FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13200

FusionGeneSummary for FBXO9_CD74

check button Fusion gene summary
Fusion gene informationFusion gene name: FBXO9_CD74
Fusion gene ID: 13200
HgeneTgene
Gene symbol

FBXO9

CD74

Gene ID

26268

972

Gene nameF-box protein 9CD74 molecule
SynonymsFBX9|NY-REN-57|VCIA1|dJ341E18.2DHLAG|HLADG|II|Ia-GAMMA
Cytomap

6p12.1

5q33.1

Type of geneprotein-codingprotein-coding
DescriptionF-box only protein 9F-box protein Fbx9cross-immune reaction antigen 1renal carcinoma antigen NY-REN-57HLA class II histocompatibility antigen gamma chainCD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)CD74 molecule, major histocompatibility complex, class II invariant chainHLA-DR antigens-associated
Modification date2018052320180522
UniProtAcc

Q9UK97

P04233

Ensembl transtripts involved in fusion geneENST00000370939, ENST00000323557, 
ENST00000244426, ENST00000461222, 
ENST00000377795, ENST00000353334, 
ENST00000524315, ENST00000009530, 
Fusion gene scores* DoF score3 X 4 X 2=2416 X 15 X 5=1200
# samples 427
** MAII scorelog2(4/24*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(27/1200*10)=-2.15200309344505
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FBXO9 [Title/Abstract] AND CD74 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFBXO9

GO:0016567

protein ubiquitination

23263282

HgeneFBXO9

GO:0031146

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

23263282

TgeneCD74

GO:0001516

prostaglandin biosynthetic process

12782713

TgeneCD74

GO:0001934

positive regulation of protein phosphorylation

24942581

TgeneCD74

GO:0002792

negative regulation of peptide secretion

19849849

TgeneCD74

GO:0007165

signal transduction

12782713

TgeneCD74

GO:0008283

cell proliferation

12782713

TgeneCD74

GO:0033674

positive regulation of kinase activity

24942581

TgeneCD74

GO:0043066

negative regulation of apoptotic process

12782713

TgeneCD74

GO:0043123

positive regulation of I-kappaB kinase/NF-kappaB signaling

24942581

TgeneCD74

GO:0043410

positive regulation of MAPK cascade

24942581

TgeneCD74

GO:0043518

negative regulation of DNA damage response, signal transduction by p53 class mediator

17045821

TgeneCD74

GO:0045657

positive regulation of monocyte differentiation

24942581

TgeneCD74

GO:0045893

positive regulation of transcription, DNA-templated

24942581

TgeneCD74

GO:0046598

positive regulation of viral entry into host cell

24942581

TgeneCD74

GO:0050731

positive regulation of peptidyl-tyrosine phosphorylation

17045821

TgeneCD74

GO:0051290

protein heterotetramerization

24942581

TgeneCD74

GO:0070374

positive regulation of ERK1 and ERK2 cascade

17045821|24942581


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-64-1680-01AFBXO9chr6

52960462

+CD74chr5

149782188

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000370939ENST00000377795FBXO9chr6

