FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13379

FusionGeneSummary for FGF2_FREM3

check button Fusion gene summary
Fusion gene informationFusion gene name: FGF2_FREM3
Fusion gene ID: 13379
HgeneTgene
Gene symbol

FGF2

FREM3

Gene ID

2258

166752

Gene namefibroblast growth factor 13FRAS1 related extracellular matrix 3
SynonymsFGF-13|FGF2|FHF-2|FHF2-
Cytomap

Xq26.3-q27.1

4q31.21

Type of geneprotein-codingprotein-coding
Descriptionfibroblast growth factor 13fibroblast growth factor homologous factor 2FRAS1-related extracellular matrix protein 3
Modification date2018051920180329
UniProtAcc

P09038

P0C091

Ensembl transtripts involved in fusion geneENST00000264498, ENST00000608478, 
ENST00000329798, ENST00000508899, 
Fusion gene scores* DoF score1 X 1 X 1=11 X 1 X 1=1
# samples 11
** MAII scorelog2(1/1*10)=3.32192809488736log2(1/1*10)=3.32192809488736
Context

PubMed: FGF2 [Title/Abstract] AND FREM3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFGF2

GO:0000165

MAPK cascade

12244047


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A1L1-01AFGF2chr4

123748507

+FREM3chr4

144548913

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000264498ENST00000329798FGF2chr4

123748507

+FREM3chr4

144548913

-
5CDS-intronENST00000264498ENST00000508899FGF2chr4

123748507

+FREM3chr4

144548913

-
In-frameENST00000608478ENST00000329798FGF2chr4

123748507

+FREM3chr4

144548913

-
5CDS-intronENST00000608478ENST00000508899FGF2chr4

123748507

+FREM3chr4

144548913

-

Top

FusionProtFeatures for FGF2_FREM3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FGF2

P09038

FREM3

P0C091

Extracellular matrix protein which may play a role incell adhesion. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFGF2chr4:123748507chr4:144548913ENST00000264498+13179_181192289MotifCell attachment site%3B atypical
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-181764_186217582140DomainNote=Calx-beta 1
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-181875_198517582140DomainNote=Calx-beta 2
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-182000_210617582140DomainNote=Calx-beta 3

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFGF2chr4:123748507chr4:144548913ENST00000264498+13221_223192289MotifCell attachment site%3B atypical
HgeneFGF2chr4:123748507chr4:144548913ENST00000264498+13261_277192289RegionHeparin-binding
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-181069_117117582140RepeatCSPG 7
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-181192_128517582140RepeatCSPG 8
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-181306_140417582140RepeatCSPG 9
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-181425_151617582140RepeatCSPG 10
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-181536_162517582140RepeatCSPG 11
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-181659_175617582140RepeatCSPG 12
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-18306_40917582140RepeatCSPG 1
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-18432_52217582140RepeatCSPG 2
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-18543_67717582140RepeatCSPG 3
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-18702_80717582140RepeatCSPG 4
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-18828_92017582140RepeatCSPG 5
TgeneFREM3chr4:123748507chr4:144548913ENST00000329798-18948_104017582140RepeatCSPG 6


Top

FusionGeneSequence for FGF2_FREM3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FGF2_ENST00000264498_chr4_123748507_+_FREM3_ENST00000329798_chr4_144548913_-_574aa
LVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPG
GRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHRGNKLTNQPFHLNWAWICLEKEYYIVDEDSTFLEVTLTRRGYLGETSFISIGTKDETAKKDKDFKWKTNKQIQFNPGQ
TTATWRVRIIPDNETETSETFQIILSEPLMAVLEFPEMATVEIVDPGDESTVTIPEAEYKIEEDIGELLIPVRRSGDASQELIVICSTRQ
GSATGTISSTVLFSDYISRPEDHTSILHFDKNETQKTCQVLIIDDSLTEEEESFSVSLRLPVGGQLGARFPTTKVTILADRTDEPVLHFG
DAETHVNESARYVEVCVWRRGTDLSQPSSIAVRSRKSEQESAEAGTDTVGISRNLDFAPGVRMQTFQVTILDDLGQPTLEGPEKFELLLQ

