGCTGCCCTACCTCAAGGTTCTCAAGGCCGCCGGTGTTAACACCACGGACAAAGAGATTGAGGTTCTCTATATTCGG
AATGTAACTTTTGAGGACGCTGGGGAATATACGTGCTTGGCGGGTAATTCTATTGGGATATCCTTTCACTCTGCATGGTTGACAGTTCTG
CCAGCGCCTGGAAGAGAAAAGGAGATTACAGCTTCCCCAGACTACCTGGAGATAGCCATTTACTGCATAGGGGTCTTCTTAATCGCCTGT
ATGGTGGTAACAGTCATCCTGTGCCGAATGAAGAACACGACCAAGAAGCCAGACTTCAGCAGCCAGCCGGCTGTGCACAAGCTGACCAAA
CGTATCCCCCTGCGGAGACAGGTTTCGGCTGAGTCCAGCTCCTCCATGAACTCCAACACCCCGCTGGTGAGGATAACAACACGCCTCTCT
TCAACGGCAGACACCCCCATGCTGGCAGGGGTCTCCGAGTATGAACTTCCAGAGGACCCAAAATGGGAGTTTCCAAGAGATAAGCTGACA
CTGGGCAAGCCCCTGGGAGAAGGTTGCTTTGGGCAAGTGGTCATGGCGGAAGCAGTGGGAATTGACAAAGACAAGCCCAAGGAGGCGGTC
ACCGTGGCCGTGAAGATGTTGAAAGATGATGCCACAGAGAAAGACCTTTCTGATCTGGTGTCAGAGATGGAGATGATGAAGATGATTGGG
AAACACAAGAATATCATAAATCTTCTTGGAGCCTGCACACAGGATGGGCCTCTCTATGTCATAGTTGAGTATGCCTCTAAAGGCAACCTC
CGAGAATACCTCCGAGCCCGGAGGCCACCCGGGATGGAGTACTCCTATGACATTAACCGTGTTCCTGAGGAGCAGATGACCTTCAAGGAC
TTGGTGTCATGCACCTACCAGCTGGCCAGAGGCATGGAGTACTTGGCTTCCCAAAAATGTATTCATCGAGATTTAGCAGCCAGAAATGTT
TTGGTAACAGAAAACAATGTGATGAAAATAGCAGACTTTGGACTCGCCAGAGATATCAACAATATAGACTATTACAAAAAGACCACCAAT
GGGCGGCTTCCAGTCAAGTGGATGGCTCCAGAAGCCCTGTTTGATAGAGTATACACTCATCAGAGTGATGTCTGGTCCTTCGGGGTGTTA
ATGTGGGAGATCTTCACTTTAGGGGGCTCGCCCTACCCAGGGATTCCCGTGGAGGAACTTTTTAAGCTGCTGAAGGAAGGACACAGAATG
GATAAGCCAGCCAACTGCACCAACGAACTGTACATGATGATGAGGGACTGTTGGCATGCAGTGCCCTCCCAGAGACCAACGTTCAAGCAG
TTGGTAGAAGACTTGGATCGAATTCTCACTCTCACAACCAATGAGTTAGAATCAAGAATAGAAGAACTTAATAAAGAAGTTAAAGCTTCC
AGAGATCAACTAATAGCTCAAGACGTTACAGCTAAAAATGCAGTTCAGCAGTTACACAAAGAGATGGCCCAACGGATGGAACAGGCCAAC
AAGAAATGTGAAGAGGCACGCCAAGAAAAAGAAGCAATGGTAATGAAATATGTAAGAGGTGAGAAGGAATCTTTAGATCTTCGAAAGGAA
AAAGAGACACTTGAGAAAAAACTTAGAGATGCAAATAAGGAACTTGAGAAAAACACTAACAAAATTAAGCAGCTTTCTCAGGAGAAAGGA
CGGTTGCACCAGCTGTATGAAACTAAGGAAGGCGAAACGACTAGACTCATCAGAGAAATAGACAAATTAAAGGAAGACATTAACTCTCAC
GTCATCAAAGTAAAGTGGGCACAAAACAAATTAAAAGCTGAAATGGATTCACACAAGGAAACCAAAGATAAACTCAAAGAAACAACAACA
AAATTAACACAAGCAAAGGAAGAAGCAGATCAGATACGAAAAAACTGTCAGGATATGATAAAAACATATCAGGAGTCAGAAGAAATTAAA
TCAAATGAGCTTGATGCAAAGCTTAGAGTCACAAAAGGAGAACTTGAAAAACAAATGCAAGAAAAATCTGACCAGCTAGAGATGCATCAT
GCCAAAATAAAGGAACTAGAAGATCTGAAGAGAACATTTAAGGAGGGTATGGATGAGTTAAGAACACTGAGAACAAAGGTGAAATGTCTA
GAAGATGAACGATTAAGAACAGAAGATGAATTATCAAAATATAAGGAAATTATTAATCGCCAAAAAGCTGAAATTCAGAATTTATTGGAC
AAGGTGAAAACTGCAGATCAGCTACAGGAGCAGCTTCAAAGAGGTAAGCAAGAAATTGAAAATTTGAAAGAAGAAGTGGAAAGTCTTAAT
TCTTTGATTAATGACCTACAAAAAGACATCGAAGGCAGTAGGAAAAGAGAATCTGAGCTGCTGCTGTTTACAGAAAGGCTCACTAGTAAG
AATGCACAGCTTCAGTCTGAATCCAATTCTTTGCAGTCACAATTTGATAAAGTTTCCTGTAGTGAAAGTCAGTTACAAAGCCAGTGTGAA
CAAATGAAACAGACAAATATTAATTTGGAAAGTAGGTTGTTGAAAGAGGAAGAACTGCGAAAAGAGGAAGTCCAAACTCTGCAAGCTGAA
CTCGCTTGTAGACAAACAGAAGTTAAAGCATTGAGTACCCAGGTAGAAGAATTAAAAGATGAGTTAGTAACTCAGAGACGTAAACATGCC
TCTAGTATCAAGGATCTCACCAAACAACTTCAGCAAGCACGAAGAAAATTAGATCAGGTTGAGAGTGGAAGCTATGACAAAGAAGTCAGC
AGCATGGGAAGTCGTTCTAGTTCATCAGGGTCCCTGAATGCTCGAAGCAGTGCAGAAGATCGATCTCCAGAAAATACTGGGTCCTCAGTA
GCTGTGGATAACTTTCCACAAGTAGATAAGGCCATGTTGATTGAGAGAATAGTTAGGCTGCAAAAAGCACATGCCCGGAAAAATGAAAAG
ATAGAATTTATGGAGGACCACATCAAACAACTGGTGGAAGAAATTAGGAAAAAAACAAAAATAATTCAAAGTTATATTTTACGAGAAGAA
TCAGGCACACTTTCTTCAGAGGCATCTGATTTTAACAAAGTTCATTTAAGTAGACGGGGTGGCATCATGGCATCTTTATATACATCCCAT
CCAGCTGACAATGGATTAACATTGGAGCTCTCTTTGGAAATCAACCGAAAATTACAGGCTGTTTTGGAGGATACGTTACTAAAAAATATT
ACTTTGAAGGAAAATCTACAAACACTTGGAACAGAAATAGAACGTCTTATTAAACACCAGCATGAACTAGAACAGAGGACAAAGAAAACC

>In-frame_FGFR2_ENST00000369056_chr10_123243212_-_C10orf118_ENST00000369287_chr10_115910979_-_4242nt
ATGGTCAGCTGGGGTCGTTTCATCTGCCTGGTCGTGGTCACCATGGCAACCTTGTCCCTGGCCCGGCCCTCCTTCAGTTTAGTTGAGGAT
ACCACATTAGAGCCAGAAGAGCCACCAACCAAATACCAAATCTCTCAACCAGAAGTGTACGTGGCTGCGCCAGGGGAGTCGCTAGAGGTG
CGCTGCCTGTTGAAAGATGCCGCCGTGATCAGTTGGACTAAGGATGGGGTGCACTTGGGGCCCAACAATAGGACAGTGCTTATTGGGGAG
TACTTGCAGATAAAGGGCGCCACGCCTAGAGACTCCGGCCTCTATGCTTGTACTGCCAGTAGGACTGTAGACAGTGAAACTTGGTACTTC
ATGGTGAATGTCACAGATGCCATCTCATCCGGAGATGATGAGGATGACACCGATGGTGCGGAAGATTTTGTCAGTGAGAACAGTAACAAC
AAGAGAGCACCATACTGGACCAACACAGAAAAGATGGAAAAGCGGCTCCATGCTGTGCCTGCGGCCAACACTGTCAAGTTTCGCTGCCCA
GCCGGGGGGAACCCAATGCCAACCATGCGGTGGCTGAAAAACGGGAAGGAGTTTAAGCAGGAGCATCGCATTGGAGGCTACAAGGTACGA
AACCAGCACTGGAGCCTCATTATGGAAAGTGTGGTCCCATCTGACAAGGGAAATTATACCTGTGTAGTGGAGAATGAATACGGGTCCATC
AATCACACGTACCACCTGGATGTTGTGGAGCGATCGCCTCACCGGCCCATCCTCCAAGCCGGACTGCCGGCAAATGCCTCCACAGTGGTC
GGAGGAGACGTAGAGTTTGTCTGCAAGGTTTACAGTGATGCCCAGCCCCACATCCAGTGGATCAAGCACGTGGAAAAGAACGGCAGTAAA
TACGGGCCCGACGGGCTGCCCTACCTCAAGGTTCTCAAGCACTCGGGGATAAATAGTTCCAATGCAGAAGTGCTGGCTCTGTTCAATGTG
ACCGAGGCGGATGCTGGGGAATATATATGTAAGGTCTCCAATTATATAGGGCAGGCCAACCAGTCTGCCTGGCTCACTGTCCTGCCAAAA
CAGCAAGCGCCTGGAAGAGAAAAGGAGATTACAGCTTCCCCAGACTACCTGGAGATAGCCATTTACTGCATAGGGGTCTTCTTAATCGCC