52960462

+CD74chr5

149782188

-
Frame-shitENST00000370939ENST00000353334FBXO9chr6

52960462

+CD74chr5

149782188

-
5CDS-intronENST00000370939ENST00000524315FBXO9chr6

52960462

+CD74chr5

149782188

-
5CDS-intronENST00000370939ENST00000009530FBXO9chr6

52960462

+CD74chr5

149782188

-
In-frameENST00000323557ENST00000377795FBXO9chr6

52960462

+CD74chr5

149782188

-
Frame-shitENST00000323557ENST00000353334FBXO9chr6

52960462

+CD74chr5

149782188

-
5CDS-intronENST00000323557ENST00000524315FBXO9chr6

52960462

+CD74chr5

149782188

-
5CDS-intronENST00000323557ENST00000009530FBXO9chr6

52960462

+CD74chr5

149782188

-
In-frameENST00000244426ENST00000377795FBXO9chr6

52960462

+CD74chr5

149782188

-
Frame-shitENST00000244426ENST00000353334FBXO9chr6

52960462

+CD74chr5

149782188

-
5CDS-intronENST00000244426ENST00000524315FBXO9chr6

52960462

+CD74chr5

149782188

-
5CDS-intronENST00000244426ENST00000009530FBXO9chr6

52960462

+CD74chr5

149782188

-
intron-3CDSENST00000461222ENST00000377795FBXO9chr6

52960462

+CD74chr5

149782188

-
intron-3CDSENST00000461222ENST00000353334FBXO9chr6

52960462

+CD74chr5

149782188

-
intron-intronENST00000461222ENST00000524315FBXO9chr6

52960462

+CD74chr5

149782188

-
intron-intronENST00000461222ENST00000009530FBXO9chr6

52960462

+CD74chr5

149782188

-

Top

FusionProtFeatures for FBXO9_CD74


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FBXO9

Q9UK97

CD74

P04233

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediatesthe ubiquitination and subsequent proteasomal degradation of TTI1and TELO2 in a CK2-dependent manner, thereby directly regulatingmTOR signaling. SCF(FBXO9) recognizes and binds mTORC1-bound TTI1and TELO2 when they are phosphorylated by CK2 following growthfactor deprivation, leading to their degradation. In contrast, theSCF(FBXO9) does not mediate ubiquitination of TTI1 and TELO2 whenthey are part of the mTORC2 complex. As a consequence, mTORC1 isinactivated to restrain cell growth and protein translation, whilemTORC2 is activated due to the relief of feedback inhibition bymTORC1. {ECO:0000269|PubMed:23263282}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFBXO9chr6:52960462chr5:149782188ENST00000244426+1112185_236411448DomainF-box
HgeneFBXO9chr6:52960462chr5:149782188ENST00000323557+1213185_236401438DomainF-box
HgeneFBXO9chr6:52960462chr5:149782188ENST00000370939+1213185_236367404DomainF-box
HgeneFBXO9chr6:52960462chr5:149782188ENST00000244426+111294_127411448RepeatNote=TPR
HgeneFBXO9chr6:52960462chr5:149782188ENST00000323557+121394_127401438RepeatNote=TPR
HgeneFBXO9chr6:52960462chr5:149782188ENST00000370939+121394_127367404RepeatNote=TPR
TgeneCD74chr6:52960462chr5:149782188ENST00000353334-58210_271208233DomainThyroglobulin type-1
TgeneCD74chr6:52960462chr5:149782188ENST00000377795-36210_271147280DomainThyroglobulin type-1

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCD74chr6:52960462chr5:149782188ENST00000009530-69210_271272297DomainThyroglobulin type-1
TgeneCD74chr6:52960462chr5:149782188ENST00000009530-69103_117272297RegionNote=CLIP
TgeneCD74chr6:52960462chr5:149782188ENST00000353334-58103_117208233RegionNote=CLIP
TgeneCD74chr6:52960462chr5:149782188ENST00000377795-36103_117147280RegionNote=CLIP
TgeneCD74chr6:52960462chr5:149782188ENST00000009530-691_46272297Topological domainCytoplasmic
TgeneCD74chr6:52960462chr5:149782188ENST00000009530-6973_296272297Topological domainExtracellular
TgeneCD74chr6:52960462chr5:149782188ENST00000353334-581_46208233Topological domainCytoplasmic
TgeneCD74chr6:52960462chr5:149782188ENST00000353334-5873_296208233Topological domainExtracellular
TgeneCD74chr6:52960462chr5:149782188ENST00000377795-361_46147280Topological domainCytoplasmic
TgeneCD74chr6:52960462chr5:149782188ENST00000377795-3673_296147280Topological domainExtracellular
TgeneCD74chr6:52960462chr5:149782188ENST00000009530-6947_72272297TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneCD74chr6:52960462chr5:149782188ENST00000353334-5847_72208233TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneCD74chr6:52960462chr5:149782188ENST00000377795-3647_72147280TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for FBXO9_CD74


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FBXO9_ENST00000370939_chr6_52960462_+_CD74_ENST00000377795_chr5_149782188_-_381aa
MFRAQWMFELAPGVSSSNLENRPCRAARGSLQKTSADTKGKQEQAKEEKARELFLKAVEEEQNGALTEAIKFTRRAMQLVPDIEFKITTT
RSPDGDGVGNSYIEDNDDDSKMADLLSYFQQQLTFQESVLKLCQPELESSQIHISVLPMEVLMYIFRWVVSSDLDLRSLEQLSLVCRGFY
ICARDPEIWRLACLKVWGRSCIKLVPYTSWREMFLERPRVRFDGVTISKTTTIRQGEQSLDGFTRAWHQVETYRYIRFFPDGHVMMLTTP
EEPQSIVPRLRTRNTRTDAILLGHTRLSQDTDNQTKVFAVITKKKEEKPLDTKYRTFRRVPVQEADQSFHVGLQLCSSGHQRFNKLIWIH