>In-frame_FGF2_ENST00000608478_chr4_123748507_+_FREM3_ENST00000329798_chr4_144548913_-_441aa
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHRGNKLTNQPFHLNWAWICLEKEYYIVDEDST
FLEVTLTRRGYLGETSFISIGTKDETAKKDKDFKWKTNKQIQFNPGQTTATWRVRIIPDNETETSETFQIILSEPLMAVLEFPEMATVEI
VDPGDESTVTIPEAEYKIEEDIGELLIPVRRSGDASQELIVICSTRQGSATGTISSTVLFSDYISRPEDHTSILHFDKNETQKTCQVLII
DDSLTEEEESFSVSLRLPVGGQLGARFPTTKVTILADRTDEPVLHFGDAETHVNESARYVEVCVWRRGTDLSQPSSIAVRSRKSEQESAE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FGF2_ENST00000264498_chr4_123748507_+_FREM3_ENST00000329798_chr4_144548913_-_1722nt
CTGGTGGGTGTGGGGGGTGGAGATGTAGAAGATGTGACGCCGCGGCCCGGCGGGTGCCAGATTAGCGGACGCGGTGCCCGCGGTTGCAAC
GGGATCCCGGGCGCTGCAGCTTGGGAGGCGGCTCTCCCCAGGCGGCGTCCGCGGAGACACCCATCCGTGAACCCCAGGTCCCGGGCCGCC
GGCTCGCCGCGCACCAGGGGCCGGCGGACAGAAGAGCGGCCGAGCGGCTCGAGGCTGGGGGACCGCGGGCGCGGCCGCGCGCTGCCGGGC
GGGAGGCTGGGGGGCCGGGGCCGGGGCCGTGCCCCGGAGCGGGTCGGAGGCCGGGGCCGGGGCCGGGGGACGGCGGCTCCCCGCGCGGCT
CCAGCGGCTCGGGGATCCCGGCCGGGCCCCGCAGGGACCATGGCAGCCGGGAGCATCACCACGCTGCCCGCCTTGCCCGAGGATGGCGGC
AGCGGCGCCTTCCCGCCCGGCCACTTCAAGGACCCCAAGCGGCTGTACTGCAAAAACGGGGGCTTCTTCCTGCGCATCCACCCCGACGGC
CGAGTTGACGGGGTCCGGGAGAAGAGCGACCCTCACAGAGGAAATAAACTAACAAATCAGCCTTTCCATCTAAACTGGGCTTGGATTTGT
TTGGAGAAAGAGTACTACATTGTGGATGAAGATTCCACATTCTTAGAAGTGACCCTTACACGCAGAGGATACCTTGGAGAAACATCATTT
ATCAGCATTGGTACCAAAGATGAAACTGCAAAAAAAGACAAAGATTTCAAATGGAAGACCAATAAACAGATCCAGTTCAATCCTGGACAG
ACTACAGCCACATGGAGGGTGAGAATTATACCTGACAATGAATATGAGACTTCAGAGACCTTCCAGATCATTCTGTCTGAACCTCTCATG
GCTGTACTGGAGTTTCCAGAAATGGCAACGGTTGAAATTGTAGACCCTGGAGATGAATCAACAGTTTATATTCCAGAGGCGGAATACAAA
ATAGAAGAGGACATTGGGGAACTTTTGATTCCAGTAAGACGATCTGGAGATGCAAGCCAGGAACTAATCGTCATTTGCTCCACACGTCAA
GGTTCTGCCACAGGCACGATTTCTTCCACAGTGTTATTCTCTGATTACATCTCACGTCCAGAAGACCACACCAGCATCCTCCACTTTGAC
AAGAATGAGACACAGAAGACCTGCCAGGTCCTGATCATTGATGACTCCCTTTATGAAGAGGAGGAATCCTTCAGCGTTTCACTTAGGCTG
CCAGTGGGAGGACAGCTGGGAGCCAGATTCCCCACCACTAAGGTGACTATTCTGGCTGATCGTTATGATGAACCTGTCCTGCACTTTGGG
GATGCTGAATATCACGTCAATGAAAGTGCTCGCTACGTGGAGGTTTGTGTTTGGAGAAGAGGCACTGATCTTTCCCAACCATCATCCATC
GCCGTGCGCTCCAGAAAGTCAGAGCAGGAGTCAGCAGAAGCTGGAACAGATTATGTTGGTATCAGCCGAAACCTGGACTTTGCTCCAGGC
GTGCGCATGCAGACATTCCAAGTGACCATCCTTGATGACCTGGGACAGCCTACCTTGGAAGGCCCAGAGAAGTTTGAATTACTTCTTCAG
ATGCCTATGGGTGCAGTGCTTGGAGAACCAAATAAAACTACCATTTTCATCGAGGACACCATCACGGACTGTAAGCAGAGTGCTTGTAGT