TGTATGGTGGTAACAGTCATCCTGTGCCGAATGAAGAACACGACCAAGAAGCCAGACTTCAGCAGCCAGCCGGCTGTGCACAAGCTGACC
AAACGTATCCCCCTGCGGAGACAGGTAACAGTTTCGGCTGAGTCCAGCTCCTCCATGAACTCCAACACCCCGCTGGTGAGGATAACAACA
CGCCTCTCTTCAACGGCAGACACCCCCATGCTGGCAGGGGTCTCCGAGTATGAACTTCCAGAGGACCCAAAATGGGAGTTTCCAAGAGAT
AAGCTGACACTGGGCAAGCCCCTGGGAGAAGGTTGCTTTGGGCAAGTGGTCATGGCGGAAGCAGTGGGAATTGACAAAGACAAGCCCAAG
GAGGCGGTCACCGTGGCCGTGAAGATGTTGAAAGATGATGCCACAGAGAAAGACCTTTCTGATCTGGTGTCAGAGATGGAGATGATGAAG
ATGATTGGGAAACACAAGAATATCATAAATCTTCTTGGAGCCTGCACACAGGATGGGCCTCTCTATGTCATAGTTGAGTATGCCTCTAAA
GGCAACCTCCGAGAATACCTCCGAGCCCGGAGGCCACCCGGGATGGAGTACTCCTATGACATTAACCGTGTTCCTGAGGAGCAGATGACC
TTCAAGGACTTGGTGTCATGCACCTACCAGCTGGCCAGAGGCATGGAGTACTTGGCTTCCCAAAAATGTATTCATCGAGATTTAGCAGCC
AGAAATGTTTTGGTAACAGAAAACAATGTGATGAAAATAGCAGACTTTGGACTCGCCAGAGATATCAACAATATAGACTATTACAAAAAG
ACCACCAATGGGCGGCTTCCAGTCAAGTGGATGGCTCCAGAAGCCCTGTTTGATAGAGTATACACTCATCAGAGTGATGTCTGGTCCTTC
GGGGTGTTAATGTGGGAGATCTTCACTTTAGGGGGCTCGCCCTACCCAGGGATTCCCGTGGAGGAACTTTTTAAGCTGCTGAAGGAAGGA
CACAGAATGGATAAGCCAGCCAACTGCACCAACGAACTGTACATGATGATGAGGGACTGTTGGCATGCAGTGCCCTCCCAGAGACCAACG
TTCAAGCAGTTGGTAGAAGACTTGGATCGAATTCTCACTCTCACAACCAATGAGTTAGAATCAAGAATAGAAGAACTTAATAAAGAAGTT
AAAGCTTCCAGAGATCAACTAATAGCTCAAGACGTTACAGCTAAAAATGCAGTTCAGCAGTTACACAAAGAGATGGCCCAACGGATGGAA
CAGGCCAACAAGAAATGTGAAGAGGCACGCCAAGAAAAAGAAGCAATGGTAATGAAATATGTAAGAGGTGAGAAGGAATCTTTAGATCTT
CGAAAGGAAAAAGAGACACTTGAGAAAAAACTTAGAGATGCAAATAAGGAACTTGAGAAAAACACTAACAAAATTAAGCAGCTTTCTCAG
GAGAAAGGACGGTTGCACCAGCTGTATGAAACTAAGGAAGGCGAAACGACTAGACTCATCAGAGAAATAGACAAATTAAAGGAAGACATT
AACTCTCACGTCATCAAAGTAAAGTGGGCACAAAACAAATTAAAAGCTGAAATGGATTCACACAAGGAAACCAAAGATAAACTCAAAGAA
ACAACAACAAAATTAACACAAGCAAAGGAAGAAGCAGATCAGATACGAAAAAACTGTCAGGATATGATAAAAACATATCAGGAGTCAGAA
GAAATTAAATCAAATGAGCTTGATGCAAAGCTTAGAGTCACAAAAGGAGAACTTGAAAAACAAATGCAAGAAAAATCTGACCAGCTAGAG
ATGCATCATGCCAAAATAAAGGAACTAGAAGATCTGAAGAGAACATTTAAGGAGGGTATGGATGAGTTAAGAACACTGAGAACAAAGGTG
AAATGTCTAGAAGATGAACGATTAAGAACAGAAGATGAATTATCAAAATATAAGGAAATTATTAATCGCCAAAAAGCTGAAATTCAGAAT
TTATTGGACAAGGTGAAAACTGCAGATCAGCTACAGGAGCAGCTTCAAAGAGGTAAGCAAGAAATTGAAAATTTGAAAGAAGAAGTGGAA
AGTCTTAATTCTTTGATTAATGACCTACAAAAAGACATCGAAGGCAGTAGGAAAAGAGAATCTGAGCTGCTGCTGTTTACAGAAAGGCTC
ACTAGTAAGAATGCACAGCTTCAGTCTGAATCCAATTCTTTGCAGTCACAATTTGATAAAGTTTCCTGTAGTGAAAGTCAGTTACAAAGC
CAGTGTGAACAAATGAAACAGACAAATATTAATTTGGAAAGTAGGTTGTTGAAAGAGGAAGAACTGCGAAAAGAGGAAGTCCAAACTCTG
CAAGCTGAACTCGCTTGTAGACAAACAGAAGTTAAAGCATTGAGTACCCAGGTAGAAGAATTAAAAGATGAGTTAGTAACTCAGAGACGT
AAACATGCCTCTAGTATCAAGGATCTCACCAAACAACTTCAGCAAGCACGAAGAAAATTAGATCAGGTTGAGAGTGGAAGCTATGACAAA
GAAGTCAGCAGCATGGGAAGTCGTTCTAGTTCATCAGGGTCCCTGAATGCTCGAAGCAGTGCAGAAGATCGATCTCCAGAAAATACTGGG
TCCTCAGTAGCTGTGGATAACTTTCCACAAGTAGATAAGGCCATGTTGATTGAGAGAATAGTTAGGCTGCAAAAAGCACATGCCCGGAAA
AATGAAAAGATAGAATTTATGGAGGACCACATCAAACAACTGGTGGAAGAAATTAGGAAAAAAACAAAAATAATTCAAAGTTATATTTTA
CGAGAAGAATCAGGCACACTTTCTTCAGAGGCATCTGATTTTAACAAAGTTCATTTAAGTAGACGGGGTGGCATCATGGCATCTTTATAT
ACATCCCATCCAGCTGACAATGGATTAACATTGGAGCTCTCTTTGGAAATCAACCGAAAATTACAGGCTGTTTTGGAGGATACGTTACTA
AAAAATATTACTTTGAAGGAAAATCTACAAACACTTGGAACAGAAATAGAACGTCTTATTAAACACCAGCATGAACTAGAACAGAGGACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_FGFR2_ENST00000369061_chr10_123243212_-_C10orf118_ENST00000369287_chr10_115910979_-_8334nt
TGACTGCAGCAGCAGCGGCAGCGCCTCGGTTCCTGAGCCCACCGCAGGCTGAAGGCATTGCGCGTAGTCCATGCCCGTAGAGGAAGTGTG
CAGATGGGATTAACGTCCACATGGAGATATGGAAGAGGACCGGGGATTGGTACCGTAACCATGGTCAGCTGGGGTCGTTTCATCTGCCTG
GTCGTGGTCACCATGGCAACCTTGTCCCTGGCCCGGCCCTCCTTCAGTTTAGTTGAGGATACCACATTAGAGCCAGAAGAGCCACCAACC
AAATACCAAATCTCTCAACCAGAAGTGTACGTGGCTGCGCCAGGGGAGTCGCTAGAGGTGCGCTGCCTGTTGAAAGATGCCGCCGTGATC
AGTTGGACTAAGGATGGGGTGCACTTGGGGCCCAACAATAGGACAGTGCTTATTGGGGAGTACTTGCAGATAAAGGGCGCCACGCCTAGA
GACTCCGGCCTCTATGCTTGTACTGCCAGTAGGACTGTAGACAGTGAAACTTGGTACTTCATGGTGAATGTCACAGATGCCATCTCATCC
GGAGATGATGAGGATGACACCGATGGTGCGGAAGATTTTGTCAGTGAGAACAGTAACAACAAGAGAGCACCATACTGGACCAACACAGAA
AAGATGGAAAAGCGGCTCCATGCTGTGCCTGCGGCCAACACTGTCAAGTTTCGCTGCCCAGCCGGGGGGAACCCAATGCCAACCATGCGG
TGGCTGAAAAACGGGAAGGAGTTTAAGCAGGAGCATCGCATTGGAGGCTACAAGGTACGAAACCAGCACTGGAGCCTCATTATGGAAAGT
GTGGTCCCATCTGACAAGGGAAATTATACCTGTGTAGTGGAGAATGAATACGGGTCCATCAATCACACGTACCACCTGGATGTTGTGGCG
CCTGGAAGAGAAAAGGAGATTACAGCTTCCCCAGACTACCTGGAGATAGCCATTTACTGCATAGGGGTCTTCTTAATCGCCTGTATGGTG
GTAACAGTCATCCTGTGCCGAATGAAGAACACGACCAAGAAGCCAGACTTCAGCAGCCAGCCGGCTGTGCACAAGCTGACCAAACGTATC
CCCCTGCGGAGACAGGTAACAGTTTCGGCTGAGTCCAGCTCCTCCATGAACTCCAACACCCCGCTGGTGAGGATAACAACACGCCTCTCT
TCAACGGCAGACACCCCCATGCTGGCAGGGGTCTCCGAGTATGAACTTCCAGAGGACCCAAAATGGGAGTTTCCAAGAGATAAGCTGACA
CTGGGCAAGCCCCTGGGAGAAGGTTGCTTTGGGCAAGTGGTCATGGCGGAAGCAGTGGGAATTGACAAAGACAAGCCCAAGGAGGCGGTC