>In-frame_FBXO9_ENST00000323557_chr6_52960462_+_CD74_ENST00000377795_chr5_149782188_-_415aa
MAEAEEDCHSDTVRADDDEENESPAETDLQAQLQMFRAQWMFELAPGVSSSNLENRPCRAARGSLQKTSADTKGKQEQAKEEKARELFLK
AVEEEQNGALTEAIKFTRRAMQLVPDIEFKITTTRSPDGDGVGNSYIEDNDDDSKMADLLSYFQQQLTFQESVLKLCQPELESSQIHISV
LPMEVLMYIFRWVVSSDLDLRSLEQLSLVCRGFYICARDPEIWRLACLKVWGRSCIKLVPYTSWREMFLERPRVRFDGVTISKTTTIRQG
EQSLDGFTRAWHQVETYRYIRFFPDGHVMMLTTPEEPQSIVPRLRTRNTRTDAILLGHTRLSQDTDNQTKVFAVITKKKEEKPLDTKYRT

>In-frame_FBXO9_ENST00000244426_chr6_52960462_+_CD74_ENST00000377795_chr5_149782188_-_425aa
MPDIIWVFPPQAEAEEDCHSDTVRADDDEENESPAETDLQAQLQMFRAQWMFELAPGVSSSNLENRPCRAARGSLQKTSADTKGKQEQAK
EEKARELFLKAVEEEQNGALTEAIKFTRRAMQLVPDIEFKITTTRSPDGDGVGNSYIEDNDDDSKMADLLSYFQQQLTFQESVLKLCQPE
LESSQIHISVLPMEVLMYIFRWVVSSDLDLRSLEQLSLVCRGFYICARDPEIWRLACLKVWGRSCIKLVPYTSWREMFLERPRVRFDGVT
ISKTTTIRQGEQSLDGFTRAWHQVETYRYIRFFPDGHVMMLTTPEEPQSIVPRLRTRNTRTDAILLGHTRLSQDTDNQTKVFAVITKKKE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FBXO9_ENST00000370939_chr6_52960462_+_CD74_ENST00000377795_chr5_149782188_-_1145nt
ATGTTCCGAGCTCAGTGGATGTTTGAACTTGCTCCAGGTGTAAGCTCTAGCAATTTAGAAAATCGACCTTGCAGAGCAGCAAGAGGCTCT
CTCCAGAAAACATCGGCAGATACCAAAGGAAAACAAGAACAGGCAAAAGAAGAAAAGGCTCGAGAACTCTTCCTAAAAGCAGTAGAAGAA
GAACAAAATGGAGCTCTCTATGAAGCCATCAAGTTTTATCGTAGGGCTATGCAACTTGTACCTGATATAGAGTTCAAGATTACTTATACC
CGGTCTCCAGATGGTGATGGCGTTGGAAACAGCTACATTGAAGATAATGATGATGACAGCAAAATGGCAGATCTCTTGTCCTACTTCCAG
CAGCAACTCACATTTCAGGAGTCTGTGCTTAAACTGTGTCAGCCTGAGCTTGAGAGCAGTCAGATTCACATATCAGTGCTGCCAATGGAG
GTCCTGATGTACATCTTCCGATGGGTGGTGTCTAGTGACTTGGACCTCAGATCATTGGAGCAGTTGTCGCTGGTGTGCAGAGGATTCTAC
ATCTGTGCCAGAGACCCTGAAATATGGCGTCTGGCCTGCTTGAAAGTTTGGGGCAGAAGCTGTATTAAACTTGTTCCGTACACGTCCTGG
AGAGAGATGTTTTTAGAACGGCCTCGTGTTCGGTTTGATGGCGTGTATATCAGTAAAACCACATATATTCGTCAAGGGGAACAGTCTCTT
GATGGTTTCTATAGAGCCTGGCACCAAGTGGAATATTACAGGTACATAAGATTCTTTCCTGATGGCCATGTGATGATGTTGACAACCCCT
GAAGAGCCTCAGTCCATTGTTCCACGTTTAAGAACTAGGAATACCAGGACTGATGCAATTCTACTGGGTCACTATCGCTTGTCACAAGAC
ACAGACAATCAGACCAAAGTATTTGCTGTAATAACTAAGAAAAAAGAAGAAAAACCACTTGACTATAAATACAGATATTTTCGTCGTGTC
CCTGTACAAGAAGCAGATCAGAGTTTTCATGTGGGGCTACAGCTATGTTCCAGTGGTCACCAGAGGTTCAACAAACTCATCTGGATACAT