>In-frame_FGF2_ENST00000608478_chr4_123748507_+_FREM3_ENST00000329798_chr4_144548913_-_1323nt
ATGGCAGCCGGGAGCATCACCACGCTGCCCGCCTTGCCCGAGGATGGCGGCAGCGGCGCCTTCCCGCCCGGCCACTTCAAGGACCCCAAG
CGGCTGTACTGCAAAAACGGGGGCTTCTTCCTGCGCATCCACCCCGACGGCCGAGTTGACGGGGTCCGGGAGAAGAGCGACCCTCACAGA
GGAAATAAACTAACAAATCAGCCTTTCCATCTAAACTGGGCTTGGATTTGTTTGGAGAAAGAGTACTACATTGTGGATGAAGATTCCACA
TTCTTAGAAGTGACCCTTACACGCAGAGGATACCTTGGAGAAACATCATTTATCAGCATTGGTACCAAAGATGAAACTGCAAAAAAAGAC
AAAGATTTCAAATGGAAGACCAATAAACAGATCCAGTTCAATCCTGGACAGACTACAGCCACATGGAGGGTGAGAATTATACCTGACAAT
GAATATGAGACTTCAGAGACCTTCCAGATCATTCTGTCTGAACCTCTCATGGCTGTACTGGAGTTTCCAGAAATGGCAACGGTTGAAATT
GTAGACCCTGGAGATGAATCAACAGTTTATATTCCAGAGGCGGAATACAAAATAGAAGAGGACATTGGGGAACTTTTGATTCCAGTAAGA
CGATCTGGAGATGCAAGCCAGGAACTAATCGTCATTTGCTCCACACGTCAAGGTTCTGCCACAGGCACGATTTCTTCCACAGTGTTATTC
TCTGATTACATCTCACGTCCAGAAGACCACACCAGCATCCTCCACTTTGACAAGAATGAGACACAGAAGACCTGCCAGGTCCTGATCATT
GATGACTCCCTTTATGAAGAGGAGGAATCCTTCAGCGTTTCACTTAGGCTGCCAGTGGGAGGACAGCTGGGAGCCAGATTCCCCACCACT
AAGGTGACTATTCTGGCTGATCGTTATGATGAACCTGTCCTGCACTTTGGGGATGCTGAATATCACGTCAATGAAAGTGCTCGCTACGTG
GAGGTTTGTGTTTGGAGAAGAGGCACTGATCTTTCCCAACCATCATCCATCGCCGTGCGCTCCAGAAAGTCAGAGCAGGAGTCAGCAGAA
GCTGGAACAGATTATGTTGGTATCAGCCGAAACCTGGACTTTGCTCCAGGCGTGCGCATGCAGACATTCCAAGTGACCATCCTTGATGAC
CTGGGACAGCCTACCTTGGAAGGCCCAGAGAAGTTTGAATTACTTCTTCAGATGCCTATGGGTGCAGTGCTTGGAGAACCAAATAAAACT