ACCGTGGCCGTGAAGATGTTGAAAGATGATGCCACAGAGAAAGACCTTTCTGATCTGGTGTCAGAGATGGAGATGATGAAGATGATTGGG
AAACACAAGAATATCATAAATCTTCTTGGAGCCTGCACACAGGATGGGCCTCTCTATGTCATAGTTGAGTATGCCTCTAAAGGCAACCTC
CGAGAATACCTCCGAGCCCGGAGGCCACCCGGGATGGAGTACTCCTATGACATTAACCGTGTTCCTGAGGAGCAGATGACCTTCAAGGAC
TTGGTGTCATGCACCTACCAGCTGGCCAGAGGCATGGAGTACTTGGCTTCCCAAAAATGTATTCATCGAGATTTAGCAGCCAGAAATGTT
TTGGTAACAGAAAACAATGTGATGAAAATAGCAGACTTTGGACTCGCCAGAGATATCAACAATATAGACTATTACAAAAAGACCACCAAT
GGGCGGCTTCCAGTCAAGTGGATGGCTCCAGAAGCCCTGTTTGATAGAGTATACACTCATCAGAGTGATGTCTGGTCCTTCGGGGTGTTA
ATGTGGGAGATCTTCACTTTAGGGGGCTCGCCCTACCCAGGGATTCCCGTGGAGGAACTTTTTAAGCTGCTGAAGGAAGGACACAGAATG
GATAAGCCAGCCAACTGCACCAACGAACTGTACATGATGATGAGGGACTGTTGGCATGCAGTGCCCTCCCAGAGACCAACGTTCAAGCAG
TTGGTAGAAGACTTGGATCGAATTCTCACTCTCACAACCAATGAGTTAGAATCAAGAATAGAAGAACTTAATAAAGAAGTTAAAGCTTCC
AGAGATCAACTAATAGCTCAAGACGTTACAGCTAAAAATGCAGTTCAGCAGTTACACAAAGAGATGGCCCAACGGATGGAACAGGCCAAC
AAGAAATGTGAAGAGGCACGCCAAGAAAAAGAAGCAATGGTAATGAAATATGTAAGAGGTGAGAAGGAATCTTTAGATCTTCGAAAGGAA
AAAGAGACACTTGAGAAAAAACTTAGAGATGCAAATAAGGAACTTGAGAAAAACACTAACAAAATTAAGCAGCTTTCTCAGGAGAAAGGA
CGGTTGCACCAGCTGTATGAAACTAAGGAAGGCGAAACGACTAGACTCATCAGAGAAATAGACAAATTAAAGGAAGACATTAACTCTCAC
GTCATCAAAGTAAAGTGGGCACAAAACAAATTAAAAGCTGAAATGGATTCACACAAGGAAACCAAAGATAAACTCAAAGAAACAACAACA
AAATTAACACAAGCAAAGGAAGAAGCAGATCAGATACGAAAAAACTGTCAGGATATGATAAAAACATATCAGGAGTCAGAAGAAATTAAA
TCAAATGAGCTTGATGCAAAGCTTAGAGTCACAAAAGGAGAACTTGAAAAACAAATGCAAGAAAAATCTGACCAGCTAGAGATGCATCAT
GCCAAAATAAAGGAACTAGAAGATCTGAAGAGAACATTTAAGGAGGGTATGGATGAGTTAAGAACACTGAGAACAAAGGTGAAATGTCTA
GAAGATGAACGATTAAGAACAGAAGATGAATTATCAAAATATAAGGAAATTATTAATCGCCAAAAAGCTGAAATTCAGAATTTATTGGAC
AAGGTGAAAACTGCAGATCAGCTACAGGAGCAGCTTCAAAGAGGTAAGCAAGAAATTGAAAATTTGAAAGAAGAAGTGGAAAGTCTTAAT
TCTTTGATTAATGACCTACAAAAAGACATCGAAGGCAGTAGGAAAAGAGAATCTGAGCTGCTGCTGTTTACAGAAAGGCTCACTAGTAAG
AATGCACAGCTTCAGTCTGAATCCAATTCTTTGCAGTCACAATTTGATAAAGTTTCCTGTAGTGAAAGTCAGTTACAAAGCCAGTGTGAA
CAAATGAAACAGACAAATATTAATTTGGAAAGTAGGTTGTTGAAAGAGGAAGAACTGCGAAAAGAGGAAGTCCAAACTCTGCAAGCTGAA
CTCGCTTGTAGACAAACAGAAGTTAAAGCATTGAGTACCCAGGTAGAAGAATTAAAAGATGAGTTAGTAACTCAGAGACGTAAACATGCC
TCTAGTATCAAGGATCTCACCAAACAACTTCAGCAAGCACGAAGAAAATTAGATCAGGTTGAGAGTGGAAGCTATGACAAAGAAGTCAGC
AGCATGGGAAGTCGTTCTAGTTCATCAGGGTCCCTGAATGCTCGAAGCAGTGCAGAAGATCGATCTCCAGAAAATACTGGGTCCTCAGTA
GCTGTGGATAACTTTCCACAAGTAGATAAGGCCATGTTGATTGAGAGAATAGTTAGGCTGCAAAAAGCACATGCCCGGAAAAATGAAAAG
ATAGAATTTATGGAGGACCACATCAAACAACTGGTGGAAGAAATTAGGAAAAAAACAAAAATAATTCAAAGTTATATTTTACGAGAAGAA
TCAGGCACACTTTCTTCAGAGGCATCTGATTTTAACAAAGTTCATTTAAGTAGACGGGGTGGCATCATGGCATCTTTATATACATCCCAT
CCAGCTGACAATGGATTAACATTGGAGCTCTCTTTGGAAATCAACCGAAAATTACAGGCTGTTTTGGAGGATACGTTACTAAAAAATATT
ACTTTGAAGGAAAATCTACAAACACTTGGAACAGAAATAGAACGTCTTATTAAACACCAGCATGAACTAGAACAGAGGACAAAGAAAACC
TAAAACAAGCCTCTTGCTCAGTAAAGAGACAAAAGCCACACAGGAGTAGGTGCCACTGACCTCTATTGTTGGAGACTTTGTTCCACTTTT
TGTTTCAGCCAGTAAAAATATTGTTTTGCTTCATCTGTACACAAAAAAATACCCTTTTACAATATGAATGCATTGCTGTATATACTGTAA
GACTGAAAGCTTTGATGAAATTTGTTTTTGTATGGTGCAATATGACAGCCTGTCATTGAATCTAAACAACTTAATTTGCTTGTATTCATA
AGAAGTGTTGAACATTACAAGGGCTTTTATAAAAAACCCTTTGTTCATATTTCTTCCCTTTAAAATATGTAATGTCAAAAATGACTCACC
TTTTAAAAATTATGCATGAAAACAGGTGGTAAACATTCAGTAATACGCTATTTCTCCAACATCAAGACAACTAAAACAAATGATAAAAAT
GTTTATTTTTACACTCCAGCATATCGGGTGAGTTTTAGGGATGTGTATGAATATTTAAATCTTTTAATTTCAGTTTTAATGAAAGCTGAA
CTTAATAGGAAAGCTAGCTCTTGGTAACTAGCAATGATCAGGCATTGTTTGCCTCTGTCAGGTTTTCTTATCTGTTTTAGGTACATTTTT
TCAGATTCTGATTGTTTGAGTTAATGGTTGAATTTTTAAAGTTTTTAGTTACTTAAAATATGATTTTAAATTACATATTAATTTAGAAAA
TTCCTGTGTTTACTTATATTTTAAATTGTGAAATGGATCCAATCATTAGAACAGAGAGAATAGTTCTTTGAAACTGAAATACTTTAGTTT
TACTGACCTTGTGTAAAGATAATATGAAGAACCAGCTTCCAAAAGAAACCAGCATATGGCACTATAAACTATTTCATTTGAGCACCATTC
TTTACCATGGATATATTAATTATGTATTATAGTGGAGTGATCATACAGTTCCCCCAAATGTGATGTTTCAGTGTATTTATTTAAAACATA
AAGTAGACCAGGTGCAGTAGCTCACGCCTGTAATCCCAGCACTTTGGGAAGCCAAGGCAGGAGGATTACCTGAGGCCAGGAGTTTAAGAC
CAGCCTTGGCAACATAGCGAGACCCCCATCTCTACAAAGAAATTTTAAAAGATTATCCAGGCATGGTGGTGCATGCCTATGGTTCCAGCT
ACTCGGGAGGCTGAAGCGGTAGAATCACTTGAGCACAGGAGGTCAAGGCTGCAGGTGAGCCATGATCGTGTCACTGCACTCCAGCCTAGG
CAACAGAGCAAGACCCTGTCTCTTAAAACAAAAAACCTCACACATACCTAAAATAAGTATATATCTGTAACCAAAGGAACTTAATTTTAG
AGCCAAATTTTTCTATCTTGTTGGATTTTTTACAGTGTTTAAGATAGACACTTAAGTGTTGCCGTAGTATCAATATTTCTGTCATTGAAT
TTTTTCTCACCCCTTATTATTTCTCACTTACAATTTCTGAGCATGATTTTTCATAATTCATTATCTTCAGATCATTACTATAATAAGATA
CCGTGGCTCTTATGCAGATATTGCAGCAAGCCTTGTTTGGTTTGGATTTTTGCATCCCTTTTTCTCCCATTAAGGGAATTAAGTTTTGGG
ATGATGGATTAAAAGCCTGTAAAGAATTGTTTGGGCTCTAAAAGTTGGGCTCATGGTGGCAATATCCTTTTAATGTGTTTTAACATTTTT
TAATCAACATCGTTTAAAAATAATTTACTAAGGATTAGATTATTTAATGAATGTCTTTTTTTCTATATATTGAATTAGATGTTATCCCAA
AAAAAATATCTTTTCACTTCAAAATGAAAATATATGTTCAAAGATGTTTTATTTTTAGAATAGTTATAAAAAGTATTAGTCTTAACATAA