>In-frame_FBXO9_ENST00000323557_chr6_52960462_+_CD74_ENST00000377795_chr5_149782188_-_1247nt
ATGGCAGAAGCTGAGGAAGATTGTCATTCTGATACTGTCAGAGCAGATGATGATGAAGAAAATGAAAGTCCTGCTGAAACAGATCTGCAG
GCACAACTCCAGATGTTCCGAGCTCAGTGGATGTTTGAACTTGCTCCAGGTGTAAGCTCTAGCAATTTAGAAAATCGACCTTGCAGAGCA
GCAAGAGGCTCTCTCCAGAAAACATCGGCAGATACCAAAGGAAAACAAGAACAGGCAAAAGAAGAAAAGGCTCGAGAACTCTTCCTAAAA
GCAGTAGAAGAAGAACAAAATGGAGCTCTCTATGAAGCCATCAAGTTTTATCGTAGGGCTATGCAACTTGTACCTGATATAGAGTTCAAG
ATTACTTATACCCGGTCTCCAGATGGTGATGGCGTTGGAAACAGCTACATTGAAGATAATGATGATGACAGCAAAATGGCAGATCTCTTG
TCCTACTTCCAGCAGCAACTCACATTTCAGGAGTCTGTGCTTAAACTGTGTCAGCCTGAGCTTGAGAGCAGTCAGATTCACATATCAGTG
CTGCCAATGGAGGTCCTGATGTACATCTTCCGATGGGTGGTGTCTAGTGACTTGGACCTCAGATCATTGGAGCAGTTGTCGCTGGTGTGC
AGAGGATTCTACATCTGTGCCAGAGACCCTGAAATATGGCGTCTGGCCTGCTTGAAAGTTTGGGGCAGAAGCTGTATTAAACTTGTTCCG
TACACGTCCTGGAGAGAGATGTTTTTAGAACGGCCTCGTGTTCGGTTTGATGGCGTGTATATCAGTAAAACCACATATATTCGTCAAGGG
GAACAGTCTCTTGATGGTTTCTATAGAGCCTGGCACCAAGTGGAATATTACAGGTACATAAGATTCTTTCCTGATGGCCATGTGATGATG
TTGACAACCCCTGAAGAGCCTCAGTCCATTGTTCCACGTTTAAGAACTAGGAATACCAGGACTGATGCAATTCTACTGGGTCACTATCGC
TTGTCACAAGACACAGACAATCAGACCAAAGTATTTGCTGTAATAACTAAGAAAAAAGAAGAAAAACCACTTGACTATAAATACAGATAT
TTTCGTCGTGTCCCTGTACAAGAAGCAGATCAGAGTTTTCATGTGGGGCTACAGCTATGTTCCAGTGGTCACCAGAGGTTCAACAAACTC