* Fusion transcript sequences (Full-length transcript).
>In-frame_FGF2_ENST00000264498_chr4_123748507_+_FREM3_ENST00000329798_chr4_144548913_-_2099nt
CGGCCCCAGAAAACCCGAGCGAGTAGGGGGCGGCGCGCAGGAGGGAGGAGAACTGGGGGCGCGGGAGGCTGGTGGGTGTGGGGGGTGGAG
ATGTAGAAGATGTGACGCCGCGGCCCGGCGGGTGCCAGATTAGCGGACGCGGTGCCCGCGGTTGCAACGGGATCCCGGGCGCTGCAGCTT
GGGAGGCGGCTCTCCCCAGGCGGCGTCCGCGGAGACACCCATCCGTGAACCCCAGGTCCCGGGCCGCCGGCTCGCCGCGCACCAGGGGCC
GGCGGACAGAAGAGCGGCCGAGCGGCTCGAGGCTGGGGGACCGCGGGCGCGGCCGCGCGCTGCCGGGCGGGAGGCTGGGGGGCCGGGGCC
GGGGCCGTGCCCCGGAGCGGGTCGGAGGCCGGGGCCGGGGCCGGGGGACGGCGGCTCCCCGCGCGGCTCCAGCGGCTCGGGGATCCCGGC
CGGGCCCCGCAGGGACCATGGCAGCCGGGAGCATCACCACGCTGCCCGCCTTGCCCGAGGATGGCGGCAGCGGCGCCTTCCCGCCCGGCC
ACTTCAAGGACCCCAAGCGGCTGTACTGCAAAAACGGGGGCTTCTTCCTGCGCATCCACCCCGACGGCCGAGTTGACGGGGTCCGGGAGA
AGAGCGACCCTCACAGAGGAAATAAACTAACAAATCAGCCTTTCCATCTAAACTGGGCTTGGATTTGTTTGGAGAAAGAGTACTACATTG
TGGATGAAGATTCCACATTCTTAGAAGTGACCCTTACACGCAGAGGATACCTTGGAGAAACATCATTTATCAGCATTGGTACCAAAGATG
AAACTGCAAAAAAAGACAAAGATTTCAAATGGAAGACCAATAAACAGATCCAGTTCAATCCTGGACAGACTACAGCCACATGGAGGGTGA
GAATTATACCTGACAATGAATATGAGACTTCAGAGACCTTCCAGATCATTCTGTCTGAACCTCTCATGGCTGTACTGGAGTTTCCAGAAA
TGGCAACGGTTGAAATTGTAGACCCTGGAGATGAATCAACAGTTTATATTCCAGAGGCGGAATACAAAATAGAAGAGGACATTGGGGAAC
TTTTGATTCCAGTAAGACGATCTGGAGATGCAAGCCAGGAACTAATCGTCATTTGCTCCACACGTCAAGGTTCTGCCACAGGCACGATTT
CTTCCACAGTGTTATTCTCTGATTACATCTCACGTCCAGAAGACCACACCAGCATCCTCCACTTTGACAAGAATGAGACACAGAAGACCT
GCCAGGTCCTGATCATTGATGACTCCCTTTATGAAGAGGAGGAATCCTTCAGCGTTTCACTTAGGCTGCCAGTGGGAGGACAGCTGGGAG
CCAGATTCCCCACCACTAAGGTGACTATTCTGGCTGATCGTTATGATGAACCTGTCCTGCACTTTGGGGATGCTGAATATCACGTCAATG
AAAGTGCTCGCTACGTGGAGGTTTGTGTTTGGAGAAGAGGCACTGATCTTTCCCAACCATCATCCATCGCCGTGCGCTCCAGAAAGTCAG
AGCAGGAGTCAGCAGAAGCTGGAACAGATTATGTTGGTATCAGCCGAAACCTGGACTTTGCTCCAGGCGTGCGCATGCAGACATTCCAAG
TGACCATCCTTGATGACCTGGGACAGCCTACCTTGGAAGGCCCAGAGAAGTTTGAATTACTTCTTCAGATGCCTATGGGTGCAGTGCTTG
GAGAACCAAATAAAACTACCATTTTCATCGAGGACACCATCACGGACTGTAAGCAGAGTGCTTGTAGTTCCTTTGATTGAAAGACTTTAA
GAGGGAAAAAAACAGCCAAGATATGTCTCCTAACAACAGAATGAAACTCTACTGTTTATAGATCTTAGCAATTCTGGGATATCAGTGATA
TTGTACTGTCATTGGTGTTATATTCTGGTGATATGTGGAAATGTAATTTATATGACTGCATGGAGATAGAAATATATATACCTAGAAAAC
ATTGAGCCCACAAATAATTAGACTGTGTTCATGTTCTTTTTCTATTTTGTTTTACTTTGTTTCTGAGGCAAGTAAGAAATCCACTGTGAT

