FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13387

FusionGeneSummary for FGFR1_BCR

check button Fusion gene summary
Fusion gene informationFusion gene name: FGFR1_BCR
Fusion gene ID: 13387
HgeneTgene
Gene symbol

FGFR1

BCR

Gene ID

2260

613

Gene namefibroblast growth factor receptor 1BCR, RhoGEF and GTPase activating protein
SynonymsBFGFR|CD331|CEK|ECCL|FGFBR|FGFR-1|FLG|FLT-2|FLT2|HBGFR|HH2|HRTFDS|KAL2|N-SAM|OGD|bFGF-R-1ALL|BCR1|CML|D22S11|D22S662|PHL
Cytomap

8p11.23

22q11.23

Type of geneprotein-codingprotein-coding
Descriptionfibroblast growth factor receptor 1FGFR1/PLAG1 fusionFMS-like tyrosine kinase 2basic fibroblast growth factor receptor 1fms-related tyrosine kinase 2heparin-binding growth factor receptorhydroxyaryl-protein kinaseproto-oncogene c-Fgrbreakpoint cluster region proteinBCR/FGFR1 chimera proteinFGFR1/BCR chimera proteinbreakpoint cluster regionrenal carcinoma antigen NY-REN-26
Modification date2018052720180527
UniProtAcc

P11362

P11274

Ensembl transtripts involved in fusion geneENST00000425967, ENST00000397091, 
ENST00000447712, ENST00000341462, 
ENST00000532791, ENST00000397113, 
ENST00000356207, ENST00000335922, 
ENST00000326324, ENST00000397103, 
ENST00000397108, ENST00000496629, 
ENST00000305877, ENST00000359540, 
ENST00000398512, ENST00000436990, 
Fusion gene scores* DoF score11 X 9 X 5=4956 X 12 X 4=288
# samples 1215
** MAII scorelog2(12/495*10)=-2.04439411935845
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/288*10)=-0.941106310946431
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FGFR1 [Title/Abstract] AND BCR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFGFR1

GO:0008284

positive regulation of cell proliferation

8663044

HgeneFGFR1

GO:0008543

fibroblast growth factor receptor signaling pathway

8663044

HgeneFGFR1

GO:0010863

positive regulation of phospholipase C activity

18480409

HgeneFGFR1

GO:0018108

peptidyl-tyrosine phosphorylation

8622701|18480409

HgeneFGFR1

GO:0043406

positive regulation of MAP kinase activity

8622701|18480409

HgeneFGFR1

GO:0046777

protein autophosphorylation

8622701

HgeneFGFR1

GO:2000546

positive regulation of endothelial cell chemotaxis to fibroblast growth factor

21885851


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1AJ298917FGFR1chr8

38277056

-BCRchr22

23610592

+
ChiTaRS3.1AB742171FGFR1chr8

38277056

-BCRchr22

23610592

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000425967ENST00000305877FGFR1chr8

38277056

-BCRchr22

23610592

+
Frame-shitENST00000425967ENST00000359540FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000425967ENST00000398512FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000425967ENST00000436990FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000397091ENST00000305877FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000397091ENST00000359540FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000397091ENST00000398512FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000397091ENST00000436990FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000447712ENST00000305877FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000447712ENST00000359540FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000447712ENST00000398512FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000447712ENST00000436990FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000341462ENST00000305877FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000341462ENST00000359540FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000341462ENST00000398512FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000341462ENST00000436990FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000532791ENST00000305877FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000532791ENST00000359540FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000532791ENST00000398512FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000532791ENST00000436990FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000397113ENST00000305877FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000397113ENST00000359540FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000397113ENST00000398512FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000397113ENST00000436990FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000356207ENST00000305877FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000356207ENST00000359540FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000356207ENST00000398512FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000356207ENST00000436990FGFR1chr8

38277056

-BCRchr22

23610592

+
Frame-shitENST00000335922ENST00000305877FGFR1chr8

38277056

-BCRchr22

23610592

+
Frame-shitENST00000335922ENST00000359540FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000335922ENST00000398512FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000335922ENST00000436990FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000326324ENST00000305877FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000326324ENST00000359540FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000326324ENST00000398512FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000326324ENST00000436990FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000397103ENST00000305877FGFR1chr8

38277056

-BCRchr22

23610592

+
In-frameENST00000397103ENST00000359540FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000397103ENST00000398512FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000397103ENST00000436990FGFR1chr8

38277056

-BCRchr22

23610592

+
Frame-shitENST00000397108ENST00000305877FGFR1chr8

38277056

-BCRchr22

23610592

+
Frame-shitENST00000397108ENST00000359540FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000397108ENST00000398512FGFR1chr8

38277056

-BCRchr22

23610592

+
5CDS-intronENST00000397108ENST00000436990FGFR1chr8

38277056

-BCRchr22

23610592

+
intron-3CDSENST00000496629ENST00000305877FGFR1chr8

38277056

-BCRchr22

23610592

+
intron-3CDSENST00000496629ENST00000359540FGFR1chr8

38277056

-BCRchr22

23610592

+
intron-intronENST00000496629ENST00000398512FGFR1chr8

38277056

-BCRchr22

23610592

+
intron-intronENST00000496629ENST00000436990FGFR1chr8

38277056

-BCRchr22

23610592

+

Top

FusionProtFeatures for FGFR1_BCR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FGFR1

P11362

BCR

P11274

GTPase-activating protein for RAC1 and CDC42. Promotesthe exchange of RAC or CDC42-bound GDP by GTP, thereby activatingthem. Displays serine/threonine kinase activity.{ECO:0000269|PubMed:1657398, ECO:0000269|PubMed:1903516}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for FGFR1_BCR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FGFR1_ENST00000397091_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000397091_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000447712_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000447712_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000341462_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000341462_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000532791_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000532791_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000397113_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000397113_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000356207_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000356207_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000326324_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000326324_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000397103_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000397103_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000397091_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000397091_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000447712_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000447712_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000341462_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000341462_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000532791_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000532791_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000397113_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000397113_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000356207_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000356207_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000326324_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000326324_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP

>In-frame_FGFR1_ENST00000397103_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_688aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNEEFEIELEGSQTLRILCTEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFN
SREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI
AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRP

>In-frame_FGFR1_ENST00000397103_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_644aa
ASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLL
QDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQTDCKWYIPLTDLSF
QMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDTER
AEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLTGFLNVIVHSATGFKQSSNLYCTLEVDSFGTFVNK
AKTRVYRDTAEPNWNELDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEI
ERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLL
LSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FGFR1_ENST00000397091_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000397091_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000447712_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000447712_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000341462_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000341462_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000532791_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000532791_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000397113_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000397113_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000356207_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000356207_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000326324_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000326324_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000397103_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000397103_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000397091_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000397091_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000447712_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000447712_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000341462_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000341462_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000532791_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000532791_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000397113_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000397113_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000356207_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000356207_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000326324_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000326324_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG

>In-frame_FGFR1_ENST00000397103_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_2064nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATA
CTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAG
CTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAAC
AGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGG
TCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTG
GCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATC
GCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTT
TCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGAC
CACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCC
TCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAG

>In-frame_FGFR1_ENST00000397103_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_1932nt
GCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAG
TTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTAC
AAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTG
CAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGA
GAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTG
CTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTC
CAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATC
AAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTG
CTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGT
GCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAAC
TCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAAT
GTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAA
GCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACC
GTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAG
ACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATC
GAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAAT
AACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCC
CTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTG
CTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATG
TCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCT
ATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCG


* Fusion transcript sequences (Full-length transcript).
>In-frame_FGFR1_ENST00000397091_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6606nt
GCCGGCGCATAGCGCTCGGAGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTG
CAGCCGCAGCGCGCGGAGGAACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCG
ACCTCGCCTTCCCCGGCCGCGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGC
AGGGCGCACGGTACCCGTGCTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGG
CGCCGCCGCTGCGTTCTGGAGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGC
ACCAGCTCCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGC
GACCCCGCCAGGACCCGAACAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACT
CTCCCGAGGCGGAACCTCCACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCT
TGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCG
CTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCACCCCGGTGACCTGC
TGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGCAACCGCACCCGCA
TCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCCTCGGGCAGTGACA
CCACCTACTTCTCCGTCAATGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAA
CAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGA
CAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAA
TTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGG
AGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCG
CCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACA
TCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGA
TGGAGGTGCTTCACTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACT
CTGCATGGTTGACCGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAG
GGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGG
CTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACG
GAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAG
ATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATG
ACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCA
ATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGG
TGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGC
AGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGG
TGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCA
AGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCC
GCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTT
TCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCA
TCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATC
TGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGA
ACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGG
AGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCG
TCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGA
CAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCG
AGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATA
ACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCC
TCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGC
TGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGT
CCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTA
TCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGG
ACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTG
GCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACC
CAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACC
TGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGA
GTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATTCCCTCACTGTTGTATCTTG
AATAAACGCTGCTGCTTCATCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTCCCTGACTTAGAAACCACAC
TCCACTTCTAACAGGGTTTGAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTTTTTCTTTCCAGAAGGATTT
TTGTGCAGAAATGGGTCTTTTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATGTCAGGGGACAGGACCCCCA
GGGAGGGAACCCCAGGCTACGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGACCGCCCTTCCGGCCCACGC
TCTCCTGTTTGGCTTCCACAGGCCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTCCCTGCCCCTGCCCCAGCAC
AGGTGACTTCATTTCTGTCCTCTCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGCAGCAGCTTGCTGATGACTT
GTTTTAAAACTTTCATCCTAAATAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAATTTTTTTCCGAACAGATCCA
GATACCTAATAAGATGCTGGAATGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAAGCGCCTGGCTCCGCTGTTC
TCAGGAGTGGGTTCTGAAGTCTCTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGACGGGAGACTCCCTCCCGGAG
CAGGTGGAGGCACAGGACCATTCGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTAAACCCTCCTGACCACCTGG
CTCAAAGAAAACAGAAGCATGGAGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTTTTTTAGAAAGAGGGGCTTG
GGGCAGGCAGAGGAGAGAAGGGAGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGATGCAGCTGCCCAGAGGGAA
GCAGGATCACATTTAAGGAAGTGTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCACCCGCTCCCAAGGTGGGAG
GAGTGGGTGTCCCCTGTGTGTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTGGGGCCATGCGCCTGACACT
CCTCTCTGCTTGTGGACCTGGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTGTGTGCAGTGTGGATTTAGT
TGTGCTTTTTTCTTGCTGGGAGAGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGACAGAACAGGAGCCTCTGCTC
TCTGTACCTATCTGGGCCCGGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCCTGCGCAGGAACACGTGTTG
CTTAGAAAAGCCAAATCCAGCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAACTGGAAACCAGTCTATCAAT
GTCTGTGCCAATTTTTTATTCCCTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTGCTGTCTAATGATGGGATGA
CCACACTTTTCCATGTTCTAAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTACAGCTACGTCTTACCCACC
TCCTGCCTCAACAGCCTGTGTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGGGACCTGGCTCTCCTTCTGC
AATGCAGGCGAAGGCCTAGATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAGTGATGCTTTTTTGCCTTGG
GCCCTGGGTTTGAAGCAGCCTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTCAGCCACCTACACACCACCG

>In-frame_FGFR1_ENST00000397091_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_4387nt
GCCGGCGCATAGCGCTCGGAGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTG
CAGCCGCAGCGCGCGGAGGAACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCG
ACCTCGCCTTCCCCGGCCGCGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGC
AGGGCGCACGGTACCCGTGCTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGG
CGCCGCCGCTGCGTTCTGGAGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGC
ACCAGCTCCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGC
GACCCCGCCAGGACCCGAACAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACT
CTCCCGAGGCGGAACCTCCACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCT
TGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCG
CTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCACCCCGGTGACCTGC
TGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGCAACCGCACCCGCA
TCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCCTCGGGCAGTGACA
CCACCTACTTCTCCGTCAATGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAA
CAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGA
CAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAA
TTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGG
AGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCG
CCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACA
TCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGA
TGGAGGTGCTTCACTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACT
CTGCATGGTTGACCGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAG
GGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGG
CTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACG
GAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAG
ATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATG
ACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCA
ATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGG
TGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGC
AGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGG
TGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCA
AGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCC
GCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTT
TCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCA
TCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATC
TGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGA
ACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGT
TCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAG
AGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCG
GTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACG
CCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCG
CTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTC
TGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCC
GGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGG
TCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAA
GGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGT
CCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGT
CTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGG
CCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCT

>In-frame_FGFR1_ENST00000447712_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6805nt
AGATGCAGGGGCGCAAACGCCAAAGGAGACCAGGCTGTAGGAAGAGAAGGGCAGAGCGCCGGACAGCTCGGCCCGCTCCCCGTCCTTTGG
GGCCGCGGCTGGGGAACTACAAGGCCCAGCAGGCAGCTGCAGGGGGCGGAGGCGGAGGAGGGACCAGCGCGGGTGGGAGTGAGAGAGCGA
GCCCTCGCGCCCCGCCGGCGCATAGCGCTCGGAGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGC
CGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTA
GCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCT
CGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGC
AAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCC
CCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCC
GCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAA
GCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGG
AGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCC
ACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCAC
CCCGGTGACCTGCTGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGC
AACCGCACCCGCATCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCC
TCGGGCAGTGACACCACCTACTTCTCCGTCAATGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCA
GAGGAGAAAGAAACAGATAACACCAAACCAAACCGTATGCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCAT
GCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAA
TTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGC
AACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATC
CTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCAC
ATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTT
AATACCACCGACAAAGAGATGGAGGTGCTTCACTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCT
ATCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAG
ATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGT
GACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGG
GCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTG
AGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGG
AGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAG
AACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGAC
AGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAG
CAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCA
GTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAG
AGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATG
GCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGG
GAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTC
CACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGA
TTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGAC
ACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAAC
AAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGAC
AGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGG
ATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGC
CAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAG
GCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTC
CGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGC
TGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAG
GAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCT
GCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTG
GAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACA
GATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCAT
CTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGT
GGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTT
TTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATT
CCCTCACTGTTGTATCTTGAATAAACGCTGCTGCTTCATCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTC
CCTGACTTAGAAACCACACTCCACTTCTAACAGGGTTTGAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTT
TTTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGTCTTTTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATG
TCAGGGGACAGGACCCCCAGGGAGGGAACCCCAGGCTACGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGA
CCGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTCCACAGGCCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTC
CCTGCCCCTGCCCCAGCACAGGTGACTTCATTTCTGTCCTCTCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGC
AGCAGCTTGCTGATGACTTGTTTTAAAACTTTCATCCTAAATAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAAT
TTTTTTCCGAACAGATCCAGATACCTAATAAGATGCTGGAATGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAA
GCGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTGAAGTCTCTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGAC
GGGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGGACCATTCGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTA
AACCCTCCTGACCACCTGGCTCAAAGAAAACAGAAGCATGGAGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTT
TTTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGAGAAGGGAGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGA
TGCAGCTGCCCAGAGGGAAGCAGGATCACATTTAAGGAAGTGTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCA
CCCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTGTGTGTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTG
GGGCCATGCGCCTGACACTCCTCTCTGCTTGTGGACCTGGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTG
TGTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGCTGGGAGAGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGAC
AGAACAGGAGCCTCTGCTCTCTGTACCTATCTGGGCCCGGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCC
TGCGCAGGAACACGTGTTGCTTAGAAAAGCCAAATCCAGCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAAC
TGGAAACCAGTCTATCAATGTCTGTGCCAATTTTTTATTCCCTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTG
CTGTCTAATGATGGGATGACCACACTTTTCCATGTTCTAAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTA
CAGCTACGTCTTACCCACCTCCTGCCTCAACAGCCTGTGTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGG
GACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCCTAGATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAG
TGATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGCAGCCTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTC

>In-frame_FGFR1_ENST00000447712_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_4586nt
AGATGCAGGGGCGCAAACGCCAAAGGAGACCAGGCTGTAGGAAGAGAAGGGCAGAGCGCCGGACAGCTCGGCCCGCTCCCCGTCCTTTGG
GGCCGCGGCTGGGGAACTACAAGGCCCAGCAGGCAGCTGCAGGGGGCGGAGGCGGAGGAGGGACCAGCGCGGGTGGGAGTGAGAGAGCGA
GCCCTCGCGCCCCGCCGGCGCATAGCGCTCGGAGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGC
CGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTA
GCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCT
CGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGC
AAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCC
CCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCC
GCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAA
GCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGG
AGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCC
ACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCAC
CCCGGTGACCTGCTGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGC
AACCGCACCCGCATCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCC
TCGGGCAGTGACACCACCTACTTCTCCGTCAATGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCA
GAGGAGAAAGAAACAGATAACACCAAACCAAACCGTATGCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCAT
GCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAA
TTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGC
AACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATC
CTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCAC
ATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTT
AATACCACCGACAAAGAGATGGAGGTGCTTCACTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCT
ATCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAG
ATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGT
GACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGG
GCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTG
AGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGG
AGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAG
AACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGAC
AGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAG
CAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCA
GTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAG
AGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATG
GCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGG
GAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTC
CACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGA
TTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGAC
ACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAA
GTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATT
GCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTG
GGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATG
AGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCC
AACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTG
CTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTC
TTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCC
TTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTG
TTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGC
GGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCT
GGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCA
TCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATC

>In-frame_FGFR1_ENST00000341462_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6805nt
AGATGCAGGGGCGCAAACGCCAAAGGAGACCAGGCTGTAGGAAGAGAAGGGCAGAGCGCCGGACAGCTCGGCCCGCTCCCCGTCCTTTGG
GGCCGCGGCTGGGGAACTACAAGGCCCAGCAGGCAGCTGCAGGGGGCGGAGGCGGAGGAGGGACCAGCGCGGGTGGGAGTGAGAGAGCGA
GCCCTCGCGCCCCGCCGGCGCATAGCGCTCGGAGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGC
CGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTA
GCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCT
CGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGC
AAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCC
CCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCC
GCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAA
GCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGG
AGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCC
ACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCAC
CCCGGTGACCTGCTGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGC
AACCGCACCCGCATCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCC
TCGGGCAGTGACACCACCTACTTCTCCGTCAATGTTTCAGTTCCCATAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGAC
TCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTG
CATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAA
GAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAG
GGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCC
ATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCG
CACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGCATTCGGGG
ATTAATAGCTCGGATGCGGAGGTGCTGACCCTGTTCAATGTGACAGAGGCCCAGAGCGGGGAGTATGTGTGTAAGGTTTCCAATTATATT
GGTGAAGCTAACCAGTCTGCGTGGCTCACTGTCACCAGACCTGTGCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAG
ATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGT
GACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGG
GCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTG
AGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGG
AGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAG
AACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGAC
AGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAG
CAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCA
GTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAG
AGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATG
GCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGG
GAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTC
CACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGA
TTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGAC
ACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAAC
AAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGAC
AGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGG
ATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGC
CAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAG
GCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTC
CGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGC
TGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAG
GAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCT
GCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTG
GAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACA
GATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCAT
CTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGT
GGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTT
TTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATT
CCCTCACTGTTGTATCTTGAATAAACGCTGCTGCTTCATCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTC
CCTGACTTAGAAACCACACTCCACTTCTAACAGGGTTTGAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTT
TTTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGTCTTTTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATG
TCAGGGGACAGGACCCCCAGGGAGGGAACCCCAGGCTACGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGA
CCGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTCCACAGGCCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTC
CCTGCCCCTGCCCCAGCACAGGTGACTTCATTTCTGTCCTCTCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGC
AGCAGCTTGCTGATGACTTGTTTTAAAACTTTCATCCTAAATAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAAT
TTTTTTCCGAACAGATCCAGATACCTAATAAGATGCTGGAATGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAA
GCGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTGAAGTCTCTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGAC
GGGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGGACCATTCGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTA
AACCCTCCTGACCACCTGGCTCAAAGAAAACAGAAGCATGGAGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTT
TTTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGAGAAGGGAGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGA
TGCAGCTGCCCAGAGGGAAGCAGGATCACATTTAAGGAAGTGTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCA
CCCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTGTGTGTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTG
GGGCCATGCGCCTGACACTCCTCTCTGCTTGTGGACCTGGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTG
TGTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGCTGGGAGAGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGAC
AGAACAGGAGCCTCTGCTCTCTGTACCTATCTGGGCCCGGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCC
TGCGCAGGAACACGTGTTGCTTAGAAAAGCCAAATCCAGCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAAC
TGGAAACCAGTCTATCAATGTCTGTGCCAATTTTTTATTCCCTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTG
CTGTCTAATGATGGGATGACCACACTTTTCCATGTTCTAAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTA
CAGCTACGTCTTACCCACCTCCTGCCTCAACAGCCTGTGTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGG
GACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCCTAGATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAG
TGATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGCAGCCTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTC

>In-frame_FGFR1_ENST00000341462_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_4586nt
AGATGCAGGGGCGCAAACGCCAAAGGAGACCAGGCTGTAGGAAGAGAAGGGCAGAGCGCCGGACAGCTCGGCCCGCTCCCCGTCCTTTGG
GGCCGCGGCTGGGGAACTACAAGGCCCAGCAGGCAGCTGCAGGGGGCGGAGGCGGAGGAGGGACCAGCGCGGGTGGGAGTGAGAGAGCGA
GCCCTCGCGCCCCGCCGGCGCATAGCGCTCGGAGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGC
CGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTA
GCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCT
CGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGC
AAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCC
CCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCC
GCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAA
GCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGG
AGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCC
ACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCAC
CCCGGTGACCTGCTGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGC
AACCGCACCCGCATCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCC
TCGGGCAGTGACACCACCTACTTCTCCGTCAATGTTTCAGTTCCCATAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGAC
TCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTG
CATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAA
GAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAG
GGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCC
ATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCG
CACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGCATTCGGGG
ATTAATAGCTCGGATGCGGAGGTGCTGACCCTGTTCAATGTGACAGAGGCCCAGAGCGGGGAGTATGTGTGTAAGGTTTCCAATTATATT
GGTGAAGCTAACCAGTCTGCGTGGCTCACTGTCACCAGACCTGTGCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAG
ATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGT
GACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGG
GCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTG
AGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGG
AGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAG
AACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGAC
AGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAG
CAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCA
GTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAG
AGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATG
GCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGG
GAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTC
CACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGA
TTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGAC
ACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAA
GTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATT
GCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTG
GGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATG
AGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCC
AACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTG
CTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTC
TTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCC
TTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTG
TTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGC
GGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCT
GGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCA
TCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATC

>In-frame_FGFR1_ENST00000532791_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6587nt
AGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTGCAGCCGCAGCGCGCGGAGG
AACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCGACCTCGCCTTCCCCGGCCG
CGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGCAGGGCGCACGGTACCCGTG
CTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGG
AGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGCACCAGCTCCGGCTCCATTG
TTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGCGACCCCGCCAGGACCCGAA
CAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACTCTCCCGAGGCGGAACCTCC
ACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTG
CAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTT
GCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCACCCCGGTGACCTGCTGCAGCTTCGCTGTCGGCT
GCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGCAACCGCACCCGCATCACAGGGGAGGAGGTGGA
GGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCCTCGGGCAGTGACACCACCTACTTCTCCGTCAA
TGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAA
CCGTATGCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAA
ATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAA
GGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGG
CAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGT
GGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGG
GAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGATGGAGGTGCTTCA
CTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGAC
CGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCAT
CTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCT
GGCCAAGAGCATCCCTCTGCGCAGACAGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGC
TGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGAC
CAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCC
TGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCG
ACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCT
GCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATG
GTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGA
CGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAA
GAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACAC
GTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGAC
ATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGA
GTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGT
GGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGA
GCTGGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGA
CAGACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGAT
CGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAA
GATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGA
GGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGAT
GATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTA
CCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAA
CCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCAC
GGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTG
GTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCAT
CCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTA
GAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTG
GCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAG
TTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTG
GATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATTCCCTCACTGTTGTATCTTGAATAAACGCTGCTGCTTCA
TCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTCCCTGACTTAGAAACCACACTCCACTTCTAACAGGGTTT
GAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTTTTTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGTCTT
TTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATGTCAGGGGACAGGACCCCCAGGGAGGGAACCCCAGGCTA
CGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGACCGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTCCAC
AGGCCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTCCCTGCCCCTGCCCCAGCACAGGTGACTTCATTTCTGTC
CTCTCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGCAGCAGCTTGCTGATGACTTGTTTTAAAACTTTCATCCT
AAATAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAATTTTTTTCCGAACAGATCCAGATACCTAATAAGATGCTG
GAATGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAAGCGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTGAAG
TCTCTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGACGGGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGGACC
ATTCGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTAAACCCTCCTGACCACCTGGCTCAAAGAAAACAGAAGCA
TGGAGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTTTTTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGAGAA
GGGAGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGATGCAGCTGCCCAGAGGGAAGCAGGATCACATTTAAGGA
AGTGTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCACCCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTGTGT
GTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTGGGGCCATGCGCCTGACACTCCTCTCTGCTTGTGGACCT
GGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTGTGTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGCTGG
GAGAGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGACAGAACAGGAGCCTCTGCTCTCTGTACCTATCTGGGCCC
GGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCCTGCGCAGGAACACGTGTTGCTTAGAAAAGCCAAATCCA
GCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAACTGGAAACCAGTCTATCAATGTCTGTGCCAATTTTTTAT
TCCCTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTGCTGTCTAATGATGGGATGACCACACTTTTCCATGTTCT
AAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTACAGCTACGTCTTACCCACCTCCTGCCTCAACAGCCTGT
GTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGGGACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCCTAG
ATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAGTGATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGCAGC
CTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTCAGCCACCTACACACCACCGTGGCCGACACTTTCATTAA

>In-frame_FGFR1_ENST00000532791_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_4368nt
AGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTGCAGCCGCAGCGCGCGGAGG
AACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCGACCTCGCCTTCCCCGGCCG
CGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGCAGGGCGCACGGTACCCGTG
CTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGG
AGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGCACCAGCTCCGGCTCCATTG
TTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGCGACCCCGCCAGGACCCGAA
CAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACTCTCCCGAGGCGGAACCTCC
ACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTG
CAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTT
GCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCACCCCGGTGACCTGCTGCAGCTTCGCTGTCGGCT
GCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGCAACCGCACCCGCATCACAGGGGAGGAGGTGGA
GGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCCTCGGGCAGTGACACCACCTACTTCTCCGTCAA
TGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAA
CCGTATGCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAA
ATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAA
GGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGG
CAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGT
GGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGG
GAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGATGGAGGTGCTTCA
CTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGAC
CGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCAT
CTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCT
GGCCAAGAGCATCCCTCTGCGCAGACAGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGC
TGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGAC
CAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCC
TGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCG
ACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCT
GCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATG
GTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGA
CGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAA
GAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACAC
GTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGAC
ATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGA
GTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGT
GGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGC
CCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAG
CTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTA
CATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCA
GGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAA
GCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGC
AAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGT
GGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAG
CAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTT
CCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTG
GAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGT
GTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGC
CTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAA
GGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACG

>In-frame_FGFR1_ENST00000397113_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6174nt
GCTTTGCCCGCCGCAGCCCAGCCGGGGCCGGCGCCTCCCTCCGCTCGCCGCCCGCCCCTTTCACCTCCTGGCTCCCTCCCGGGCGATCCG
CGCCCCTTGGGTCTCCCCTCCCTTCCCTCCGTCCGCGTCTCCTGCGCCCCCTCCCTGCGCTCGTCCCGCCGCTCTTCCCGCCGCCCAACT
TTTCCTCCAACTCGCGCTCGGGAGCTGGCGAGGCGGCGGCGGCTCCTCAGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATC
CATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCA
CAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGG
TCCACCCCGGTGACCTGCTGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGG
AAAGCAACCGCACCCGCATCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCA
GCCCCTCGGGCAGTGACACCACCTACTTCTCCGTCAATGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCT
CTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATG
CAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAAT
TCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCA
ACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCC
TGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACA
TCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTA
ATACCACCGACAAAGAGATGGAGGTGCTTCACTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTA
TCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGA
TCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTG
ACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGG
CCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGA
GAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGA
GCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGA
ACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACA
GCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGC
AGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAG
TGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGA
GGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGG
CCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGG
AGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCC
ACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGAT
TTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACA
CAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAACA
AGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGACA
GAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGA
TGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCC
AGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGG
CAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCC
GTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCT
GCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGG
AGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTG
CCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGG
AGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAG
ATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATC
TGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTG
GTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTT
TTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATTC
CCTCACTGTTGTATCTTGAATAAACGCTGCTGCTTCATCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTCC
CTGACTTAGAAACCACACTCCACTTCTAACAGGGTTTGAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTTT
TTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGTCTTTTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATGT
CAGGGGACAGGACCCCCAGGGAGGGAACCCCAGGCTACGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGAC
CGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTCCACAGGCCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTCC
CTGCCCCTGCCCCAGCACAGGTGACTTCATTTCTGTCCTCTCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGCA
GCAGCTTGCTGATGACTTGTTTTAAAACTTTCATCCTAAATAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAATT
TTTTTCCGAACAGATCCAGATACCTAATAAGATGCTGGAATGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAAG
CGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTGAAGTCTCTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGACG
GGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGGACCATTCGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTAA
ACCCTCCTGACCACCTGGCTCAAAGAAAACAGAAGCATGGAGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTTT
TTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGAGAAGGGAGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGAT
GCAGCTGCCCAGAGGGAAGCAGGATCACATTTAAGGAAGTGTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCAC
CCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTGTGTGTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTGG
GGCCATGCGCCTGACACTCCTCTCTGCTTGTGGACCTGGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTGT
GTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGCTGGGAGAGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGACA
GAACAGGAGCCTCTGCTCTCTGTACCTATCTGGGCCCGGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCCT
GCGCAGGAACACGTGTTGCTTAGAAAAGCCAAATCCAGCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAACT
GGAAACCAGTCTATCAATGTCTGTGCCAATTTTTTATTCCCTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTGC
TGTCTAATGATGGGATGACCACACTTTTCCATGTTCTAAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTAC
AGCTACGTCTTACCCACCTCCTGCCTCAACAGCCTGTGTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGGG
ACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCCTAGATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAGT
GATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGCAGCCTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTCA

>In-frame_FGFR1_ENST00000397113_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_3955nt
GCTTTGCCCGCCGCAGCCCAGCCGGGGCCGGCGCCTCCCTCCGCTCGCCGCCCGCCCCTTTCACCTCCTGGCTCCCTCCCGGGCGATCCG
CGCCCCTTGGGTCTCCCCTCCCTTCCCTCCGTCCGCGTCTCCTGCGCCCCCTCCCTGCGCTCGTCCCGCCGCTCTTCCCGCCGCCCAACT
TTTCCTCCAACTCGCGCTCGGGAGCTGGCGAGGCGGCGGCGGCTCCTCAGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATC
CATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCA
CAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGG
TCCACCCCGGTGACCTGCTGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGG
AAAGCAACCGCACCCGCATCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCA
GCCCCTCGGGCAGTGACACCACCTACTTCTCCGTCAATGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCT
CTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATG
CAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAAT
TCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCA
ACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCC
TGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACA
TCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTA
ATACCACCGACAAAGAGATGGAGGTGCTTCACTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTA
TCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGA
TCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTG
ACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGG
CCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGA
GAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGA
GCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGA
ACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACA
GCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGC
AGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAG
TGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGA
GGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGG
CCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGG
AGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCC
ACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGAT
TTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACA
CAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAG
TAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTG
CTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGG
GCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGA
GCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCA
ACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGC
TCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCT
TTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCT
TGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGT
TCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCG
GGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTG
GAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCAT
CTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCA

>In-frame_FGFR1_ENST00000356207_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6320nt
CTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCG
GGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCG
CGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAG
TCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGG
GGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCG
CCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGC
CCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCG
AGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAAC
TGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGA
ACAAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCG
TATGCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATG
CCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGT
CCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAG
CATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGC
CCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAG
CAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGATGGAGGTGCTTCACTT
AAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGACCGT
TCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCATCTC
CTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCTGGC
CAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAAT
GGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAAC
GACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACAC
TCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACC
CCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAA
GCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAA
ATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCT
GGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCT
GAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTA
CACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCT
GACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGA
TGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGA
GGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGAT
AGAGCTGGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCAC
GGACAGACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGG
GATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGT
CAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGA
GGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGT
GATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTT
CTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGC
CAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGC
CACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAG
CTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAG
CATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCC
GTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAG
GTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGC
CAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTA
CTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATTCCCTCACTGTTGTATCTTGAATAAACGCTGCTGCT
TCATCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTCCCTGACTTAGAAACCACACTCCACTTCTAACAGGG
TTTGAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTTTTTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGT
CTTTTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATGTCAGGGGACAGGACCCCCAGGGAGGGAACCCCAGG
CTACGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGACCGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTC
CACAGGCCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTCCCTGCCCCTGCCCCAGCACAGGTGACTTCATTTCT
GTCCTCTCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGCAGCAGCTTGCTGATGACTTGTTTTAAAACTTTCAT
CCTAAATAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAATTTTTTTCCGAACAGATCCAGATACCTAATAAGATG
CTGGAATGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAAGCGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTG
AAGTCTCTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGACGGGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGG
ACCATTCGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTAAACCCTCCTGACCACCTGGCTCAAAGAAAACAGAA
GCATGGAGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTTTTTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGA
GAAGGGAGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGATGCAGCTGCCCAGAGGGAAGCAGGATCACATTTAA
GGAAGTGTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCACCCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTG
TGTGTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTGGGGCCATGCGCCTGACACTCCTCTCTGCTTGTGGA
CCTGGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTGTGTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGC
TGGGAGAGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGACAGAACAGGAGCCTCTGCTCTCTGTACCTATCTGGG
CCCGGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCCTGCGCAGGAACACGTGTTGCTTAGAAAAGCCAAAT
CCAGCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAACTGGAAACCAGTCTATCAATGTCTGTGCCAATTTTT
TATTCCCTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTGCTGTCTAATGATGGGATGACCACACTTTTCCATGT
TCTAAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTACAGCTACGTCTTACCCACCTCCTGCCTCAACAGCC
TGTGTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGGGACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCC
TAGATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAGTGATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGC
AGCCTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTCAGCCACCTACACACCACCGTGGCCGACACTTTCAT

>In-frame_FGFR1_ENST00000356207_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_4101nt
CTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCG
GGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCG
CGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAG
TCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGG
GGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCG
CCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGC
CCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCG
AGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAAC
TGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGA
ACAAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCG
TATGCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATG
CCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGT
CCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAG
CATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGC
CCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAG
CAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGATGGAGGTGCTTCACTT
AAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGACCGT
TCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCATCTC
CTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCTGGC
CAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAAT
GGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAAC
GACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACAC
TCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACC
CCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAA
GCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAA
ATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCT
GGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCT
GAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTA
CACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCT
GACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGA
TGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGA
GGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCA
GGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTT
CAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCC
CTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACAT
CCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCT
GAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGT
TGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAG
GGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGA
GAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTA
CTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTC
CTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCA
AGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCT
GGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGT
GAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGA

>In-frame_FGFR1_ENST00000326324_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6314nt
CTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCG
GGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCG
CGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAG
TCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGG
GGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCG
CCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGC
CCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCG
AGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAAC
TGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGA
ACAAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCC
CGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTC
CAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTA
TGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAA
CCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGG
TAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGAT
TGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGATGGAGGTGCTTCACTTAAGAAA
TGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGA
AGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCAT
GGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAG
CATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGA
GAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAA
GAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGC
CAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACG
GCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCG
CCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTA
CATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGC
TTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAA
GAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTT
CCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATC
CGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTC
TCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGA
TTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCT
GGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAG
ACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGA
AGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGAT
TGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGT
GGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGAT
GAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCC
CAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCT
GCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGT
CTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTC
CTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCT
GTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAG
CGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCC
TGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTC
ATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGAT
CACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATTCCCTCACTGTTGTATCTTGAATAAACGCTGCTGCTTCATCC
TGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTCCCTGACTTAGAAACCACACTCCACTTCTAACAGGGTTTGAG
AGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTTTTTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGTCTTTTG
TTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATGTCAGGGGACAGGACCCCCAGGGAGGGAACCCCAGGCTACGC
ACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGACCGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTCCACAGG
CCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTCCCTGCCCCTGCCCCAGCACAGGTGACTTCATTTCTGTCCTC
TCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGCAGCAGCTTGCTGATGACTTGTTTTAAAACTTTCATCCTAAA
TAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAATTTTTTTCCGAACAGATCCAGATACCTAATAAGATGCTGGAA
TGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAAGCGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTGAAGTCT
CTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGACGGGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGGACCATT
CGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTAAACCCTCCTGACCACCTGGCTCAAAGAAAACAGAAGCATGG
AGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTTTTTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGAGAAGGG
AGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGATGCAGCTGCCCAGAGGGAAGCAGGATCACATTTAAGGAAGT
GTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCACCCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTGTGTGTC
AGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTGGGGCCATGCGCCTGACACTCCTCTCTGCTTGTGGACCTGGC
AAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTGTGTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGCTGGGAG
AGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGACAGAACAGGAGCCTCTGCTCTCTGTACCTATCTGGGCCCGGT
GGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCCTGCGCAGGAACACGTGTTGCTTAGAAAAGCCAAATCCAGCC
TTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAACTGGAAACCAGTCTATCAATGTCTGTGCCAATTTTTTATTCC
CTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTGCTGTCTAATGATGGGATGACCACACTTTTCCATGTTCTAAA
AGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTACAGCTACGTCTTACCCACCTCCTGCCTCAACAGCCTGTGTG
GTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGGGACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCCTAGATG
CCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAGTGATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGCAGCCTG
GCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTCAGCCACCTACACACCACCGTGGCCGACACTTTCATTAAAAA

>In-frame_FGFR1_ENST00000326324_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_4095nt
CTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCG
GGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCG
CGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAG
TCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGG
GGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCG
CCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGC
CCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCG
AGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAAC
TGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGA
ACAAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCC
CGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTC
CAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTA
TGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAA
CCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGG
TAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGAT
TGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGATGGAGGTGCTTCACTTAAGAAA
TGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGA
AGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCAT
GGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAG
CATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGA
GAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAA
GAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGC
CAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACG
GCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCG
CCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTA
CATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGC
TTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAA
GAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTT
CCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATC
CGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTC
TCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGA
TTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCT
GCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTT
GAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACAT
CGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGC
ACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCT
GTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAA
GGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGC
AGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAA
GCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCT
GCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAG
GCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTT
GGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTC
AGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGG
AGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGA

>In-frame_FGFR1_ENST00000397103_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_5653nt
GTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCT
GTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGATGCTCTCCCCTCCTCGGAGGATGATGATGAT
GATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAA
AAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAA
AATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCC
TCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCT
CACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGAC
CCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAG
CATTCGGGGATTAATAGCTCGGATGCGGAGGTGCTGACCCTGTTCAATGTGACAGAGGCCCAGAGCGGGGAGTATGTGTGTAAGGTTTCC
AATTATATTGGTGAAGCTAACCAGTCTGCGTGGCTCACTGTCACCAGACCTGTGGCAAAAGCCCTGGAAGAGAGGCCGGCAGTGATGACC
TCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAG
AGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGC
CAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCA
GAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCT
GTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGAC
GCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCAC
CGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTC
TGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATG
GTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAAT
GACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTG
CTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAG
TGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGT
GTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATC
GTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAG
ACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATACTGTGC
TATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAGCTGGAC
CCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGG
GAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAG
GTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACG
GACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGC
ACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGAC
CCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTG
AAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAG
AAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTG
CTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCC
ATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCAC
CCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCC
AGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGAC
AGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGA
AGGGAACGTGACTGGATTCCCTCACTGTTGTATCTTGAATAAACGCTGCTGCTTCATCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGG
TGGGGCCTCTTCCATTTCCCTGACTTAGAAACCACACTCCACTTCTAACAGGGTTTGAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGAC
TCCATTCTTGGCTTTCTTTTTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGTCTTTTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCT
CAGAAGGCCTGTGAAATGTCAGGGGACAGGACCCCCAGGGAGGGAACCCCAGGCTACGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGAC
CTCGTCCCCCGATCCTGACCGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTCCACAGGCCTGGACTTCTCTGGCTTCTCTGCCCACACA
CTCCCTGCCCCCAGTGTCCCTGCCCCTGCCCCAGCACAGGTGACTTCATTTCTGTCCTCTCAGCTCAGTGGACTCGCTCAACTTTTGTAT
AAGTCTCCACTTGGTGGCAGCAGCTTGCTGATGACTTGTTTTAAAACTTTCATCCTAAATAACCTTTTGATACTTGAATATTTGTAAGTT
TTATACATAGTTTCTAATTTTTTTCCGAACAGATCCAGATACCTAATAAGATGCTGGAATGTAATCCCTGGACAATCCGTGTCCTGGCAG
CATTTGGTCTTCCTCTAAGCGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTGAAGTCTCTGGAGAACAGGATACGTGGAGGGTTAGGAA
GGGGCCAGGCCTAGAGACGGGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGGACCATTCGCTACCCCATCTGCCGACACCTGCGGGGGA
GCCCAGGCATTCTTTGTAAACCCTCCTGACCACCTGGCTCAAAGAAAACAGAAGCATGGAGACCGCCAAGTATTTTCAAGAAATAACCCC
ATGAATATTCCATCACTTTTTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGAGAAGGGAGAGCAAACTGAGAGCCAAGTTTCCACACGG
TCCTGCAGGAGGAGAGGATGCAGCTGCCCAGAGGGAAGCAGGATCACATTTAAGGAAGTGTGTGGGGTCCCTGGATGACACCAGCACCCA
GTGCGGCTCTGTCTGGCACCCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTGTGTGTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCA
CTAGGGAGCCTGACAGTGGGGCCATGCGCCTGACACTCCTCTCTGCTTGTGGACCTGGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAG
GCTTTCTGTCTGCGTCTGTGTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGCTGGGAGAGCACAGCCACCATTTACAAGCAGTGTCACC
GTCGTGGGTGGCGAGGACAGAACAGGAGCCTCTGCTCTCTGTACCTATCTGGGCCCGGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTC
TCAGCGACCATTCAGCCCTGCGCAGGAACACGTGTTGCTTAGAAAAGCCAAATCCAGCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTG
CATCTGTTACCTTGAAACTGGAAACCAGTCTATCAATGTCTGTGCCAATTTTTTATTCCCTCCCCAACCTCCTTCCCCATACGACTTTTT
ATTTATGTAGGATGTGTGCTGTCTAATGATGGGATGACCACACTTTTCCATGTTCTAAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTG
GTGGTTGCTTTGGGTCTACAGCTACGTCTTACCCACCTCCTGCCTCAACAGCCTGTGTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGC
AGCGTTCTCCAGGAGGGGGACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCCTAGATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCC
AGACTCCCCGGCCGGAAGTGATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGCAGCCTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAG

>In-frame_FGFR1_ENST00000397103_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_3434nt
GTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCT
GTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGATGCTCTCCCCTCCTCGGAGGATGATGATGAT
GATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAA
AAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAA
AATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCC
TCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCT
CACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGAC
CCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAG
CATTCGGGGATTAATAGCTCGGATGCGGAGGTGCTGACCCTGTTCAATGTGACAGAGGCCCAGAGCGGGGAGTATGTGTGTAAGGTTTCC
AATTATATTGGTGAAGCTAACCAGTCTGCGTGGCTCACTGTCACCAGACCTGTGGCAAAAGCCCTGGAAGAGAGGCCGGCAGTGATGACC
TCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAG
AGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGC
CAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCA
GAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCT
GTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGAC
GCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCAC
CGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTC
TGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATG
GTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAAT
GACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTG
CTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAG
TGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGT
GTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATC
GTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAG
ACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATC
GCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGG
GTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGC
CGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAG
GACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTC
ACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCC
CTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTG
CACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACC
ATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGC
AAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAA
TCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAG
CCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGG
GCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTA
AAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATTCCCTCACTGTTGTATCTTGAATAA

>In-frame_FGFR1_ENST00000397091_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6606nt
GCCGGCGCATAGCGCTCGGAGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTG
CAGCCGCAGCGCGCGGAGGAACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCG
ACCTCGCCTTCCCCGGCCGCGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGC
AGGGCGCACGGTACCCGTGCTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGG
CGCCGCCGCTGCGTTCTGGAGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGC
ACCAGCTCCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGC
GACCCCGCCAGGACCCGAACAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACT
CTCCCGAGGCGGAACCTCCACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCT
TGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCG
CTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCACCCCGGTGACCTGC
TGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGCAACCGCACCCGCA
TCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCCTCGGGCAGTGACA
CCACCTACTTCTCCGTCAATGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAA
CAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGA
CAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAA
TTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGG
AGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCG
CCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACA
TCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGA
TGGAGGTGCTTCACTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACT
CTGCATGGTTGACCGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAG
GGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGG
CTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACG
GAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAG
ATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATG
ACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCA
ATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGG
TGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGC
AGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGG
TGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCA
AGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCC
GCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTT
TCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCA
TCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATC
TGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGA
ACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGG
AGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCG
TCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGA
CAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCG
AGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATA
ACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCC
TCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGC
TGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGT
CCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTA
TCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGG
ACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTG
GCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACC
CAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACC
TGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGA
GTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATTCCCTCACTGTTGTATCTTG
AATAAACGCTGCTGCTTCATCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTCCCTGACTTAGAAACCACAC
TCCACTTCTAACAGGGTTTGAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTTTTTCTTTCCAGAAGGATTT
TTGTGCAGAAATGGGTCTTTTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATGTCAGGGGACAGGACCCCCA
GGGAGGGAACCCCAGGCTACGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGACCGCCCTTCCGGCCCACGC
TCTCCTGTTTGGCTTCCACAGGCCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTCCCTGCCCCTGCCCCAGCAC
AGGTGACTTCATTTCTGTCCTCTCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGCAGCAGCTTGCTGATGACTT
GTTTTAAAACTTTCATCCTAAATAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAATTTTTTTCCGAACAGATCCA
GATACCTAATAAGATGCTGGAATGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAAGCGCCTGGCTCCGCTGTTC
TCAGGAGTGGGTTCTGAAGTCTCTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGACGGGAGACTCCCTCCCGGAG
CAGGTGGAGGCACAGGACCATTCGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTAAACCCTCCTGACCACCTGG
CTCAAAGAAAACAGAAGCATGGAGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTTTTTTAGAAAGAGGGGCTTG
GGGCAGGCAGAGGAGAGAAGGGAGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGATGCAGCTGCCCAGAGGGAA
GCAGGATCACATTTAAGGAAGTGTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCACCCGCTCCCAAGGTGGGAG
GAGTGGGTGTCCCCTGTGTGTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTGGGGCCATGCGCCTGACACT
CCTCTCTGCTTGTGGACCTGGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTGTGTGCAGTGTGGATTTAGT
TGTGCTTTTTTCTTGCTGGGAGAGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGACAGAACAGGAGCCTCTGCTC
TCTGTACCTATCTGGGCCCGGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCCTGCGCAGGAACACGTGTTG
CTTAGAAAAGCCAAATCCAGCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAACTGGAAACCAGTCTATCAAT
GTCTGTGCCAATTTTTTATTCCCTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTGCTGTCTAATGATGGGATGA
CCACACTTTTCCATGTTCTAAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTACAGCTACGTCTTACCCACC
TCCTGCCTCAACAGCCTGTGTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGGGACCTGGCTCTCCTTCTGC
AATGCAGGCGAAGGCCTAGATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAGTGATGCTTTTTTGCCTTGG
GCCCTGGGTTTGAAGCAGCCTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTCAGCCACCTACACACCACCG

>In-frame_FGFR1_ENST00000397091_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_4387nt
GCCGGCGCATAGCGCTCGGAGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTG
CAGCCGCAGCGCGCGGAGGAACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCG
ACCTCGCCTTCCCCGGCCGCGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGC
AGGGCGCACGGTACCCGTGCTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGG
CGCCGCCGCTGCGTTCTGGAGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGC
ACCAGCTCCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGC
GACCCCGCCAGGACCCGAACAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACT
CTCCCGAGGCGGAACCTCCACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCT
TGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCG
CTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCACCCCGGTGACCTGC
TGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGCAACCGCACCCGCA
TCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCCTCGGGCAGTGACA
CCACCTACTTCTCCGTCAATGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAA
CAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGA
CAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAA
TTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGG
AGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCG
CCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACA
TCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGA
TGGAGGTGCTTCACTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACT
CTGCATGGTTGACCGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAG
GGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGG
CTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACG
GAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAG
ATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATG
ACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCA
ATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGG
TGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGC
AGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGG
TGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCA
AGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCC
GCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTT
TCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCA
TCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATC
TGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGA
ACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGT
TCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAG
AGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCG
GTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACG
CCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCG
CTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTC
TGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCC
GGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGG
TCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAA
GGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGT
CCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGT
CTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGG
CCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCT

>In-frame_FGFR1_ENST00000447712_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6805nt
AGATGCAGGGGCGCAAACGCCAAAGGAGACCAGGCTGTAGGAAGAGAAGGGCAGAGCGCCGGACAGCTCGGCCCGCTCCCCGTCCTTTGG
GGCCGCGGCTGGGGAACTACAAGGCCCAGCAGGCAGCTGCAGGGGGCGGAGGCGGAGGAGGGACCAGCGCGGGTGGGAGTGAGAGAGCGA
GCCCTCGCGCCCCGCCGGCGCATAGCGCTCGGAGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGC
CGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTA
GCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCT
CGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGC
AAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCC
CCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCC
GCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAA
GCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGG
AGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCC
ACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCAC
CCCGGTGACCTGCTGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGC
AACCGCACCCGCATCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCC
TCGGGCAGTGACACCACCTACTTCTCCGTCAATGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCA
GAGGAGAAAGAAACAGATAACACCAAACCAAACCGTATGCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCAT
GCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAA
TTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGC
AACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATC
CTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCAC
ATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTT
AATACCACCGACAAAGAGATGGAGGTGCTTCACTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCT
ATCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAG
ATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGT
GACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGG
GCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTG
AGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGG
AGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAG
AACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGAC
AGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAG
CAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCA
GTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAG
AGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATG
GCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGG
GAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTC
CACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGA
TTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGAC
ACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAAC
AAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGAC
AGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGG
ATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGC
CAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAG
GCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTC
CGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGC
TGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAG
GAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCT
GCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTG
GAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACA
GATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCAT
CTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGT
GGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTT
TTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATT
CCCTCACTGTTGTATCTTGAATAAACGCTGCTGCTTCATCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTC
CCTGACTTAGAAACCACACTCCACTTCTAACAGGGTTTGAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTT
TTTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGTCTTTTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATG
TCAGGGGACAGGACCCCCAGGGAGGGAACCCCAGGCTACGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGA
CCGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTCCACAGGCCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTC
CCTGCCCCTGCCCCAGCACAGGTGACTTCATTTCTGTCCTCTCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGC
AGCAGCTTGCTGATGACTTGTTTTAAAACTTTCATCCTAAATAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAAT
TTTTTTCCGAACAGATCCAGATACCTAATAAGATGCTGGAATGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAA
GCGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTGAAGTCTCTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGAC
GGGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGGACCATTCGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTA
AACCCTCCTGACCACCTGGCTCAAAGAAAACAGAAGCATGGAGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTT
TTTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGAGAAGGGAGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGA
TGCAGCTGCCCAGAGGGAAGCAGGATCACATTTAAGGAAGTGTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCA
CCCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTGTGTGTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTG
GGGCCATGCGCCTGACACTCCTCTCTGCTTGTGGACCTGGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTG
TGTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGCTGGGAGAGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGAC
AGAACAGGAGCCTCTGCTCTCTGTACCTATCTGGGCCCGGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCC
TGCGCAGGAACACGTGTTGCTTAGAAAAGCCAAATCCAGCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAAC
TGGAAACCAGTCTATCAATGTCTGTGCCAATTTTTTATTCCCTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTG
CTGTCTAATGATGGGATGACCACACTTTTCCATGTTCTAAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTA
CAGCTACGTCTTACCCACCTCCTGCCTCAACAGCCTGTGTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGG
GACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCCTAGATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAG
TGATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGCAGCCTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTC

>In-frame_FGFR1_ENST00000447712_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_4586nt
AGATGCAGGGGCGCAAACGCCAAAGGAGACCAGGCTGTAGGAAGAGAAGGGCAGAGCGCCGGACAGCTCGGCCCGCTCCCCGTCCTTTGG
GGCCGCGGCTGGGGAACTACAAGGCCCAGCAGGCAGCTGCAGGGGGCGGAGGCGGAGGAGGGACCAGCGCGGGTGGGAGTGAGAGAGCGA
GCCCTCGCGCCCCGCCGGCGCATAGCGCTCGGAGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGC
CGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTA
GCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCT
CGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGC
AAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCC
CCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCC
GCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAA
GCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGG
AGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCC
ACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCAC
CCCGGTGACCTGCTGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGC
AACCGCACCCGCATCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCC
TCGGGCAGTGACACCACCTACTTCTCCGTCAATGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCA
GAGGAGAAAGAAACAGATAACACCAAACCAAACCGTATGCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCAT
GCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAA
TTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGC
AACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATC
CTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCAC
ATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTT
AATACCACCGACAAAGAGATGGAGGTGCTTCACTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCT
ATCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAG
ATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGT
GACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGG
GCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTG
AGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGG
AGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAG
AACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGAC
AGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAG
CAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCA
GTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAG
AGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATG
GCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGG
GAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTC
CACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGA
TTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGAC
ACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAA
GTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATT
GCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTG
GGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATG
AGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCC
AACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTG
CTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTC
TTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCC
TTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTG
TTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGC
GGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCT
GGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCA
TCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATC

>In-frame_FGFR1_ENST00000341462_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6805nt
AGATGCAGGGGCGCAAACGCCAAAGGAGACCAGGCTGTAGGAAGAGAAGGGCAGAGCGCCGGACAGCTCGGCCCGCTCCCCGTCCTTTGG
GGCCGCGGCTGGGGAACTACAAGGCCCAGCAGGCAGCTGCAGGGGGCGGAGGCGGAGGAGGGACCAGCGCGGGTGGGAGTGAGAGAGCGA
GCCCTCGCGCCCCGCCGGCGCATAGCGCTCGGAGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGC
CGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTA
GCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCT
CGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGC
AAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCC
CCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCC
GCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAA
GCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGG
AGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCC
ACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCAC
CCCGGTGACCTGCTGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGC
AACCGCACCCGCATCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCC
TCGGGCAGTGACACCACCTACTTCTCCGTCAATGTTTCAGTTCCCATAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGAC
TCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTG
CATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAA
GAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAG
GGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCC
ATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCG
CACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGCATTCGGGG
ATTAATAGCTCGGATGCGGAGGTGCTGACCCTGTTCAATGTGACAGAGGCCCAGAGCGGGGAGTATGTGTGTAAGGTTTCCAATTATATT
GGTGAAGCTAACCAGTCTGCGTGGCTCACTGTCACCAGACCTGTGCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAG
ATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGT
GACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGG
GCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTG
AGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGG
AGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAG
AACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGAC
AGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAG
CAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCA
GTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAG
AGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATG
GCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGG
GAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTC
CACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGA
TTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGAC
ACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAAC
AAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGAC
AGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGG
ATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGC
CAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAG
GCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTC
CGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGC
TGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAG
GAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCT
GCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTG
GAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACA
GATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCAT
CTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGT
GGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTT
TTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATT
CCCTCACTGTTGTATCTTGAATAAACGCTGCTGCTTCATCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTC
CCTGACTTAGAAACCACACTCCACTTCTAACAGGGTTTGAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTT
TTTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGTCTTTTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATG
TCAGGGGACAGGACCCCCAGGGAGGGAACCCCAGGCTACGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGA
CCGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTCCACAGGCCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTC
CCTGCCCCTGCCCCAGCACAGGTGACTTCATTTCTGTCCTCTCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGC
AGCAGCTTGCTGATGACTTGTTTTAAAACTTTCATCCTAAATAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAAT
TTTTTTCCGAACAGATCCAGATACCTAATAAGATGCTGGAATGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAA
GCGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTGAAGTCTCTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGAC
GGGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGGACCATTCGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTA
AACCCTCCTGACCACCTGGCTCAAAGAAAACAGAAGCATGGAGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTT
TTTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGAGAAGGGAGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGA
TGCAGCTGCCCAGAGGGAAGCAGGATCACATTTAAGGAAGTGTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCA
CCCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTGTGTGTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTG
GGGCCATGCGCCTGACACTCCTCTCTGCTTGTGGACCTGGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTG
TGTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGCTGGGAGAGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGAC
AGAACAGGAGCCTCTGCTCTCTGTACCTATCTGGGCCCGGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCC
TGCGCAGGAACACGTGTTGCTTAGAAAAGCCAAATCCAGCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAAC
TGGAAACCAGTCTATCAATGTCTGTGCCAATTTTTTATTCCCTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTG
CTGTCTAATGATGGGATGACCACACTTTTCCATGTTCTAAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTA
CAGCTACGTCTTACCCACCTCCTGCCTCAACAGCCTGTGTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGG
GACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCCTAGATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAG
TGATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGCAGCCTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTC

>In-frame_FGFR1_ENST00000341462_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_4586nt
AGATGCAGGGGCGCAAACGCCAAAGGAGACCAGGCTGTAGGAAGAGAAGGGCAGAGCGCCGGACAGCTCGGCCCGCTCCCCGTCCTTTGG
GGCCGCGGCTGGGGAACTACAAGGCCCAGCAGGCAGCTGCAGGGGGCGGAGGCGGAGGAGGGACCAGCGCGGGTGGGAGTGAGAGAGCGA
GCCCTCGCGCCCCGCCGGCGCATAGCGCTCGGAGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGC
CGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTA
GCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCT
CGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGC
AAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCC
CCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCC
GCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAA
GCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGG
AGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCC
ACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCAC
CCCGGTGACCTGCTGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGC
AACCGCACCCGCATCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCC
TCGGGCAGTGACACCACCTACTTCTCCGTCAATGTTTCAGTTCCCATAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGAC
TCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTG
CATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAA
GAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAG
GGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCC
ATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCG
CACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGCATTCGGGG
ATTAATAGCTCGGATGCGGAGGTGCTGACCCTGTTCAATGTGACAGAGGCCCAGAGCGGGGAGTATGTGTGTAAGGTTTCCAATTATATT
GGTGAAGCTAACCAGTCTGCGTGGCTCACTGTCACCAGACCTGTGCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAG
ATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGT
GACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGG
GCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTG
AGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGG
AGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAG
AACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGAC
AGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAG
CAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCA
GTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAG
AGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATG
GCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGG
GAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTC
CACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGA
TTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGAC
ACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAA
GTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATT
GCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTG
GGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATG
AGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCC
AACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTG
CTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTC
TTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCC
TTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTG
TTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGC
GGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCT
GGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCA
TCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATC

>In-frame_FGFR1_ENST00000532791_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6587nt
AGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTGCAGCCGCAGCGCGCGGAGG
AACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCGACCTCGCCTTCCCCGGCCG
CGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGCAGGGCGCACGGTACCCGTG
CTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGG
AGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGCACCAGCTCCGGCTCCATTG
TTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGCGACCCCGCCAGGACCCGAA
CAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACTCTCCCGAGGCGGAACCTCC
ACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTG
CAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTT
GCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCACCCCGGTGACCTGCTGCAGCTTCGCTGTCGGCT
GCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGCAACCGCACCCGCATCACAGGGGAGGAGGTGGA
GGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCCTCGGGCAGTGACACCACCTACTTCTCCGTCAA
TGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAA
CCGTATGCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAA
ATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAA
GGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGG
CAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGT
GGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGG
GAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGATGGAGGTGCTTCA
CTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGAC
CGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCAT
CTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCT
GGCCAAGAGCATCCCTCTGCGCAGACAGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGC
TGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGAC
CAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCC
TGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCG
ACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCT
GCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATG
GTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGA
CGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAA
GAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACAC
GTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGAC
ATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGA
GTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGT
GGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGA
GCTGGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGA
CAGACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGAT
CGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAA
GATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGA
GGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGAT
GATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTA
CCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAA
CCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCAC
GGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTG
GTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCAT
CCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTA
GAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTG
GCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAG
TTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTG
GATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATTCCCTCACTGTTGTATCTTGAATAAACGCTGCTGCTTCA
TCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTCCCTGACTTAGAAACCACACTCCACTTCTAACAGGGTTT
GAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTTTTTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGTCTT
TTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATGTCAGGGGACAGGACCCCCAGGGAGGGAACCCCAGGCTA
CGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGACCGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTCCAC
AGGCCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTCCCTGCCCCTGCCCCAGCACAGGTGACTTCATTTCTGTC
CTCTCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGCAGCAGCTTGCTGATGACTTGTTTTAAAACTTTCATCCT
AAATAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAATTTTTTTCCGAACAGATCCAGATACCTAATAAGATGCTG
GAATGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAAGCGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTGAAG
TCTCTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGACGGGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGGACC
ATTCGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTAAACCCTCCTGACCACCTGGCTCAAAGAAAACAGAAGCA
TGGAGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTTTTTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGAGAA
GGGAGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGATGCAGCTGCCCAGAGGGAAGCAGGATCACATTTAAGGA
AGTGTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCACCCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTGTGT
GTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTGGGGCCATGCGCCTGACACTCCTCTCTGCTTGTGGACCT
GGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTGTGTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGCTGG
GAGAGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGACAGAACAGGAGCCTCTGCTCTCTGTACCTATCTGGGCCC
GGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCCTGCGCAGGAACACGTGTTGCTTAGAAAAGCCAAATCCA
GCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAACTGGAAACCAGTCTATCAATGTCTGTGCCAATTTTTTAT
TCCCTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTGCTGTCTAATGATGGGATGACCACACTTTTCCATGTTCT
AAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTACAGCTACGTCTTACCCACCTCCTGCCTCAACAGCCTGT
GTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGGGACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCCTAG
ATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAGTGATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGCAGC
CTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTCAGCCACCTACACACCACCGTGGCCGACACTTTCATTAA

>In-frame_FGFR1_ENST00000532791_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_4368nt
AGCGCTCTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTGCAGCCGCAGCGCGCGGAGG
AACCCGGGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCGACCTCGCCTTCCCCGGCCG
CGAGCGCGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGCAGGGCGCACGGTACCCGTG
CTGCAGTCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGG
AGGAGGGGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGCACCAGCTCCGGCTCCATTG
TTCCCGCCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGCGACCCCGCCAGGACCCGAA
CAGAGCCCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACTCTCCCGAGGCGGAACCTCC
ACGCCGAGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTG
CAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTT
GCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCACCCCGGTGACCTGCTGCAGCTTCGCTGTCGGCT
GCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGGAAAGCAACCGCACCCGCATCACAGGGGAGGAGGTGGA
GGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCCTCGGGCAGTGACACCACCTACTTCTCCGTCAA
TGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAA
CCGTATGCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAA
ATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAA
GGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGG
CAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGT
GGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGG
GAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGATGGAGGTGCTTCA
CTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGAC
CGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCAT
CTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCT
GGCCAAGAGCATCCCTCTGCGCAGACAGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGC
TGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGAC
CAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCC
TGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCG
ACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCT
GCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATG
GTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGA
CGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAA
GAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACAC
GTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGAC
ATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGA
GTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGT
GGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGC
CCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAG
CTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTA
CATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCA
GGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAA
GCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGC
AAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGT
GGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAG
CAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTT
CCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTG
GAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGT
GTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGC
CTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAA
GGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACG

>In-frame_FGFR1_ENST00000397113_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6174nt
GCTTTGCCCGCCGCAGCCCAGCCGGGGCCGGCGCCTCCCTCCGCTCGCCGCCCGCCCCTTTCACCTCCTGGCTCCCTCCCGGGCGATCCG
CGCCCCTTGGGTCTCCCCTCCCTTCCCTCCGTCCGCGTCTCCTGCGCCCCCTCCCTGCGCTCGTCCCGCCGCTCTTCCCGCCGCCCAACT
TTTCCTCCAACTCGCGCTCGGGAGCTGGCGAGGCGGCGGCGGCTCCTCAGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATC
CATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCA
CAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGG
TCCACCCCGGTGACCTGCTGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGG
AAAGCAACCGCACCCGCATCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCA
GCCCCTCGGGCAGTGACACCACCTACTTCTCCGTCAATGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCT
CTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATG
CAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAAT
TCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCA
ACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCC
TGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACA
TCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTA
ATACCACCGACAAAGAGATGGAGGTGCTTCACTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTA
TCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGA
TCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTG
ACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGG
CCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGA
GAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGA
GCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGA
ACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACA
GCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGC
AGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAG
TGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGA
GGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGG
CCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGG
AGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCC
ACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGAT
TTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACA
CAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAACA
AGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGACA
GAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGA
TGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCC
AGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGG
CAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCC
GTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCT
GCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGG
AGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTG
CCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGG
AGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAG
ATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATC
TGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTG
GTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTT
TTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATTC
CCTCACTGTTGTATCTTGAATAAACGCTGCTGCTTCATCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTCC
CTGACTTAGAAACCACACTCCACTTCTAACAGGGTTTGAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTTT
TTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGTCTTTTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATGT
CAGGGGACAGGACCCCCAGGGAGGGAACCCCAGGCTACGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGAC
CGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTCCACAGGCCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTCC
CTGCCCCTGCCCCAGCACAGGTGACTTCATTTCTGTCCTCTCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGCA
GCAGCTTGCTGATGACTTGTTTTAAAACTTTCATCCTAAATAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAATT
TTTTTCCGAACAGATCCAGATACCTAATAAGATGCTGGAATGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAAG
CGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTGAAGTCTCTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGACG
GGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGGACCATTCGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTAA
ACCCTCCTGACCACCTGGCTCAAAGAAAACAGAAGCATGGAGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTTT
TTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGAGAAGGGAGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGAT
GCAGCTGCCCAGAGGGAAGCAGGATCACATTTAAGGAAGTGTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCAC
CCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTGTGTGTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTGG
GGCCATGCGCCTGACACTCCTCTCTGCTTGTGGACCTGGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTGT
GTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGCTGGGAGAGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGACA
GAACAGGAGCCTCTGCTCTCTGTACCTATCTGGGCCCGGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCCT
GCGCAGGAACACGTGTTGCTTAGAAAAGCCAAATCCAGCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAACT
GGAAACCAGTCTATCAATGTCTGTGCCAATTTTTTATTCCCTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTGC
TGTCTAATGATGGGATGACCACACTTTTCCATGTTCTAAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTAC
AGCTACGTCTTACCCACCTCCTGCCTCAACAGCCTGTGTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGGG
ACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCCTAGATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAGT
GATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGCAGCCTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTCA

>In-frame_FGFR1_ENST00000397113_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_3955nt
GCTTTGCCCGCCGCAGCCCAGCCGGGGCCGGCGCCTCCCTCCGCTCGCCGCCCGCCCCTTTCACCTCCTGGCTCCCTCCCGGGCGATCCG
CGCCCCTTGGGTCTCCCCTCCCTTCCCTCCGTCCGCGTCTCCTGCGCCCCCTCCCTGCGCTCGTCCCGCCGCTCTTCCCGCCGCCCAACT
TTTCCTCCAACTCGCGCTCGGGAGCTGGCGAGGCGGCGGCGGCTCCTCAGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATC
CATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCA
CAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGCCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGG
TCCACCCCGGTGACCTGCTGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGGTGCAGCTGGCGG
AAAGCAACCGCACCCGCATCACAGGGGAGGAGGTGGAGGTGCAGGACTCCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCA
GCCCCTCGGGCAGTGACACCACCTACTTCTCCGTCAATGTTTCAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCT
CTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATG
CAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAAT
TCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCA
ACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCC
TGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACA
TCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTA
ATACCACCGACAAAGAGATGGAGGTGCTTCACTTAAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTA
TCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGA
TCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTG
ACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGG
CCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGA
GAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGA
GCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGA
ACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACA
GCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGC
AGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAG
TGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGA
GGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGG
CCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGG
AGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCC
ACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGAT
TTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACA
CAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAG
TAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTG
CTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGG
GCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGA
GCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCA
ACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGC
TCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCT
TTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCT
TGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGT
TCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCG
GGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTG
GAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCAT
CTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCA

>In-frame_FGFR1_ENST00000356207_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6320nt
CTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCG
GGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCG
CGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAG
TCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGG
GGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCG
CCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGC
CCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCG
AGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAAC
TGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGA
ACAAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCG
TATGCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATG
CCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGT
CCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAG
CATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGC
CCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAG
CAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGATGGAGGTGCTTCACTT
AAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGACCGT
TCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCATCTC
CTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCTGGC
CAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAAT
GGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAAC
GACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACAC
TCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACC
CCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAA
GCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAA
ATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCT
GGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCT
GAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTA
CACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCT
GACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGA
TGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGA
GGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGAT
AGAGCTGGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCAC
GGACAGACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGG
GATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGT
CAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGA
GGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGT
GATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTT
CTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGC
CAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGC
CACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAG
CTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAG
CATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCC
GTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAG
GTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGC
CAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTA
CTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATTCCCTCACTGTTGTATCTTGAATAAACGCTGCTGCT
TCATCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTCCCTGACTTAGAAACCACACTCCACTTCTAACAGGG
TTTGAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTTTTTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGT
CTTTTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATGTCAGGGGACAGGACCCCCAGGGAGGGAACCCCAGG
CTACGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGACCGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTC
CACAGGCCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTCCCTGCCCCTGCCCCAGCACAGGTGACTTCATTTCT
GTCCTCTCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGCAGCAGCTTGCTGATGACTTGTTTTAAAACTTTCAT
CCTAAATAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAATTTTTTTCCGAACAGATCCAGATACCTAATAAGATG
CTGGAATGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAAGCGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTG
AAGTCTCTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGACGGGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGG
ACCATTCGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTAAACCCTCCTGACCACCTGGCTCAAAGAAAACAGAA
GCATGGAGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTTTTTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGA
GAAGGGAGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGATGCAGCTGCCCAGAGGGAAGCAGGATCACATTTAA
GGAAGTGTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCACCCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTG
TGTGTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTGGGGCCATGCGCCTGACACTCCTCTCTGCTTGTGGA
CCTGGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTGTGTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGC
TGGGAGAGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGACAGAACAGGAGCCTCTGCTCTCTGTACCTATCTGGG
CCCGGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCCTGCGCAGGAACACGTGTTGCTTAGAAAAGCCAAAT
CCAGCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAACTGGAAACCAGTCTATCAATGTCTGTGCCAATTTTT
TATTCCCTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTGCTGTCTAATGATGGGATGACCACACTTTTCCATGT
TCTAAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTACAGCTACGTCTTACCCACCTCCTGCCTCAACAGCC
TGTGTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGGGACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCC
TAGATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAGTGATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGC
AGCCTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTCAGCCACCTACACACCACCGTGGCCGACACTTTCAT

>In-frame_FGFR1_ENST00000356207_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_4101nt
CTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCG
GGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCG
CGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAG
TCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGG
GGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCG
CCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGC
CCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCG
AGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAAC
TGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGA
ACAAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCG
TATGCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATG
CCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGT
CCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAG
CATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGC
CCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAG
CAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGATGGAGGTGCTTCACTT
AAGAAATGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGACCGT
TCTGGAAGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCATCTC
CTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCTGGC
CAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAAT
GGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAAC
GACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACAC
TCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACC
CCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAA
GCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAA
ATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCT
GGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCT
GAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTA
CACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCT
GACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGA
TGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGA
GGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCA
GGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTT
CAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCC
CTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACAT
CCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCT
GAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGT
TGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAG
GGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGA
GAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTA
CTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTC
CTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCA
AGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCT
GGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGT
GAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGA

>In-frame_FGFR1_ENST00000326324_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_6314nt
CTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCG
GGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCG
CGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAG
TCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGG
GGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCG
CCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGC
CCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCG
AGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAAC
TGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGA
ACAAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCC
CGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTC
CAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTA
TGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAA
CCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGG
TAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGAT
TGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGATGGAGGTGCTTCACTTAAGAAA
TGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGA
AGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCAT
GGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAG
CATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGA
GAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAA
GAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGC
CAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACG
GCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCG
CCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTA
CATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGC
TTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAA
GAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTT
CCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATC
CGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTC
TCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGA
TTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCT
GGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAG
ACTCATGGGGAAGGGCCAGGTCCAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGA
AGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGAT
TGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGT
GGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGAT
GAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCC
CAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCT
GCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGT
CTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTC
CTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCT
GTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAG
CGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCC
TGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTC
ATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGAT
CACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATTCCCTCACTGTTGTATCTTGAATAAACGCTGCTGCTTCATCC
TGTGGGGGCCGTGGCCCTGTCCCTGTGTGGGTGGGGCCTCTTCCATTTCCCTGACTTAGAAACCACACTCCACTTCTAACAGGGTTTGAG
AGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTCTTTTTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGTCTTTTG
TTGCCATGTTAGTCCTCCTTGGAAGGCAGCTCAGAAGGCCTGTGAAATGTCAGGGGACAGGACCCCCAGGGAGGGAACCCCAGGCTACGC
ACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCTGACCGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTCCACAGG
CCTGGACTTCTCTGGCTTCTCTGCCCACACACTCCCTGCCCCCAGTGTCCCTGCCCCTGCCCCAGCACAGGTGACTTCATTTCTGTCCTC
TCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTGGCAGCAGCTTGCTGATGACTTGTTTTAAAACTTTCATCCTAAA
TAACCTTTTGATACTTGAATATTTGTAAGTTTTATACATAGTTTCTAATTTTTTTCCGAACAGATCCAGATACCTAATAAGATGCTGGAA
TGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCTAAGCGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTGAAGTCT
CTGGAGAACAGGATACGTGGAGGGTTAGGAAGGGGCCAGGCCTAGAGACGGGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGGACCATT
CGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTGTAAACCCTCCTGACCACCTGGCTCAAAGAAAACAGAAGCATGG
AGACCGCCAAGTATTTTCAAGAAATAACCCCATGAATATTCCATCACTTTTTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGAGAAGGG
AGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAGGATGCAGCTGCCCAGAGGGAAGCAGGATCACATTTAAGGAAGT
GTGTGGGGTCCCTGGATGACACCAGCACCCAGTGCGGCTCTGTCTGGCACCCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTGTGTGTC
AGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAGTGGGGCCATGCGCCTGACACTCCTCTCTGCTTGTGGACCTGGC
AAGGCAGGGAGCAGAAAACAGCCACTTGAAGGCTTTCTGTCTGCGTCTGTGTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGCTGGGAG
AGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGGACAGAACAGGAGCCTCTGCTCTCTGTACCTATCTGGGCCCGGT
GGGCTCCCTTGTCCTGGCTTCCATCTCTGTCTCAGCGACCATTCAGCCCTGCGCAGGAACACGTGTTGCTTAGAAAAGCCAAATCCAGCC
TTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAAACTGGAAACCAGTCTATCAATGTCTGTGCCAATTTTTTATTCC
CTCCCCAACCTCCTTCCCCATACGACTTTTTATTTATGTAGGATGTGTGCTGTCTAATGATGGGATGACCACACTTTTCCATGTTCTAAA
AGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTCTACAGCTACGTCTTACCCACCTCCTGCCTCAACAGCCTGTGTG
GTGGCAAAGCCGGTGTGGGGCTGGGGAACGCAGCGTTCTCCAGGAGGGGGACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCCTAGATG
CCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGAAGTGATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGCAGCCTG
GCTTTCTCTTGGTAAGTGGCTGGTGTCTTAGCAGCTGCAATCTGAGCTCAGCCACCTACACACCACCGTGGCCGACACTTTCATTAAAAA

>In-frame_FGFR1_ENST00000326324_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_4095nt
CTTGCGGCCACAGGCGCGGCGTCCTCGGCGGCGGGCGGCAGCTAGCGGGAGCCGGGACGCCGGTGCAGCCGCAGCGCGCGGAGGAACCCG
GGTGTGCCGGGAGCTGGGCGGCCACGTCCGGACGGGACCGAGACCCCTCGTAGCGCATTGCGGCGACCTCGCCTTCCCCGGCCGCGAGCG
CGCCGCTGCTTGAAAAGCCGCGGAACCCAAGGACTTTTCTCCGGTCCGAGCTCGGGGCGCCCCGCAGGGCGCACGGTACCCGTGCTGCAG
TCGGGCACGCCGCGGCGCCGGGGCCTCCGCAGGGCGATGGAGCCCGGTCTGCAAGGAAAGTGAGGCGCCGCCGCTGCGTTCTGGAGGAGG
GGGGCACAAGGTCTGGAGACCCCGGGTGGCGGACGGGAGCCCTCCCCCCGCCCCGCCTCCGGGGCACCAGCTCCGGCTCCATTGTTCCCG
CCCGGGCTGGAGGCGCCGAGCACCGAGCGCCGCCGGGAGTCGAGCGCCGGCCGCGGAGCTCTTGCGACCCCGCCAGGACCCGAACAGAGC
CCGGGGGCGGCGGGCCGGAGCCGGGGACGCGGGCACACGCCCGCTCGCACAAGCCACGGCGGACTCTCCCGAGGCGGAACCTCCACGCCG
AGCGAGGGTCAGTTTGAAAAGGAGGATCGAGCTCACTGTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAAC
TGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGA
ACAAGATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCC
CGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTC
CAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTA
TGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAA
CCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGG
TAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGAT
TGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAGACTGCTGGAGTTAATACCACCGACAAAGAGATGGAGGTGCTTCACTTAAGAAA
TGTCTCCTTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCACTCTGCATGGTTGACCGTTCTGGA
AGCCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCAT
GGTGGGGTCGGTCATCGTCTACAAGATGAAGAGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAG
CATCCCTCTGCGCAGACAGGTAACAGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGA
GAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAA
GAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGC
CAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACG
GCAGTCCATGACGGTGAAGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCG
CCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTA
CATTCCGCTCACGGATCTCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGC
TTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAA
GAAGCTGTCGGAGCAGGAGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTT
CCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATC
CGTGGAGCTGCAGATGCTGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTC
TCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGA
TTCCTTTGGGTATTTTGTGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCT
GCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTT
GAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACAT
CGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGC
ACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCT
GTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAA
GGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGC
AGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAA
GCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCT
GCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAG
GCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTT
GGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTC
AGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGG
AGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGA

>In-frame_FGFR1_ENST00000397103_chr8_38277056_-_BCR_ENST00000305877_chr22_23610592_+_5653nt
GTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCT
GTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGATGCTCTCCCCTCCTCGGAGGATGATGATGAT
GATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAA
AAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAA
AATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCC
TCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCT
CACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGAC
CCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAG
CATTCGGGGATTAATAGCTCGGATGCGGAGGTGCTGACCCTGTTCAATGTGACAGAGGCCCAGAGCGGGGAGTATGTGTGTAAGGTTTCC
AATTATATTGGTGAAGCTAACCAGTCTGCGTGGCTCACTGTCACCAGACCTGTGGCAAAAGCCCTGGAAGAGAGGCCGGCAGTGATGACC
TCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAG
AGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGC
CAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCA
GAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCT
GTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGAC
GCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCAC
CGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTC
TGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATG
GTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAAT
GACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTG
CTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAG
TGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGT
GTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATC
GTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAG
ACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAATTTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATACTGTGC
TATGAAAAGTGTTACAACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCCAGGTCCAGCTGGAC
CCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGG
GAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAG
GTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACG
GACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGC
ACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGAC
CCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTG
AAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAG
AAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTG
CTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCC
ATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCAC
CCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCC
AGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGAC
AGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGA
AGGGAACGTGACTGGATTCCCTCACTGTTGTATCTTGAATAAACGCTGCTGCTTCATCCTGTGGGGGCCGTGGCCCTGTCCCTGTGTGGG
TGGGGCCTCTTCCATTTCCCTGACTTAGAAACCACACTCCACTTCTAACAGGGTTTGAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGAC
TCCATTCTTGGCTTTCTTTTTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGTCTTTTGTTGCCATGTTAGTCCTCCTTGGAAGGCAGCT
CAGAAGGCCTGTGAAATGTCAGGGGACAGGACCCCCAGGGAGGGAACCCCAGGCTACGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGAC
CTCGTCCCCCGATCCTGACCGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTCCACAGGCCTGGACTTCTCTGGCTTCTCTGCCCACACA
CTCCCTGCCCCCAGTGTCCCTGCCCCTGCCCCAGCACAGGTGACTTCATTTCTGTCCTCTCAGCTCAGTGGACTCGCTCAACTTTTGTAT
AAGTCTCCACTTGGTGGCAGCAGCTTGCTGATGACTTGTTTTAAAACTTTCATCCTAAATAACCTTTTGATACTTGAATATTTGTAAGTT
TTATACATAGTTTCTAATTTTTTTCCGAACAGATCCAGATACCTAATAAGATGCTGGAATGTAATCCCTGGACAATCCGTGTCCTGGCAG
CATTTGGTCTTCCTCTAAGCGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTGAAGTCTCTGGAGAACAGGATACGTGGAGGGTTAGGAA
GGGGCCAGGCCTAGAGACGGGAGACTCCCTCCCGGAGCAGGTGGAGGCACAGGACCATTCGCTACCCCATCTGCCGACACCTGCGGGGGA
GCCCAGGCATTCTTTGTAAACCCTCCTGACCACCTGGCTCAAAGAAAACAGAAGCATGGAGACCGCCAAGTATTTTCAAGAAATAACCCC
ATGAATATTCCATCACTTTTTTAGAAAGAGGGGCTTGGGGCAGGCAGAGGAGAGAAGGGAGAGCAAACTGAGAGCCAAGTTTCCACACGG
TCCTGCAGGAGGAGAGGATGCAGCTGCCCAGAGGGAAGCAGGATCACATTTAAGGAAGTGTGTGGGGTCCCTGGATGACACCAGCACCCA
GTGCGGCTCTGTCTGGCACCCGCTCCCAAGGTGGGAGGAGTGGGTGTCCCCTGTGTGTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCA
CTAGGGAGCCTGACAGTGGGGCCATGCGCCTGACACTCCTCTCTGCTTGTGGACCTGGCAAGGCAGGGAGCAGAAAACAGCCACTTGAAG
GCTTTCTGTCTGCGTCTGTGTGCAGTGTGGATTTAGTTGTGCTTTTTTCTTGCTGGGAGAGCACAGCCACCATTTACAAGCAGTGTCACC
GTCGTGGGTGGCGAGGACAGAACAGGAGCCTCTGCTCTCTGTACCTATCTGGGCCCGGTGGGCTCCCTTGTCCTGGCTTCCATCTCTGTC
TCAGCGACCATTCAGCCCTGCGCAGGAACACGTGTTGCTTAGAAAAGCCAAATCCAGCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTG
CATCTGTTACCTTGAAACTGGAAACCAGTCTATCAATGTCTGTGCCAATTTTTTATTCCCTCCCCAACCTCCTTCCCCATACGACTTTTT
ATTTATGTAGGATGTGTGCTGTCTAATGATGGGATGACCACACTTTTCCATGTTCTAAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTG
GTGGTTGCTTTGGGTCTACAGCTACGTCTTACCCACCTCCTGCCTCAACAGCCTGTGTGGTGGCAAAGCCGGTGTGGGGCTGGGGAACGC
AGCGTTCTCCAGGAGGGGGACCTGGCTCTCCTTCTGCAATGCAGGCGAAGGCCTAGATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCC
AGACTCCCCGGCCGGAAGTGATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGCAGCCTGGCTTTCTCTTGGTAAGTGGCTGGTGTCTTAG

>In-frame_FGFR1_ENST00000397103_chr8_38277056_-_BCR_ENST00000359540_chr22_23610592_+_3434nt
GTGGAGTATCCATGGAGATGTGGAGCCTTGTCACCAACCTCTAACTGCAGAACTGGGATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCT
GTGCTGGTCACAGCCACACTCTGCACCGCTAGGCCGTCCCCGACCTTGCCTGAACAAGATGCTCTCCCCTCCTCGGAGGATGATGATGAT
GATGATGACTCCTCTTCAGAGGAGAAAGAAACAGATAACACCAAACCAAACCCCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAA
AAGAAATTGCATGCAGTGCCGGCTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCTGGTTGAAA
AATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAAGGTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCC
TCTGACAAGGGCAACTACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTCGTGGAGCGGTCCCCT
CACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCCTGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGAC
CCGCAGCCGCACATCCAGTGGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCCAGATCTTGAAG
CATTCGGGGATTAATAGCTCGGATGCGGAGGTGCTGACCCTGTTCAATGTGACAGAGGCCCAGAGCGGGGAGTATGTGTGTAAGGTTTCC
AATTATATTGGTGAAGCTAACCAGTCTGCGTGGCTCACTGTCACCAGACCTGTGGCAAAAGCCCTGGAAGAGAGGCCGGCAGTGATGACC
TCGCCCCTGTACCTGGAGATCATCATCTATTGCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAG
AGTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCTCTGCGCAGACAGGTAACAGCCAGC
CAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCA
GAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCT
GTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGAC
GCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCAC
CGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGGCCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTC
TGCACCAAGCTCAAGAAGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATCTCAGCTTCCAGATG
GTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATGAGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAAT
GACATCCAGAGAGAGAAGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGGAGTCACTGCTGCTG
CTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCAAGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAG
TGGAGGGAGAACATCCGGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGCTGACCAACTCGTGT
GTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGGAAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATC
GTCCACTCAGCCACTGGATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTGTGAATAAAGCAAAG
ACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATC
GCCATGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGAGGATGCCGTCCCGAAAACAGACAGGG
GTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGAGAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGC
CGAGGCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGAAGGCAGCCTTCGACGTCAATAACAAG
GACGTGTCGGTGATGATGAGCGAGATGGACGTGAACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTC
ACTGACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGAGCTGCATGCTCAACCTGCTGCTGTCC
CTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCCTTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTG
CACAACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCCCTGCCAACCCCAGCCAGCCTATCACC
ATGACTGACAGCTGGTCCTTGGAGGTCATGTCCCAGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGC
AAGAGACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGACAGATGGCCTGGAAACCTCTGGCTAA
TCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGGTGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAG
CCGAAGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACTGTGGTTTTTTATGTGGCCACCTGAGG
GCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCCTGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTA
AAAGATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGATTCCCTCACTGTTGTATCTTGAATAA


Top

FusionGenePPI for FGFR1_BCR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FGFR1FDPS, FRS3, NCAM1, FGF1, FGFR1, FRS2, PLCG1, FGF2, SHB, GRB14, BNIP2, KPNB1, CREBBP, STAT3, JAK2, SRC, NEDD4, PPP2R1B, FGF23, PTK6, ITK, NCK1, VAV1, HSP90AA1, ERBB3, CTPS2, CDK9, RPS6KA3, CDC20, TSPAN3, CEACAM21, IL20RB, LGALS8, TGFBR2, GINM1, DLK1, LTBR, TNFRSF10B, EVI2A, MREG, HEPACAM2, GOLGA7B, LDLRAD4, CRK, CTNNB1, CDH1, FGF8, SOS1, PIK3R1, PKM, FGF3, FGF5, FGF6, FGF9, FGF10, FGF17, CD44, RPS6KA1, SLA, PIK3R2, SH3BP2, NCK2, TENC1, RTN1, RTN3, PVRL1, EPHA4, YES1, L1CAM, TNK2, AKT1, PDP1, FGFR2, FAM8A1, TMEM30B, LRRN2, LITAF, C16orf58, ZDHHC11, IFNGR1, GAD1, FCGRT, IL27RA, RAET1E, SLC1A1, C14orf37, MANSC1, TPCN2, CD79B, SCN3B, C19orf45, HTR1A, FLRT1, KAL1BCRMLLT4, HCK, PTPN6, FES, RB1, ERCC3, GRB2, ABL1, GAB2, HOXA9, CRKL, KIT, PIK3CG, IGSF21, TP53, UNC119, SOS1, PXN, RAC1, CDC42, RHOA, IL3, WDR48, TSG101, VPS28, INPP5D, MYC, HSP90AA1, HSPA8, HIF1A, CRK, GABRR1, CBL, LNX1, LRRK1, GRK5, UBASH3B, PIK3R2, SHC1, AP2M1, CFTR, ERBB2IP, DOK1, PTGES3, HSPA4, HSPD1, UBC, CSNK2A2, STUB1, CCDC183, RSPH9, SEC13, NTRK1, CEP128, NINL, XPO1, PIK3R1, PDZK1, COMMD1, TULP3, JPH4, NAGK, USP15, SPAG9, MCM2, MCM4, WEE1, CSNK1A1, MCM6, TRIM25, RAD51


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FGFR1_BCR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneFGFR1P11362DB00039PaliferminFibroblast growth factor receptor 1biotechapproved
HgeneFGFR1P11362DB08896RegorafenibFibroblast growth factor receptor 1small moleculeapproved
HgeneFGFR1P11362DB09079NintedanibFibroblast growth factor receptor 1small moleculeapproved
HgeneFGFR1P11362DB00398SorafenibFibroblast growth factor receptor 1small moleculeapproved|investigational
HgeneFGFR1P11362DB01109HeparinFibroblast growth factor receptor 1small moleculeapproved|investigational
HgeneFGFR1P11362DB08901PonatinibFibroblast growth factor receptor 1small moleculeapproved|investigational
HgeneFGFR1P11362DB09078LenvatinibFibroblast growth factor receptor 1small moleculeapproved|investigational
TgeneBCRP11274DB06616BosutinibBreakpoint cluster region proteinsmall moleculeapproved
TgeneBCRP11274DB01254DasatinibBreakpoint cluster region proteinsmall moleculeapproved|investigational
TgeneBCRP11274DB08901PonatinibBreakpoint cluster region proteinsmall moleculeapproved|investigational

Top

RelatedDiseases for FGFR1_BCR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFGFR1C1563720Kallmann Syndrome 2 (disorder)14ORPHANET;UNIPROT
HgeneFGFR1C0011570Mental Depression5PSYGENET
HgeneFGFR1C0011581Depressive disorder5CTD_human;HPO;PSYGENET
HgeneFGFR1C0005586Bipolar Disorder3PSYGENET
HgeneFGFR1C0041696Unipolar Depression3PSYGENET
HgeneFGFR1C1269683Major Depressive Disorder3PSYGENET
HgeneFGFR1C0027022Myeloproliferative disease2CTD_human
HgeneFGFR1C0220658Pfeiffer Syndrome2UNIPROT
HgeneFGFR1C0406612Encephalocraniocutaneous lipomatosis2ORPHANET;UNIPROT
HgeneFGFR1C0432283Osteoglophonic dwarfism2CTD_human;ORPHANET;UNIPROT
HgeneFGFR1C1458155Mammary Neoplasms2CTD_human
HgeneFGFR1C1845146Holoprosencephaly, Ectrodactyly, and Bilateral Cleft Lip-Palate2ORPHANET;UNIPROT
HgeneFGFR1C0004114Astrocytoma1CTD_human
HgeneFGFR1C0007131Non-Small Cell Lung Carcinoma1CTD_human
HgeneFGFR1C0007137Squamous cell carcinoma1CTD_human
HgeneFGFR1C0008924Cleft Lip1CTD_human;HPO
HgeneFGFR1C0008925Cleft Palate1CTD_human;HPO
HgeneFGFR1C0017638Glioma1CTD_human
HgeneFGFR1C0024121Lung Neoplasms1CTD_human
HgeneFGFR1C0036341Schizophrenia1CTD_human
HgeneFGFR1C0149925Small cell carcinoma of lung1CTD_human
HgeneFGFR1C0376634Craniofacial Abnormalities1CTD_human
HgeneFGFR1C0432122Interfrontal craniofaciosynostosis1CTD_human;UNIPROT
TgeneBCRC0005586Bipolar Disorder4PSYGENET
TgeneBCRC0023473Myeloid Leukemia, Chronic3CTD_human;HPO;ORPHANET
TgeneBCRC0005699Blast Phase1CTD_human
TgeneBCRC0023893Liver Cirrhosis, Experimental1CTD_human
TgeneBCRC0027022Myeloproliferative disease1CTD_human;HPO
TgeneBCRC0027540Necrosis1CTD_human
TgeneBCRC0027659Neoplasms, Experimental1CTD_human
TgeneBCRC0041696Unipolar Depression1PSYGENET
TgeneBCRC1269683Major Depressive Disorder1PSYGENET