>In-frame_FBXO9_ENST00000244426_chr6_52960462_+_CD74_ENST00000377795_chr5_149782188_-_1277nt
ATGCCTGACATTATTTGGGTTTTCCCCCCTCAGGCAGAAGCTGAGGAAGATTGTCATTCTGATACTGTCAGAGCAGATGATGATGAAGAA
AATGAAAGTCCTGCTGAAACAGATCTGCAGGCACAACTCCAGATGTTCCGAGCTCAGTGGATGTTTGAACTTGCTCCAGGTGTAAGCTCT
AGCAATTTAGAAAATCGACCTTGCAGAGCAGCAAGAGGCTCTCTCCAGAAAACATCGGCAGATACCAAAGGAAAACAAGAACAGGCAAAA
GAAGAAAAGGCTCGAGAACTCTTCCTAAAAGCAGTAGAAGAAGAACAAAATGGAGCTCTCTATGAAGCCATCAAGTTTTATCGTAGGGCT
ATGCAACTTGTACCTGATATAGAGTTCAAGATTACTTATACCCGGTCTCCAGATGGTGATGGCGTTGGAAACAGCTACATTGAAGATAAT
GATGATGACAGCAAAATGGCAGATCTCTTGTCCTACTTCCAGCAGCAACTCACATTTCAGGAGTCTGTGCTTAAACTGTGTCAGCCTGAG
CTTGAGAGCAGTCAGATTCACATATCAGTGCTGCCAATGGAGGTCCTGATGTACATCTTCCGATGGGTGGTGTCTAGTGACTTGGACCTC
AGATCATTGGAGCAGTTGTCGCTGGTGTGCAGAGGATTCTACATCTGTGCCAGAGACCCTGAAATATGGCGTCTGGCCTGCTTGAAAGTT
TGGGGCAGAAGCTGTATTAAACTTGTTCCGTACACGTCCTGGAGAGAGATGTTTTTAGAACGGCCTCGTGTTCGGTTTGATGGCGTGTAT
ATCAGTAAAACCACATATATTCGTCAAGGGGAACAGTCTCTTGATGGTTTCTATAGAGCCTGGCACCAAGTGGAATATTACAGGTACATA
AGATTCTTTCCTGATGGCCATGTGATGATGTTGACAACCCCTGAAGAGCCTCAGTCCATTGTTCCACGTTTAAGAACTAGGAATACCAGG
ACTGATGCAATTCTACTGGGTCACTATCGCTTGTCACAAGACACAGACAATCAGACCAAAGTATTTGCTGTAATAACTAAGAAAAAAGAA
GAAAAACCACTTGACTATAAATACAGATATTTTCGTCGTGTCCCTGTACAAGAAGCAGATCAGAGTTTTCATGTGGGGCTACAGCTATGT
TCCAGTGGTCACCAGAGGTTCAACAAACTCATCTGGATACATCATTCTTGTCACATTACTTACAAAGTCACTGGAACTGGAGGACCCGTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_FBXO9_ENST00000370939_chr6_52960462_+_CD74_ENST00000377795_chr5_149782188_-_2090nt
CTCCAGTCTGTCTGTGCTCTCAAAAACTTTAGTCGTTATAACAACTGTGACTGTTGAGAAATTTCACTGTTTTCCTGCATTCCTGGCGCG
GGACTCTAGCCAGAGGCTCCGAGGACTTTGTAGCGACTGTCCCAAGCGTCCAGTTCGATGCTTCTCAGGGCGGCTTGCTTTAAGGGCCCA
CCCCTAAATTTGGGTTGTAAAAATTTTTGAGGCAGAAGCTGAGGAAGATTGTCATTCTGATACTGTCAGAGCAGATGATGATGAAGAAAA