TGTGTCTTGTTCTTTTTACCAATAATAATTTATCAAAATAAGAGGGAAAGTGCAATCAAATCTGAATTATTTTACTATTTGTTTCTAGAC
ACACTACTTAACACTCCTAAAGACTACTTTGAGTAGGCAACATAACTAAATTTTTCTAGTTTCTTATGATACAGGTTCATAAACTACAAT
ATTTGGATTTTTTTCCCCAAGGCACAAAATGTATAATGGAGACCAAATAGTGATCTGATCCATAGTATCCTATGCCTATACACTTTAAAA
TGTATATACATTTTAGACAAAAATGCACACTCCAGTATTAATATTTGTGCTACCATCTACTTGGAGAAGTTTAATGAGAAAATTTTAGAA
GAAAAGTATTACAAACAATATTTTGACTCTATTACCTGTTTTGCCTTATACATTTTAGAAACTGGAAATTTTTTAAAGAAAATGCTTTAG
TTTTCTTCTGTTCTTCACTGTCTACAGTGTGCTTTTGTATATGGATCAGGACTGAGCAAAGTAATTACATGTATCAGAGATACTTATCTC
TATACTAATTCACAGACAGCTCCTGATGTAAGGATTTAGAGGGCCTTCTGCCCTCTGAATATATGGTGAGGAGAATGGGGTATCTGGAAA
AGGAAAATGATCTGGATAAATCTGAGACCTGGGGGGAAGTTTGTTTTATATGTTCATTATTGGTTGTTACATATCAAGGCTGTTTTGGTT
ATGTATCAATATTGTGGTTTATTTGAGCTGGAAGTGATTTTTTCTGTGTATGTATATGTATACACTTCAATAGGTTTTAATTTTGAAGTG
AATATTTGCCATGACTCCATTTTCCCCATACCACTTCAGACTTTAGCCTGTTTAGTTTTAAGGACTGAAAATGGTAGGTTTGGGCAGAAG
AATGAATTTGAACTTTGATGGGGTTTTTTTGTTTTTACTTTCTATCTTCATAACCATTTAAAGCGATTTAGCTTGAAATTAAATTTTATC
AGGCTACCAACATGTTATTTATTTATTTAATAAACACATTTATTGAAAACCTATACTATTGTATTGGCACCATACAGGGTATTGTATTTA
TACTAGTGAGCAGACCAGGGCATTTCCATCCTCATGGAGTTCATGGTCTAATGAAAATAGCTGGGGCCGGGTGTGGTGGCTCACCCCTGT
AATCCCAGCACTTTGGGAGGCTGAGGTGGGAGGATTGTTTGAGCCCAGGAGTTTGAGACCAGCCAGGGCAACATGGCAAAACCCCATGTG
TACAAAAGATTAAAAAATTAGCCAGATGCAGTGGCACATGGCTGGGGTCCCAGCTACCCAGGAGGCTGAGTTGGGAGGATCATCTGAGCC
TGGGAGGTTGAAGCTTGCAGTGAGCTATGATTGCCACTGTACTCTATACTCCAGCCTGGGTGACAGAGTGAAACCCTGTCTCAAAAAAAA
AAGAGGAAAGAAAATAGCTAGGAGACAATCAGAGCAGATCTTGGGCTTCTGTGGCTCATCTCAGCCCTTTATAACTGGCCTGAGAAGAGG
GTTTATCTACTTGTGCAAGTGGCCCAGAAATCTCACTCGTACATGAGGCTTTGGAACATCCTTGCAAAGGTACGCTGAAAGCAAATTGCT
GTTTTCCTGGTGGTTCTGCACGTTTCCTAACTTTTATCATAGTTTGATTTTCATTATTTAAGAAAAAATAAAAAATCCAAAGACCATAAG
ATGGCATTAGATTTTTTACCATTAAATTATTAATGCCTATTTGGTGCTCATAAAGATTAATCATGTCACGCATGTTTCCAATCTTTCTTT
TGCAGTATATTATTTTCTAAAAATTGTTACATGCAAATTTAAACCAAGATTTATCAGTAAAAGAAAAAAATAGAATCCTTAATAATGTAA
ATGTTGTTATATATGCTACCCTGGTGAAAATATTTTTATAAATCATGTTGTCATTTATGCTTTATGTAGCCTATTTTTCAATAACCTTTT
TTTAAAAGCAATTTTTTTTGACACCAAGATTGTTGATTTTTAATTAACACCAGTTGGTGGCACTAGAAACCTGAAATTTTTCAAAGATGA
ACAAAGAAAAATTGAAAAGGTAATCTAAACATGGAGAATTTTTAGGAAAATAAATGAAAAATATAATTGTATATTAGAGATGTATTTTTC
TTCTGGAATGGAATTCTTTTTCTAAAATGCAAATCGCTATCCATTTTGACTGCAATGATGAAACTTGTTTATCTTCCAGAGGACATATAT
ATATGTGTGTGTGTGTGTATTGTACAGATACCTTTAATTTGATTACACTGTTTCTTGTAAATATGTTTCTGTATAAAATGAAACTTTTCA

>In-frame_FGFR2_ENST00000346997_chr10_123243212_-_C10orf118_ENST00000369287_chr10_115910979_-_8526nt
GGTACCGTAACCATGGTCAGCTGGGGTCGTTTCATCTGCCTGGTCGTGGTCACCATGGCAACCTTGTCCCTGGCCCGGCCCTCCTTCAGT
TTAGTTGAGGATACCACATTAGAGCCAGAAGAGCCACCAACCAAATACCAAATCTCTCAACCAGAAGTGTACGTGGCTGCGCCAGGGGAG
TCGCTAGAGGTGCGCTGCCTGTTGAAAGATGCCGCCGTGATCAGTTGGACTAAGGATGGGGTGCACTTGGGGCCCAACAATAGGACAGTG
CTTATTGGGGAGTACTTGCAGATAAAGGGCGCCACGCCTAGAGACTCCGGCCTCTATGCTTGTACTGCCAGTAGGACTGTAGACAGTGAA
ACTTGGTACTTCATGGTGAATGTCACAGATGCCATCTCATCCGGAGATGATGAGGATGACACCGATGGTGCGGAAGATTTTGTCAGTGAG
AACAGTAACAACAAGAGAGCACCATACTGGACCAACACAGAAAAGATGGAAAAGCGGCTCCATGCTGTGCCTGCGGCCAACACTGTCAAG
TTTCGCTGCCCAGCCGGGGGGAACCCAATGCCAACCATGCGGTGGCTGAAAAACGGGAAGGAGTTTAAGCAGGAGCATCGCATTGGAGGC
TACAAGGTACGAAACCAGCACTGGAGCCTCATTATGGAAAGTGTGGTCCCATCTGACAAGGGAAATTATACCTGTGTAGTGGAGAATGAA
TACGGGTCCATCAATCACACGTACCACCTGGATGTTGTGGAGCGATCGCCTCACCGGCCCATCCTCCAAGCCGGACTGCCGGCAAATGCC
TCCACAGTGGTCGGAGGAGACGTAGAGTTTGTCTGCAAGGTTTACAGTGATGCCCAGCCCCACATCCAGTGGATCAAGCACGTGGAAAAG
AACGGCAGTAAATACGGGCCCGACGGGCTGCCCTACCTCAAGGTTCTCAAGGCCGCCGGTGTTAACACCACGGACAAAGAGATTGAGGTT
CTCTATATTCGGAATGTAACTTTTGAGGACGCTGGGGAATATACGTGCTTGGCGGGTAATTCTATTGGGATATCCTTTCACTCTGCATGG
TTGACAGTTCTGCCAGCGCCTGGAAGAGAAAAGGAGATTACAGCTTCCCCAGACTACCTGGAGATAGCCATTTACTGCATAGGGGTCTTC
TTAATCGCCTGTATGGTGGTAACAGTCATCCTGTGCCGAATGAAGAACACGACCAAGAAGCCAGACTTCAGCAGCCAGCCGGCTGTGCAC
AAGCTGACCAAACGTATCCCCCTGCGGAGACAGGTTTCGGCTGAGTCCAGCTCCTCCATGAACTCCAACACCCCGCTGGTGAGGATAACA
ACACGCCTCTCTTCAACGGCAGACACCCCCATGCTGGCAGGGGTCTCCGAGTATGAACTTCCAGAGGACCCAAAATGGGAGTTTCCAAGA
GATAAGCTGACACTGGGCAAGCCCCTGGGAGAAGGTTGCTTTGGGCAAGTGGTCATGGCGGAAGCAGTGGGAATTGACAAAGACAAGCCC
AAGGAGGCGGTCACCGTGGCCGTGAAGATGTTGAAAGATGATGCCACAGAGAAAGACCTTTCTGATCTGGTGTCAGAGATGGAGATGATG
AAGATGATTGGGAAACACAAGAATATCATAAATCTTCTTGGAGCCTGCACACAGGATGGGCCTCTCTATGTCATAGTTGAGTATGCCTCT
AAAGGCAACCTCCGAGAATACCTCCGAGCCCGGAGGCCACCCGGGATGGAGTACTCCTATGACATTAACCGTGTTCCTGAGGAGCAGATG
ACCTTCAAGGACTTGGTGTCATGCACCTACCAGCTGGCCAGAGGCATGGAGTACTTGGCTTCCCAAAAATGTATTCATCGAGATTTAGCA
GCCAGAAATGTTTTGGTAACAGAAAACAATGTGATGAAAATAGCAGACTTTGGACTCGCCAGAGATATCAACAATATAGACTATTACAAA
AAGACCACCAATGGGCGGCTTCCAGTCAAGTGGATGGCTCCAGAAGCCCTGTTTGATAGAGTATACACTCATCAGAGTGATGTCTGGTCC
TTCGGGGTGTTAATGTGGGAGATCTTCACTTTAGGGGGCTCGCCCTACCCAGGGATTCCCGTGGAGGAACTTTTTAAGCTGCTGAAGGAA