>In-frame_FGF2_ENST00000608478_chr4_123748507_+_FREM3_ENST00000329798_chr4_144548913_-_1976nt
GCCAGATTAGCGGACGCGGTGCCCGCGGTTGCAACGGGATCCCGGGCGCTGCAGCTTGGGAGGCGGCTCTCCCCAGGCGGCGTCCGCGGA
GACACCCATCCGTGAACCCCAGGTCCCGGGCCGCCGGCTCGCCGCGCACCAGGGGCCGGCGGACAGAAGAGCGGCCGAGCGGCTCGAGGC
TGGGGGACCGCGGGCGCGGCCGCGCGCTGCCGGGCGGGAGGCTGGGGGGCCGGGGCCGGGGCCGTGCCCCGGAGCGGGTCGGAGGCCGGG
GCCGGGGCCGGGGGACGGCGGCTCCCCGCGCGGCTCCAGCGGCTCGGGGATCCCGGCCGGGCCCCGCAGGGACCATGGCAGCCGGGAGCA
TCACCACGCTGCCCGCCTTGCCCGAGGATGGCGGCAGCGGCGCCTTCCCGCCCGGCCACTTCAAGGACCCCAAGCGGCTGTACTGCAAAA
ACGGGGGCTTCTTCCTGCGCATCCACCCCGACGGCCGAGTTGACGGGGTCCGGGAGAAGAGCGACCCTCACAGAGGAAATAAACTAACAA
ATCAGCCTTTCCATCTAAACTGGGCTTGGATTTGTTTGGAGAAAGAGTACTACATTGTGGATGAAGATTCCACATTCTTAGAAGTGACCC
TTACACGCAGAGGATACCTTGGAGAAACATCATTTATCAGCATTGGTACCAAAGATGAAACTGCAAAAAAAGACAAAGATTTCAAATGGA
AGACCAATAAACAGATCCAGTTCAATCCTGGACAGACTACAGCCACATGGAGGGTGAGAATTATACCTGACAATGAATATGAGACTTCAG
AGACCTTCCAGATCATTCTGTCTGAACCTCTCATGGCTGTACTGGAGTTTCCAGAAATGGCAACGGTTGAAATTGTAGACCCTGGAGATG
AATCAACAGTTTATATTCCAGAGGCGGAATACAAAATAGAAGAGGACATTGGGGAACTTTTGATTCCAGTAAGACGATCTGGAGATGCAA
GCCAGGAACTAATCGTCATTTGCTCCACACGTCAAGGTTCTGCCACAGGCACGATTTCTTCCACAGTGTTATTCTCTGATTACATCTCAC
GTCCAGAAGACCACACCAGCATCCTCCACTTTGACAAGAATGAGACACAGAAGACCTGCCAGGTCCTGATCATTGATGACTCCCTTTATG
AAGAGGAGGAATCCTTCAGCGTTTCACTTAGGCTGCCAGTGGGAGGACAGCTGGGAGCCAGATTCCCCACCACTAAGGTGACTATTCTGG
CTGATCGTTATGATGAACCTGTCCTGCACTTTGGGGATGCTGAATATCACGTCAATGAAAGTGCTCGCTACGTGGAGGTTTGTGTTTGGA
GAAGAGGCACTGATCTTTCCCAACCATCATCCATCGCCGTGCGCTCCAGAAAGTCAGAGCAGGAGTCAGCAGAAGCTGGAACAGATTATG
TTGGTATCAGCCGAAACCTGGACTTTGCTCCAGGCGTGCGCATGCAGACATTCCAAGTGACCATCCTTGATGACCTGGGACAGCCTACCT
TGGAAGGCCCAGAGAAGTTTGAATTACTTCTTCAGATGCCTATGGGTGCAGTGCTTGGAGAACCAAATAAAACTACCATTTTCATCGAGG
ACACCATCACGGACTGTAAGCAGAGTGCTTGTAGTTCCTTTGATTGAAAGACTTTAAGAGGGAAAAAAACAGCCAAGATATGTCTCCTAA
CAACAGAATGAAACTCTACTGTTTATAGATCTTAGCAATTCTGGGATATCAGTGATATTGTACTGTCATTGGTGTTATATTCTGGTGATA
TGTGGAAATGTAATTTATATGACTGCATGGAGATAGAAATATATATACCTAGAAAACATTGAGCCCACAAATAATTAGACTGTGTTCATG