TGAAAGTCCTGCTGAAACAGATCTGCAGGCACAACTCCAGATGTTCCGAGCTCAGTGGATGTTTGAACTTGCTCCAGGTGTAAGCTCTAG
CAATTTAGAAAATCGACCTTGCAGAGCAGCAAGAGGCTCTCTCCAGAAAACATCGGCAGATACCAAAGGAAAACAAGAACAGGCAAAAGA
AGAAAAGGCTCGAGAACTCTTCCTAAAAGCAGTAGAAGAAGAACAAAATGGAGCTCTCTATGAAGCCATCAAGTTTTATCGTAGGGCTAT
GCAACTTGTACCTGATATAGAGTTCAAGATTACTTATACCCGGTCTCCAGATGGTGATGGCGTTGGAAACAGCTACATTGAAGATAATGA
TGATGACAGCAAAATGGCAGATCTCTTGTCCTACTTCCAGCAGCAACTCACATTTCAGGAGTCTGTGCTTAAACTGTGTCAGCCTGAGCT
TGAGAGCAGTCAGATTCACATATCAGTGCTGCCAATGGAGGTCCTGATGTACATCTTCCGATGGGTGGTGTCTAGTGACTTGGACCTCAG
ATCATTGGAGCAGTTGTCGCTGGTGTGCAGAGGATTCTACATCTGTGCCAGAGACCCTGAAATATGGCGTCTGGCCTGCTTGAAAGTTTG
GGGCAGAAGCTGTATTAAACTTGTTCCGTACACGTCCTGGAGAGAGATGTTTTTAGAACGGCCTCGTGTTCGGTTTGATGGCGTGTATAT
CAGTAAAACCACATATATTCGTCAAGGGGAACAGTCTCTTGATGGTTTCTATAGAGCCTGGCACCAAGTGGAATATTACAGGTACATAAG
ATTCTTTCCTGATGGCCATGTGATGATGTTGACAACCCCTGAAGAGCCTCAGTCCATTGTTCCACGTTTAAGAACTAGGAATACCAGGAC
TGATGCAATTCTACTGGGTCACTATCGCTTGTCACAAGACACAGACAATCAGACCAAAGTATTTGCTGTAATAACTAAGAAAAAAGAAGA
AAAACCACTTGACTATAAATACAGATATTTTCGTCGTGTCCCTGTACAAGAAGCAGATCAGAGTTTTCATGTGGGGCTACAGCTATGTTC
CAGTGGTCACCAGAGGTTCAACAAACTCATCTGGATACATCATTCTTGTCACATTACTTACAAAGTCACTGGAACTGGAGGACCCGTCTT
CTGGGCTGGGTGTGACCAAGCAGGATCTGGGCCCAGTCCCCATGTGAGAGCAGCAGAGGCGGTCTTCAACATCCTGCCAGCCCCACACAG
CTACAGCTTTCTTGCTCCCTTCAGCCCCCAGCCCCTCCCCCATCTCCCACCCTGTACCTCATCCCATGAGACCCTGGTGCCTGGCTCTTT
CGTCACCCTTGGACAAGACAAACCAAGTCGGAACAGCAGATAACAATGCAGCAAGGCCCTGCTGCCCAATCTCCATCTGTCAACAGGGGC
GTGAGGTCCCAGGAAGTGGCCAAAAGCTAGACAGATCCCCGTTCCTGACATCACAGCAGCCTCCAACACAAGGCTCCAAGACCTAGGCTC
ATGGACGAGATGGGAAGGCACAGGGAGAAGGGATAACCCTACACCCAGACCCCAGGCTGGACATGCTGACTGTCCTCTCCCCTCCAGCCT
TTGGCCTTGGCTTTTCTAGCCTATTTACCTGCAGGCTGAGCCACTCTCTTCCCTTTCCCCAGCATCACTCCCCAAGGAAGAGCCAATGTT
TTCCACCCATAATCCTTTCTGCCGACCCCTAGTTCCCTCTGCTCAGCCAAGCTTGTTATCAGCTTTCAGGGCCATGGTTCACATTAGAAT