GGACACAGAATGGATAAGCCAGCCAACTGCACCAACGAACTGTACATGATGATGAGGGACTGTTGGCATGCAGTGCCCTCCCAGAGACCA
ACGTTCAAGCAGTTGGTAGAAGACTTGGATCGAATTCTCACTCTCACAACCAATGAGTTAGAATCAAGAATAGAAGAACTTAATAAAGAA
GTTAAAGCTTCCAGAGATCAACTAATAGCTCAAGACGTTACAGCTAAAAATGCAGTTCAGCAGTTACACAAAGAGATGGCCCAACGGATG
GAACAGGCCAACAAGAAATGTGAAGAGGCACGCCAAGAAAAAGAAGCAATGGTAATGAAATATGTAAGAGGTGAGAAGGAATCTTTAGAT
CTTCGAAAGGAAAAAGAGACACTTGAGAAAAAACTTAGAGATGCAAATAAGGAACTTGAGAAAAACACTAACAAAATTAAGCAGCTTTCT
CAGGAGAAAGGACGGTTGCACCAGCTGTATGAAACTAAGGAAGGCGAAACGACTAGACTCATCAGAGAAATAGACAAATTAAAGGAAGAC
ATTAACTCTCACGTCATCAAAGTAAAGTGGGCACAAAACAAATTAAAAGCTGAAATGGATTCACACAAGGAAACCAAAGATAAACTCAAA
GAAACAACAACAAAATTAACACAAGCAAAGGAAGAAGCAGATCAGATACGAAAAAACTGTCAGGATATGATAAAAACATATCAGGAGTCA
GAAGAAATTAAATCAAATGAGCTTGATGCAAAGCTTAGAGTCACAAAAGGAGAACTTGAAAAACAAATGCAAGAAAAATCTGACCAGCTA
GAGATGCATCATGCCAAAATAAAGGAACTAGAAGATCTGAAGAGAACATTTAAGGAGGGTATGGATGAGTTAAGAACACTGAGAACAAAG
GTGAAATGTCTAGAAGATGAACGATTAAGAACAGAAGATGAATTATCAAAATATAAGGAAATTATTAATCGCCAAAAAGCTGAAATTCAG
AATTTATTGGACAAGGTGAAAACTGCAGATCAGCTACAGGAGCAGCTTCAAAGAGGTAAGCAAGAAATTGAAAATTTGAAAGAAGAAGTG
GAAAGTCTTAATTCTTTGATTAATGACCTACAAAAAGACATCGAAGGCAGTAGGAAAAGAGAATCTGAGCTGCTGCTGTTTACAGAAAGG
CTCACTAGTAAGAATGCACAGCTTCAGTCTGAATCCAATTCTTTGCAGTCACAATTTGATAAAGTTTCCTGTAGTGAAAGTCAGTTACAA
AGCCAGTGTGAACAAATGAAACAGACAAATATTAATTTGGAAAGTAGGTTGTTGAAAGAGGAAGAACTGCGAAAAGAGGAAGTCCAAACT
CTGCAAGCTGAACTCGCTTGTAGACAAACAGAAGTTAAAGCATTGAGTACCCAGGTAGAAGAATTAAAAGATGAGTTAGTAACTCAGAGA
CGTAAACATGCCTCTAGTATCAAGGATCTCACCAAACAACTTCAGCAAGCACGAAGAAAATTAGATCAGGTTGAGAGTGGAAGCTATGAC
AAAGAAGTCAGCAGCATGGGAAGTCGTTCTAGTTCATCAGGGTCCCTGAATGCTCGAAGCAGTGCAGAAGATCGATCTCCAGAAAATACT
GGGTCCTCAGTAGCTGTGGATAACTTTCCACAAGTAGATAAGGCCATGTTGATTGAGAGAATAGTTAGGCTGCAAAAAGCACATGCCCGG
AAAAATGAAAAGATAGAATTTATGGAGGACCACATCAAACAACTGGTGGAAGAAATTAGGAAAAAAACAAAAATAATTCAAAGTTATATT
TTACGAGAAGAATCAGGCACACTTTCTTCAGAGGCATCTGATTTTAACAAAGTTCATTTAAGTAGACGGGGTGGCATCATGGCATCTTTA
TATACATCCCATCCAGCTGACAATGGATTAACATTGGAGCTCTCTTTGGAAATCAACCGAAAATTACAGGCTGTTTTGGAGGATACGTTA
CTAAAAAATATTACTTTGAAGGAAAATCTACAAACACTTGGAACAGAAATAGAACGTCTTATTAAACACCAGCATGAACTAGAACAGAGG
ACAAAGAAAACCTAAAACAAGCCTCTTGCTCAGTAAAGAGACAAAAGCCACACAGGAGTAGGTGCCACTGACCTCTATTGTTGGAGACTT
TGTTCCACTTTTTGTTTCAGCCAGTAAAAATATTGTTTTGCTTCATCTGTACACAAAAAAATACCCTTTTACAATATGAATGCATTGCTG
TATATACTGTAAGACTGAAAGCTTTGATGAAATTTGTTTTTGTATGGTGCAATATGACAGCCTGTCATTGAATCTAAACAACTTAATTTG
CTTGTATTCATAAGAAGTGTTGAACATTACAAGGGCTTTTATAAAAAACCCTTTGTTCATATTTCTTCCCTTTAAAATATGTAATGTCAA
AAATGACTCACCTTTTAAAAATTATGCATGAAAACAGGTGGTAAACATTCAGTAATACGCTATTTCTCCAACATCAAGACAACTAAAACA
AATGATAAAAATGTTTATTTTTACACTCCAGCATATCGGGTGAGTTTTAGGGATGTGTATGAATATTTAAATCTTTTAATTTCAGTTTTA
ATGAAAGCTGAACTTAATAGGAAAGCTAGCTCTTGGTAACTAGCAATGATCAGGCATTGTTTGCCTCTGTCAGGTTTTCTTATCTGTTTT
AGGTACATTTTTTCAGATTCTGATTGTTTGAGTTAATGGTTGAATTTTTAAAGTTTTTAGTTACTTAAAATATGATTTTAAATTACATAT
TAATTTAGAAAATTCCTGTGTTTACTTATATTTTAAATTGTGAAATGGATCCAATCATTAGAACAGAGAGAATAGTTCTTTGAAACTGAA
ATACTTTAGTTTTACTGACCTTGTGTAAAGATAATATGAAGAACCAGCTTCCAAAAGAAACCAGCATATGGCACTATAAACTATTTCATT
TGAGCACCATTCTTTACCATGGATATATTAATTATGTATTATAGTGGAGTGATCATACAGTTCCCCCAAATGTGATGTTTCAGTGTATTT
ATTTAAAACATAAAGTAGACCAGGTGCAGTAGCTCACGCCTGTAATCCCAGCACTTTGGGAAGCCAAGGCAGGAGGATTACCTGAGGCCA
GGAGTTTAAGACCAGCCTTGGCAACATAGCGAGACCCCCATCTCTACAAAGAAATTTTAAAAGATTATCCAGGCATGGTGGTGCATGCCT
ATGGTTCCAGCTACTCGGGAGGCTGAAGCGGTAGAATCACTTGAGCACAGGAGGTCAAGGCTGCAGGTGAGCCATGATCGTGTCACTGCA
CTCCAGCCTAGGCAACAGAGCAAGACCCTGTCTCTTAAAACAAAAAACCTCACACATACCTAAAATAAGTATATATCTGTAACCAAAGGA
ACTTAATTTTAGAGCCAAATTTTTCTATCTTGTTGGATTTTTTACAGTGTTTAAGATAGACACTTAAGTGTTGCCGTAGTATCAATATTT
CTGTCATTGAATTTTTTCTCACCCCTTATTATTTCTCACTTACAATTTCTGAGCATGATTTTTCATAATTCATTATCTTCAGATCATTAC
TATAATAAGATACCGTGGCTCTTATGCAGATATTGCAGCAAGCCTTGTTTGGTTTGGATTTTTGCATCCCTTTTTCTCCCATTAAGGGAA
TTAAGTTTTGGGATGATGGATTAAAAGCCTGTAAAGAATTGTTTGGGCTCTAAAAGTTGGGCTCATGGTGGCAATATCCTTTTAATGTGT
TTTAACATTTTTTAATCAACATCGTTTAAAAATAATTTACTAAGGATTAGATTATTTAATGAATGTCTTTTTTTCTATATATTGAATTAG
ATGTTATCCCAAAAAAAATATCTTTTCACTTCAAAATGAAAATATATGTTCAAAGATGTTTTATTTTTAGAATAGTTATAAAAAGTATTA
GTCTTAACATAATGTGTCTTGTTCTTTTTACCAATAATAATTTATCAAAATAAGAGGGAAAGTGCAATCAAATCTGAATTATTTTACTAT
TTGTTTCTAGACACACTACTTAACACTCCTAAAGACTACTTTGAGTAGGCAACATAACTAAATTTTTCTAGTTTCTTATGATACAGGTTC
ATAAACTACAATATTTGGATTTTTTTCCCCAAGGCACAAAATGTATAATGGAGACCAAATAGTGATCTGATCCATAGTATCCTATGCCTA
TACACTTTAAAATGTATATACATTTTAGACAAAAATGCACACTCCAGTATTAATATTTGTGCTACCATCTACTTGGAGAAGTTTAATGAG
AAAATTTTAGAAGAAAAGTATTACAAACAATATTTTGACTCTATTACCTGTTTTGCCTTATACATTTTAGAAACTGGAAATTTTTTAAAG
AAAATGCTTTAGTTTTCTTCTGTTCTTCACTGTCTACAGTGTGCTTTTGTATATGGATCAGGACTGAGCAAAGTAATTACATGTATCAGA
GATACTTATCTCTATACTAATTCACAGACAGCTCCTGATGTAAGGATTTAGAGGGCCTTCTGCCCTCTGAATATATGGTGAGGAGAATGG