Top

FusionGenePPI for FGF2_FREM3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FGF2SDC1, SDC2, SDC4, CSNK2A1, CSNK2A2, CSNK2B, GPC3, RPS19, VTN, FGFBP1, SDC3, FGFR1, GPC4, RPL6, THBS1, CRYAB, PRMT1, TUBG1, TMEFF1, IFI16, COMT, FGFR2, PRKACA, CD44, TESFREM3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FGF2_FREM3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneFGF2P09038DB00364SucralfateFibroblast growth factor 2small moleculeapproved
HgeneFGF2P09038DB00686Pentosan PolysulfateFibroblast growth factor 2small moleculeapproved
HgeneFGF2P09038DB00877SirolimusFibroblast growth factor 2small moleculeapproved|investigational
HgeneFGF2P09038DB01109HeparinFibroblast growth factor 2small moleculeapproved|investigational

Top

RelatedDiseases for FGF2_FREM3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFGF2C0525045Mood Disorders3PSYGENET
HgeneFGF2C0151744Myocardial Ischemia2CTD_human
HgeneFGF2C0008924Cleft Lip1CTD_human
HgeneFGF2C0008925Cleft Palate1CTD_human
HgeneFGF2C0011581Depressive disorder1CTD_human
HgeneFGF2C0014549Tonic-Clonic Epilepsy1CTD_human
HgeneFGF2C0017638Glioma1CTD_human
HgeneFGF2C0017639Gliosis1CTD_human
HgeneFGF2C0018800Cardiomegaly1CTD_human
HgeneFGF2C0019284Diaphragmatic Hernia1CTD_human
HgeneFGF2C0021368Inflammation1CTD_human
HgeneFGF2C0022658Kidney Diseases1CTD_human
HgeneFGF2C0023890Liver Cirrhosis1CTD_human
HgeneFGF2C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneFGF2C0025500Mesothelioma1CTD_human
HgeneFGF2C0027726Nephrotic Syndrome1CTD_human
HgeneFGF2C0027746Nerve Degeneration1CTD_human
HgeneFGF2C0029172Oral Submucous Fibrosis1CTD_human
HgeneFGF2C0031030Periapical Periodontitis1CTD_human
HgeneFGF2C0033054Prenatal Exposure Delayed Effects1CTD_human
HgeneFGF2C0033578Prostatic Neoplasms1CTD_human
HgeneFGF2C0034069Pulmonary Fibrosis1CTD_human
HgeneFGF2C0035126Reperfusion Injury1CTD_human
HgeneFGF2C0036341Schizophrenia1PSYGENET
HgeneFGF2C0036572Seizures1CTD_human
HgeneFGF2C0040028Thrombocythemia, Essential1CTD_human
HgeneFGF2C0085109Corneal Neovascularization1CTD_human
HgeneFGF2C0085207Gestational Diabetes1CTD_human
HgeneFGF2C0236736Cocaine-Related Disorders1CTD_human
HgeneFGF2C0751955Brain Infarction1CTD_human
TgeneFREM3C1269683Major Depressive Disorder2CTD_human;PSYGENET
TgeneFREM3C0041696Unipolar Depression1PSYGENET