>In-frame_FBXO9_ENST00000323557_chr6_52960462_+_CD74_ENST00000377795_chr5_149782188_-_2213nt
GTCCGGGGTCTCCAGTAGGGCTGACGCTCCGGTGCTCGCACAATCCCCCGCCTCGGCTGGCAACGGGCGTCCCTCCACTCCCCGAGTCCC
CGGCAGCCGCCGCCACCCCAGCGCGCCCCGATCTGGCCCCCTGCCCCGCGAAGATGGCTGCCGTACGCCGGGCCCGCAGTTATTGCCGCT
GCCTGGTGCGCTTCTCCGACCGAGAACTCTGCTAAGCTCCGCTGCAGAGACAGGCAGGAGTAGACACCCGGACACCCAGCACCCCTCCTC
CGGGGGGCGGTGCAGAGGGGGCACGGAGAGCCCCTCGAGCGCAGCAGGCCGCCCCGCCAGCATGGCAGAAGCTGAGGAAGATTGTCATTC
TGATACTGTCAGAGCAGATGATGATGAAGAAAATGAAAGTCCTGCTGAAACAGATCTGCAGGCACAACTCCAGATGTTCCGAGCTCAGTG
GATGTTTGAACTTGCTCCAGGTGTAAGCTCTAGCAATTTAGAAAATCGACCTTGCAGAGCAGCAAGAGGCTCTCTCCAGAAAACATCGGC
AGATACCAAAGGAAAACAAGAACAGGCAAAAGAAGAAAAGGCTCGAGAACTCTTCCTAAAAGCAGTAGAAGAAGAACAAAATGGAGCTCT
CTATGAAGCCATCAAGTTTTATCGTAGGGCTATGCAACTTGTACCTGATATAGAGTTCAAGATTACTTATACCCGGTCTCCAGATGGTGA
TGGCGTTGGAAACAGCTACATTGAAGATAATGATGATGACAGCAAAATGGCAGATCTCTTGTCCTACTTCCAGCAGCAACTCACATTTCA
GGAGTCTGTGCTTAAACTGTGTCAGCCTGAGCTTGAGAGCAGTCAGATTCACATATCAGTGCTGCCAATGGAGGTCCTGATGTACATCTT
CCGATGGGTGGTGTCTAGTGACTTGGACCTCAGATCATTGGAGCAGTTGTCGCTGGTGTGCAGAGGATTCTACATCTGTGCCAGAGACCC
TGAAATATGGCGTCTGGCCTGCTTGAAAGTTTGGGGCAGAAGCTGTATTAAACTTGTTCCGTACACGTCCTGGAGAGAGATGTTTTTAGA
ACGGCCTCGTGTTCGGTTTGATGGCGTGTATATCAGTAAAACCACATATATTCGTCAAGGGGAACAGTCTCTTGATGGTTTCTATAGAGC
CTGGCACCAAGTGGAATATTACAGGTACATAAGATTCTTTCCTGATGGCCATGTGATGATGTTGACAACCCCTGAAGAGCCTCAGTCCAT
TGTTCCACGTTTAAGAACTAGGAATACCAGGACTGATGCAATTCTACTGGGTCACTATCGCTTGTCACAAGACACAGACAATCAGACCAA
AGTATTTGCTGTAATAACTAAGAAAAAAGAAGAAAAACCACTTGACTATAAATACAGATATTTTCGTCGTGTCCCTGTACAAGAAGCAGA
TCAGAGTTTTCATGTGGGGCTACAGCTATGTTCCAGTGGTCACCAGAGGTTCAACAAACTCATCTGGATACATCATTCTTGTCACATTAC
TTACAAAGTCACTGGAACTGGAGGACCCGTCTTCTGGGCTGGGTGTGACCAAGCAGGATCTGGGCCCAGTCCCCATGTGAGAGCAGCAGA
GGCGGTCTTCAACATCCTGCCAGCCCCACACAGCTACAGCTTTCTTGCTCCCTTCAGCCCCCAGCCCCTCCCCCATCTCCCACCCTGTAC
CTCATCCCATGAGACCCTGGTGCCTGGCTCTTTCGTCACCCTTGGACAAGACAAACCAAGTCGGAACAGCAGATAACAATGCAGCAAGGC
CCTGCTGCCCAATCTCCATCTGTCAACAGGGGCGTGAGGTCCCAGGAAGTGGCCAAAAGCTAGACAGATCCCCGTTCCTGACATCACAGC
AGCCTCCAACACAAGGCTCCAAGACCTAGGCTCATGGACGAGATGGGAAGGCACAGGGAGAAGGGATAACCCTACACCCAGACCCCAGGC
TGGACATGCTGACTGTCCTCTCCCCTCCAGCCTTTGGCCTTGGCTTTTCTAGCCTATTTACCTGCAGGCTGAGCCACTCTCTTCCCTTTC
CCCAGCATCACTCCCCAAGGAAGAGCCAATGTTTTCCACCCATAATCCTTTCTGCCGACCCCTAGTTCCCTCTGCTCAGCCAAGCTTGTT