GGTATCTGGAAAAGGAAAATGATCTGGATAAATCTGAGACCTGGGGGGAAGTTTGTTTTATATGTTCATTATTGGTTGTTACATATCAAG
GCTGTTTTGGTTATGTATCAATATTGTGGTTTATTTGAGCTGGAAGTGATTTTTTCTGTGTATGTATATGTATACACTTCAATAGGTTTT
AATTTTGAAGTGAATATTTGCCATGACTCCATTTTCCCCATACCACTTCAGACTTTAGCCTGTTTAGTTTTAAGGACTGAAAATGGTAGG
TTTGGGCAGAAGAATGAATTTGAACTTTGATGGGGTTTTTTTGTTTTTACTTTCTATCTTCATAACCATTTAAAGCGATTTAGCTTGAAA
TTAAATTTTATCAGGCTACCAACATGTTATTTATTTATTTAATAAACACATTTATTGAAAACCTATACTATTGTATTGGCACCATACAGG
GTATTGTATTTATACTAGTGAGCAGACCAGGGCATTTCCATCCTCATGGAGTTCATGGTCTAATGAAAATAGCTGGGGCCGGGTGTGGTG
GCTCACCCCTGTAATCCCAGCACTTTGGGAGGCTGAGGTGGGAGGATTGTTTGAGCCCAGGAGTTTGAGACCAGCCAGGGCAACATGGCA
AAACCCCATGTGTACAAAAGATTAAAAAATTAGCCAGATGCAGTGGCACATGGCTGGGGTCCCAGCTACCCAGGAGGCTGAGTTGGGAGG
ATCATCTGAGCCTGGGAGGTTGAAGCTTGCAGTGAGCTATGATTGCCACTGTACTCTATACTCCAGCCTGGGTGACAGAGTGAAACCCTG
TCTCAAAAAAAAAAGAGGAAAGAAAATAGCTAGGAGACAATCAGAGCAGATCTTGGGCTTCTGTGGCTCATCTCAGCCCTTTATAACTGG
CCTGAGAAGAGGGTTTATCTACTTGTGCAAGTGGCCCAGAAATCTCACTCGTACATGAGGCTTTGGAACATCCTTGCAAAGGTACGCTGA
AAGCAAATTGCTGTTTTCCTGGTGGTTCTGCACGTTTCCTAACTTTTATCATAGTTTGATTTTCATTATTTAAGAAAAAATAAAAAATCC
AAAGACCATAAGATGGCATTAGATTTTTTACCATTAAATTATTAATGCCTATTTGGTGCTCATAAAGATTAATCATGTCACGCATGTTTC
CAATCTTTCTTTTGCAGTATATTATTTTCTAAAAATTGTTACATGCAAATTTAAACCAAGATTTATCAGTAAAAGAAAAAAATAGAATCC
TTAATAATGTAAATGTTGTTATATATGCTACCCTGGTGAAAATATTTTTATAAATCATGTTGTCATTTATGCTTTATGTAGCCTATTTTT
CAATAACCTTTTTTTAAAAGCAATTTTTTTTGACACCAAGATTGTTGATTTTTAATTAACACCAGTTGGTGGCACTAGAAACCTGAAATT
TTTCAAAGATGAACAAAGAAAAATTGAAAAGGTAATCTAAACATGGAGAATTTTTAGGAAAATAAATGAAAAATATAATTGTATATTAGA
GATGTATTTTTCTTCTGGAATGGAATTCTTTTTCTAAAATGCAAATCGCTATCCATTTTGACTGCAATGATGAAACTTGTTTATCTTCCA
GAGGACATATATATATGTGTGTGTGTGTGTATTGTACAGATACCTTTAATTTGATTACACTGTTTCTTGTAAATATGTTTCTGTATAAAA

>In-frame_FGFR2_ENST00000369056_chr10_123243212_-_C10orf118_ENST00000369287_chr10_115910979_-_8547nt
GGACCGGGGATTGGTACCGTAACCATGGTCAGCTGGGGTCGTTTCATCTGCCTGGTCGTGGTCACCATGGCAACCTTGTCCCTGGCCCGG
CCCTCCTTCAGTTTAGTTGAGGATACCACATTAGAGCCAGAAGAGCCACCAACCAAATACCAAATCTCTCAACCAGAAGTGTACGTGGCT
GCGCCAGGGGAGTCGCTAGAGGTGCGCTGCCTGTTGAAAGATGCCGCCGTGATCAGTTGGACTAAGGATGGGGTGCACTTGGGGCCCAAC
AATAGGACAGTGCTTATTGGGGAGTACTTGCAGATAAAGGGCGCCACGCCTAGAGACTCCGGCCTCTATGCTTGTACTGCCAGTAGGACT
GTAGACAGTGAAACTTGGTACTTCATGGTGAATGTCACAGATGCCATCTCATCCGGAGATGATGAGGATGACACCGATGGTGCGGAAGAT
TTTGTCAGTGAGAACAGTAACAACAAGAGAGCACCATACTGGACCAACACAGAAAAGATGGAAAAGCGGCTCCATGCTGTGCCTGCGGCC
AACACTGTCAAGTTTCGCTGCCCAGCCGGGGGGAACCCAATGCCAACCATGCGGTGGCTGAAAAACGGGAAGGAGTTTAAGCAGGAGCAT
CGCATTGGAGGCTACAAGGTACGAAACCAGCACTGGAGCCTCATTATGGAAAGTGTGGTCCCATCTGACAAGGGAAATTATACCTGTGTA
GTGGAGAATGAATACGGGTCCATCAATCACACGTACCACCTGGATGTTGTGGAGCGATCGCCTCACCGGCCCATCCTCCAAGCCGGACTG
CCGGCAAATGCCTCCACAGTGGTCGGAGGAGACGTAGAGTTTGTCTGCAAGGTTTACAGTGATGCCCAGCCCCACATCCAGTGGATCAAG
CACGTGGAAAAGAACGGCAGTAAATACGGGCCCGACGGGCTGCCCTACCTCAAGGTTCTCAAGCACTCGGGGATAAATAGTTCCAATGCA
GAAGTGCTGGCTCTGTTCAATGTGACCGAGGCGGATGCTGGGGAATATATATGTAAGGTCTCCAATTATATAGGGCAGGCCAACCAGTCT
GCCTGGCTCACTGTCCTGCCAAAACAGCAAGCGCCTGGAAGAGAAAAGGAGATTACAGCTTCCCCAGACTACCTGGAGATAGCCATTTAC
TGCATAGGGGTCTTCTTAATCGCCTGTATGGTGGTAACAGTCATCCTGTGCCGAATGAAGAACACGACCAAGAAGCCAGACTTCAGCAGC
CAGCCGGCTGTGCACAAGCTGACCAAACGTATCCCCCTGCGGAGACAGGTAACAGTTTCGGCTGAGTCCAGCTCCTCCATGAACTCCAAC
ACCCCGCTGGTGAGGATAACAACACGCCTCTCTTCAACGGCAGACACCCCCATGCTGGCAGGGGTCTCCGAGTATGAACTTCCAGAGGAC
CCAAAATGGGAGTTTCCAAGAGATAAGCTGACACTGGGCAAGCCCCTGGGAGAAGGTTGCTTTGGGCAAGTGGTCATGGCGGAAGCAGTG
GGAATTGACAAAGACAAGCCCAAGGAGGCGGTCACCGTGGCCGTGAAGATGTTGAAAGATGATGCCACAGAGAAAGACCTTTCTGATCTG
GTGTCAGAGATGGAGATGATGAAGATGATTGGGAAACACAAGAATATCATAAATCTTCTTGGAGCCTGCACACAGGATGGGCCTCTCTAT
GTCATAGTTGAGTATGCCTCTAAAGGCAACCTCCGAGAATACCTCCGAGCCCGGAGGCCACCCGGGATGGAGTACTCCTATGACATTAAC
CGTGTTCCTGAGGAGCAGATGACCTTCAAGGACTTGGTGTCATGCACCTACCAGCTGGCCAGAGGCATGGAGTACTTGGCTTCCCAAAAA
TGTATTCATCGAGATTTAGCAGCCAGAAATGTTTTGGTAACAGAAAACAATGTGATGAAAATAGCAGACTTTGGACTCGCCAGAGATATC
AACAATATAGACTATTACAAAAAGACCACCAATGGGCGGCTTCCAGTCAAGTGGATGGCTCCAGAAGCCCTGTTTGATAGAGTATACACT
CATCAGAGTGATGTCTGGTCCTTCGGGGTGTTAATGTGGGAGATCTTCACTTTAGGGGGCTCGCCCTACCCAGGGATTCCCGTGGAGGAA
CTTTTTAAGCTGCTGAAGGAAGGACACAGAATGGATAAGCCAGCCAACTGCACCAACGAACTGTACATGATGATGAGGGACTGTTGGCAT
GCAGTGCCCTCCCAGAGACCAACGTTCAAGCAGTTGGTAGAAGACTTGGATCGAATTCTCACTCTCACAACCAATGAGTTAGAATCAAGA
ATAGAAGAACTTAATAAAGAAGTTAAAGCTTCCAGAGATCAACTAATAGCTCAAGACGTTACAGCTAAAAATGCAGTTCAGCAGTTACAC
AAAGAGATGGCCCAACGGATGGAACAGGCCAACAAGAAATGTGAAGAGGCACGCCAAGAAAAAGAAGCAATGGTAATGAAATATGTAAGA
GGTGAGAAGGAATCTTTAGATCTTCGAAAGGAAAAAGAGACACTTGAGAAAAAACTTAGAGATGCAAATAAGGAACTTGAGAAAAACACT
AACAAAATTAAGCAGCTTTCTCAGGAGAAAGGACGGTTGCACCAGCTGTATGAAACTAAGGAAGGCGAAACGACTAGACTCATCAGAGAA
ATAGACAAATTAAAGGAAGACATTAACTCTCACGTCATCAAAGTAAAGTGGGCACAAAACAAATTAAAAGCTGAAATGGATTCACACAAG
GAAACCAAAGATAAACTCAAAGAAACAACAACAAAATTAACACAAGCAAAGGAAGAAGCAGATCAGATACGAAAAAACTGTCAGGATATG
ATAAAAACATATCAGGAGTCAGAAGAAATTAAATCAAATGAGCTTGATGCAAAGCTTAGAGTCACAAAAGGAGAACTTGAAAAACAAATG
CAAGAAAAATCTGACCAGCTAGAGATGCATCATGCCAAAATAAAGGAACTAGAAGATCTGAAGAGAACATTTAAGGAGGGTATGGATGAG
TTAAGAACACTGAGAACAAAGGTGAAATGTCTAGAAGATGAACGATTAAGAACAGAAGATGAATTATCAAAATATAAGGAAATTATTAAT
CGCCAAAAAGCTGAAATTCAGAATTTATTGGACAAGGTGAAAACTGCAGATCAGCTACAGGAGCAGCTTCAAAGAGGTAAGCAAGAAATT
GAAAATTTGAAAGAAGAAGTGGAAAGTCTTAATTCTTTGATTAATGACCTACAAAAAGACATCGAAGGCAGTAGGAAAAGAGAATCTGAG
CTGCTGCTGTTTACAGAAAGGCTCACTAGTAAGAATGCACAGCTTCAGTCTGAATCCAATTCTTTGCAGTCACAATTTGATAAAGTTTCC
TGTAGTGAAAGTCAGTTACAAAGCCAGTGTGAACAAATGAAACAGACAAATATTAATTTGGAAAGTAGGTTGTTGAAAGAGGAAGAACTG
CGAAAAGAGGAAGTCCAAACTCTGCAAGCTGAACTCGCTTGTAGACAAACAGAAGTTAAAGCATTGAGTACCCAGGTAGAAGAATTAAAA
GATGAGTTAGTAACTCAGAGACGTAAACATGCCTCTAGTATCAAGGATCTCACCAAACAACTTCAGCAAGCACGAAGAAAATTAGATCAG
GTTGAGAGTGGAAGCTATGACAAAGAAGTCAGCAGCATGGGAAGTCGTTCTAGTTCATCAGGGTCCCTGAATGCTCGAAGCAGTGCAGAA
GATCGATCTCCAGAAAATACTGGGTCCTCAGTAGCTGTGGATAACTTTCCACAAGTAGATAAGGCCATGTTGATTGAGAGAATAGTTAGG
CTGCAAAAAGCACATGCCCGGAAAAATGAAAAGATAGAATTTATGGAGGACCACATCAAACAACTGGTGGAAGAAATTAGGAAAAAAACA
AAAATAATTCAAAGTTATATTTTACGAGAAGAATCAGGCACACTTTCTTCAGAGGCATCTGATTTTAACAAAGTTCATTTAAGTAGACGG
GGTGGCATCATGGCATCTTTATATACATCCCATCCAGCTGACAATGGATTAACATTGGAGCTCTCTTTGGAAATCAACCGAAAATTACAG
GCTGTTTTGGAGGATACGTTACTAAAAAATATTACTTTGAAGGAAAATCTACAAACACTTGGAACAGAAATAGAACGTCTTATTAAACAC
CAGCATGAACTAGAACAGAGGACAAAGAAAACCTAAAACAAGCCTCTTGCTCAGTAAAGAGACAAAAGCCACACAGGAGTAGGTGCCACT
GACCTCTATTGTTGGAGACTTTGTTCCACTTTTTGTTTCAGCCAGTAAAAATATTGTTTTGCTTCATCTGTACACAAAAAAATACCCTTT
TACAATATGAATGCATTGCTGTATATACTGTAAGACTGAAAGCTTTGATGAAATTTGTTTTTGTATGGTGCAATATGACAGCCTGTCATT
GAATCTAAACAACTTAATTTGCTTGTATTCATAAGAAGTGTTGAACATTACAAGGGCTTTTATAAAAAACCCTTTGTTCATATTTCTTCC
CTTTAAAATATGTAATGTCAAAAATGACTCACCTTTTAAAAATTATGCATGAAAACAGGTGGTAAACATTCAGTAATACGCTATTTCTCC
AACATCAAGACAACTAAAACAAATGATAAAAATGTTTATTTTTACACTCCAGCATATCGGGTGAGTTTTAGGGATGTGTATGAATATTTA
AATCTTTTAATTTCAGTTTTAATGAAAGCTGAACTTAATAGGAAAGCTAGCTCTTGGTAACTAGCAATGATCAGGCATTGTTTGCCTCTG
TCAGGTTTTCTTATCTGTTTTAGGTACATTTTTTCAGATTCTGATTGTTTGAGTTAATGGTTGAATTTTTAAAGTTTTTAGTTACTTAAA
ATATGATTTTAAATTACATATTAATTTAGAAAATTCCTGTGTTTACTTATATTTTAAATTGTGAAATGGATCCAATCATTAGAACAGAGA
GAATAGTTCTTTGAAACTGAAATACTTTAGTTTTACTGACCTTGTGTAAAGATAATATGAAGAACCAGCTTCCAAAAGAAACCAGCATAT
GGCACTATAAACTATTTCATTTGAGCACCATTCTTTACCATGGATATATTAATTATGTATTATAGTGGAGTGATCATACAGTTCCCCCAA
ATGTGATGTTTCAGTGTATTTATTTAAAACATAAAGTAGACCAGGTGCAGTAGCTCACGCCTGTAATCCCAGCACTTTGGGAAGCCAAGG
CAGGAGGATTACCTGAGGCCAGGAGTTTAAGACCAGCCTTGGCAACATAGCGAGACCCCCATCTCTACAAAGAAATTTTAAAAGATTATC
CAGGCATGGTGGTGCATGCCTATGGTTCCAGCTACTCGGGAGGCTGAAGCGGTAGAATCACTTGAGCACAGGAGGTCAAGGCTGCAGGTG
AGCCATGATCGTGTCACTGCACTCCAGCCTAGGCAACAGAGCAAGACCCTGTCTCTTAAAACAAAAAACCTCACACATACCTAAAATAAG
TATATATCTGTAACCAAAGGAACTTAATTTTAGAGCCAAATTTTTCTATCTTGTTGGATTTTTTACAGTGTTTAAGATAGACACTTAAGT
GTTGCCGTAGTATCAATATTTCTGTCATTGAATTTTTTCTCACCCCTTATTATTTCTCACTTACAATTTCTGAGCATGATTTTTCATAAT
TCATTATCTTCAGATCATTACTATAATAAGATACCGTGGCTCTTATGCAGATATTGCAGCAAGCCTTGTTTGGTTTGGATTTTTGCATCC
CTTTTTCTCCCATTAAGGGAATTAAGTTTTGGGATGATGGATTAAAAGCCTGTAAAGAATTGTTTGGGCTCTAAAAGTTGGGCTCATGGT
GGCAATATCCTTTTAATGTGTTTTAACATTTTTTAATCAACATCGTTTAAAAATAATTTACTAAGGATTAGATTATTTAATGAATGTCTT
TTTTTCTATATATTGAATTAGATGTTATCCCAAAAAAAATATCTTTTCACTTCAAAATGAAAATATATGTTCAAAGATGTTTTATTTTTA
GAATAGTTATAAAAAGTATTAGTCTTAACATAATGTGTCTTGTTCTTTTTACCAATAATAATTTATCAAAATAAGAGGGAAAGTGCAATC
AAATCTGAATTATTTTACTATTTGTTTCTAGACACACTACTTAACACTCCTAAAGACTACTTTGAGTAGGCAACATAACTAAATTTTTCT
AGTTTCTTATGATACAGGTTCATAAACTACAATATTTGGATTTTTTTCCCCAAGGCACAAAATGTATAATGGAGACCAAATAGTGATCTG
ATCCATAGTATCCTATGCCTATACACTTTAAAATGTATATACATTTTAGACAAAAATGCACACTCCAGTATTAATATTTGTGCTACCATC
TACTTGGAGAAGTTTAATGAGAAAATTTTAGAAGAAAAGTATTACAAACAATATTTTGACTCTATTACCTGTTTTGCCTTATACATTTTA
GAAACTGGAAATTTTTTAAAGAAAATGCTTTAGTTTTCTTCTGTTCTTCACTGTCTACAGTGTGCTTTTGTATATGGATCAGGACTGAGC
AAAGTAATTACATGTATCAGAGATACTTATCTCTATACTAATTCACAGACAGCTCCTGATGTAAGGATTTAGAGGGCCTTCTGCCCTCTG
AATATATGGTGAGGAGAATGGGGTATCTGGAAAAGGAAAATGATCTGGATAAATCTGAGACCTGGGGGGAAGTTTGTTTTATATGTTCAT
TATTGGTTGTTACATATCAAGGCTGTTTTGGTTATGTATCAATATTGTGGTTTATTTGAGCTGGAAGTGATTTTTTCTGTGTATGTATAT
GTATACACTTCAATAGGTTTTAATTTTGAAGTGAATATTTGCCATGACTCCATTTTCCCCATACCACTTCAGACTTTAGCCTGTTTAGTT
TTAAGGACTGAAAATGGTAGGTTTGGGCAGAAGAATGAATTTGAACTTTGATGGGGTTTTTTTGTTTTTACTTTCTATCTTCATAACCAT
TTAAAGCGATTTAGCTTGAAATTAAATTTTATCAGGCTACCAACATGTTATTTATTTATTTAATAAACACATTTATTGAAAACCTATACT
ATTGTATTGGCACCATACAGGGTATTGTATTTATACTAGTGAGCAGACCAGGGCATTTCCATCCTCATGGAGTTCATGGTCTAATGAAAA
TAGCTGGGGCCGGGTGTGGTGGCTCACCCCTGTAATCCCAGCACTTTGGGAGGCTGAGGTGGGAGGATTGTTTGAGCCCAGGAGTTTGAG
ACCAGCCAGGGCAACATGGCAAAACCCCATGTGTACAAAAGATTAAAAAATTAGCCAGATGCAGTGGCACATGGCTGGGGTCCCAGCTAC
CCAGGAGGCTGAGTTGGGAGGATCATCTGAGCCTGGGAGGTTGAAGCTTGCAGTGAGCTATGATTGCCACTGTACTCTATACTCCAGCCT
GGGTGACAGAGTGAAACCCTGTCTCAAAAAAAAAAGAGGAAAGAAAATAGCTAGGAGACAATCAGAGCAGATCTTGGGCTTCTGTGGCTC
ATCTCAGCCCTTTATAACTGGCCTGAGAAGAGGGTTTATCTACTTGTGCAAGTGGCCCAGAAATCTCACTCGTACATGAGGCTTTGGAAC
ATCCTTGCAAAGGTACGCTGAAAGCAAATTGCTGTTTTCCTGGTGGTTCTGCACGTTTCCTAACTTTTATCATAGTTTGATTTTCATTAT
TTAAGAAAAAATAAAAAATCCAAAGACCATAAGATGGCATTAGATTTTTTACCATTAAATTATTAATGCCTATTTGGTGCTCATAAAGAT
TAATCATGTCACGCATGTTTCCAATCTTTCTTTTGCAGTATATTATTTTCTAAAAATTGTTACATGCAAATTTAAACCAAGATTTATCAG
TAAAAGAAAAAAATAGAATCCTTAATAATGTAAATGTTGTTATATATGCTACCCTGGTGAAAATATTTTTATAAATCATGTTGTCATTTA
TGCTTTATGTAGCCTATTTTTCAATAACCTTTTTTTAAAAGCAATTTTTTTTGACACCAAGATTGTTGATTTTTAATTAACACCAGTTGG
TGGCACTAGAAACCTGAAATTTTTCAAAGATGAACAAAGAAAAATTGAAAAGGTAATCTAAACATGGAGAATTTTTAGGAAAATAAATGA
AAAATATAATTGTATATTAGAGATGTATTTTTCTTCTGGAATGGAATTCTTTTTCTAAAATGCAAATCGCTATCCATTTTGACTGCAATG
ATGAAACTTGTTTATCTTCCAGAGGACATATATATATGTGTGTGTGTGTGTATTGTACAGATACCTTTAATTTGATTACACTGTTTCTTG


Top

FusionGenePPI for FGFR2_C10orf118


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FGFR2FGF1, FGFR2, FGF7, FGF10, PIK3R1, ITGA5, STAT3, PGR, STAT5A, STAT5B, NEDD4, FRS2, CBL, LYN, FYN, HGS, APP, PPM1A, TSPAN3, C8orf74, BEX1, BEX2, ERRFI1, GLCE, HOXC6, MTA3, PDLIM2, RASL10B, RHOBTB2, S100A14, TFF1, FGF5, FGF23, FGF8, PLCG1, FGF2, FGF3, FGF6, FGF9, FGF17, PVRL1, BRAF, MAP3K1, PTPN6, PTPN11, PTPN12, PTPRR, FGFR3, FGFR1, SNX24, GAPVD1, SNX22, UBE4A, IP6K1, RPS6KA3, IFFO2, TMEM30B, DNAJC30, XPR1, GOLGA3, KIDINS220, BCL11A, CEP295, CD44, RPS6KA2, LRRIQ1, RPS6KA1, LITAF, MRAP2, SDC2, FCGRT, SIGLECL1, RAET1E, FAM171B, CHERP, U2SURP, SLC9A6, TIMP1, CCDC120, CD83, PKP4, UBXN4, CTDSP1, CTDSPL, DUSP14, MTMR3C10orf118


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FGFR2_C10orf118


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneFGFR2P21802DB00039PaliferminFibroblast growth factor receptor 2biotechapproved
HgeneFGFR2P21802DB08896RegorafenibFibroblast growth factor receptor 2small moleculeapproved
HgeneFGFR2P21802DB09079NintedanibFibroblast growth factor receptor 2small moleculeapproved
HgeneFGFR2P21802DB01109HeparinFibroblast growth factor receptor 2small moleculeapproved|investigational
HgeneFGFR2P21802DB08901PonatinibFibroblast growth factor receptor 2small moleculeapproved|investigational
HgeneFGFR2P21802DB09078LenvatinibFibroblast growth factor receptor 2small moleculeapproved|investigational
HgeneFGFR2P21802DB01041ThalidomideFibroblast growth factor receptor 2small moleculeapproved|investigational|withdrawn

Top

RelatedDiseases for FGFR2_C10orf118


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFGFR2C2931196Craniofacial dysostosis type 121ORPHANET;UNIPROT
HgeneFGFR2C0220658Pfeiffer Syndrome10UNIPROT
HgeneFGFR2C0001193Apert syndrome8ORPHANET;UNIPROT
HgeneFGFR2C1510455Acrocephalosyndactylia4CTD_human
HgeneFGFR2C0010278Craniosynostosis3CTD_human;HPO
HgeneFGFR2C0036341Schizophrenia3PSYGENET
HgeneFGFR2C0376634Craniofacial Abnormalities3CTD_human
HgeneFGFR2C1458155Mammary Neoplasms3CTD_human
HgeneFGFR2C0011570Mental Depression2PSYGENET
HgeneFGFR2C0011581Depressive disorder2PSYGENET
HgeneFGFR2C0038356Stomach Neoplasms2CTD_human
HgeneFGFR2C1865070SCAPHOCEPHALY, MAXILLARY RETRUSION, AND MENTAL RETARDATION2CTD_human;ORPHANET;UNIPROT
HgeneFGFR2C0003090Ankylosis1CTD_human
HgeneFGFR2C0005586Bipolar Disorder1PSYGENET
HgeneFGFR2C0008924Cleft Lip1CTD_human
HgeneFGFR2C0008925Cleft Palate1CTD_human;HPO
HgeneFGFR2C0010273Craniofacial Dysostosis1CTD_human;HPO
HgeneFGFR2C0014170Endometrial Neoplasms1CTD_human
HgeneFGFR2C0018553Hamartoma Syndrome, Multiple1CTD_human
HgeneFGFR2C0023890Liver Cirrhosis1CTD_human
HgeneFGFR2C0024121Lung Neoplasms1CTD_human
HgeneFGFR2C0026613Motor Skills Disorders1CTD_human
HgeneFGFR2C0033975Psychotic Disorders1PSYGENET
HgeneFGFR2C0037268Skin Abnormalities1CTD_human
HgeneFGFR2C0037274Dermatologic disorders1CTD_human
HgeneFGFR2C0040427Tooth Abnormalities1CTD_human
HgeneFGFR2C0080178Spina Bifida1CTD_human
HgeneFGFR2C0206698Cholangiocarcinoma1CTD_human
HgeneFGFR2C0206762Limb Deformities, Congenital1CTD_human
HgeneFGFR2C0265269Lacrimoauriculodentodigital syndrome1CTD_human;ORPHANET;UNIPROT
HgeneFGFR2C0349204Nonorganic psychosis1PSYGENET
HgeneFGFR2C1450010Plagiocephaly, Nonsynostotic1CTD_human;HPO
HgeneFGFR2C1852406Cutis Gyrata Syndrome of Beare And Stevenson1CTD_human;ORPHANET;UNIPROT
HgeneFGFR2C2350233Antley-Bixler Syndrome Phenotype1CTD_human
HgeneFGFR2C3281247BENT BONE DYSPLASIA SYNDROME1ORPHANET;UNIPROT
HgeneFGFR2C3714756Intellectual Disability1CTD_human;HPO