>In-frame_FBXO9_ENST00000244426_chr6_52960462_+_CD74_ENST00000377795_chr5_149782188_-_2084nt
AGAGAATATGCTTTTCAGACTCATTTTCCTTTGGAAATTAATAGTAAGGTCTCAAGTGCCCCCTACAGCCTTGCTACTCAAAGTGGGTTC
CACAAAGTGTTGACAGTATGGTACTAAATAGAAAGTGGCTGAATGAGAAATGTAGATTGCAGAGGGCAACTGGTGTGTTTATATGCCTGA
CATTATTTGGGTTTTCCCCCCTCAGGCAGAAGCTGAGGAAGATTGTCATTCTGATACTGTCAGAGCAGATGATGATGAAGAAAATGAAAG
TCCTGCTGAAACAGATCTGCAGGCACAACTCCAGATGTTCCGAGCTCAGTGGATGTTTGAACTTGCTCCAGGTGTAAGCTCTAGCAATTT
AGAAAATCGACCTTGCAGAGCAGCAAGAGGCTCTCTCCAGAAAACATCGGCAGATACCAAAGGAAAACAAGAACAGGCAAAAGAAGAAAA
GGCTCGAGAACTCTTCCTAAAAGCAGTAGAAGAAGAACAAAATGGAGCTCTCTATGAAGCCATCAAGTTTTATCGTAGGGCTATGCAACT
TGTACCTGATATAGAGTTCAAGATTACTTATACCCGGTCTCCAGATGGTGATGGCGTTGGAAACAGCTACATTGAAGATAATGATGATGA
CAGCAAAATGGCAGATCTCTTGTCCTACTTCCAGCAGCAACTCACATTTCAGGAGTCTGTGCTTAAACTGTGTCAGCCTGAGCTTGAGAG
CAGTCAGATTCACATATCAGTGCTGCCAATGGAGGTCCTGATGTACATCTTCCGATGGGTGGTGTCTAGTGACTTGGACCTCAGATCATT
GGAGCAGTTGTCGCTGGTGTGCAGAGGATTCTACATCTGTGCCAGAGACCCTGAAATATGGCGTCTGGCCTGCTTGAAAGTTTGGGGCAG
AAGCTGTATTAAACTTGTTCCGTACACGTCCTGGAGAGAGATGTTTTTAGAACGGCCTCGTGTTCGGTTTGATGGCGTGTATATCAGTAA
AACCACATATATTCGTCAAGGGGAACAGTCTCTTGATGGTTTCTATAGAGCCTGGCACCAAGTGGAATATTACAGGTACATAAGATTCTT
TCCTGATGGCCATGTGATGATGTTGACAACCCCTGAAGAGCCTCAGTCCATTGTTCCACGTTTAAGAACTAGGAATACCAGGACTGATGC
AATTCTACTGGGTCACTATCGCTTGTCACAAGACACAGACAATCAGACCAAAGTATTTGCTGTAATAACTAAGAAAAAAGAAGAAAAACC
ACTTGACTATAAATACAGATATTTTCGTCGTGTCCCTGTACAAGAAGCAGATCAGAGTTTTCATGTGGGGCTACAGCTATGTTCCAGTGG
TCACCAGAGGTTCAACAAACTCATCTGGATACATCATTCTTGTCACATTACTTACAAAGTCACTGGAACTGGAGGACCCGTCTTCTGGGC
TGGGTGTGACCAAGCAGGATCTGGGCCCAGTCCCCATGTGAGAGCAGCAGAGGCGGTCTTCAACATCCTGCCAGCCCCACACAGCTACAG
CTTTCTTGCTCCCTTCAGCCCCCAGCCCCTCCCCCATCTCCCACCCTGTACCTCATCCCATGAGACCCTGGTGCCTGGCTCTTTCGTCAC
CCTTGGACAAGACAAACCAAGTCGGAACAGCAGATAACAATGCAGCAAGGCCCTGCTGCCCAATCTCCATCTGTCAACAGGGGCGTGAGG
TCCCAGGAAGTGGCCAAAAGCTAGACAGATCCCCGTTCCTGACATCACAGCAGCCTCCAACACAAGGCTCCAAGACCTAGGCTCATGGAC
GAGATGGGAAGGCACAGGGAGAAGGGATAACCCTACACCCAGACCCCAGGCTGGACATGCTGACTGTCCTCTCCCCTCCAGCCTTTGGCC
TTGGCTTTTCTAGCCTATTTACCTGCAGGCTGAGCCACTCTCTTCCCTTTCCCCAGCATCACTCCCCAAGGAAGAGCCAATGTTTTCCAC
CCATAATCCTTTCTGCCGACCCCTAGTTCCCTCTGCTCAGCCAAGCTTGTTATCAGCTTTCAGGGCCATGGTTCACATTAGAATAAAAGG


Top

FusionGenePPI for FBXO9_CD74


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FBXO9CALM1, CUL1, COPS5, HSP90AA1, GFOD1, SKP1, XPO1, EEF2CD74MIF, CD74, APP, HADHA, LAMTOR5, MAP3K1, TM4SF20, COPG1, COPG2, HLA-DPB1, HLA-DQA1, CD44


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FBXO9_CD74


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FBXO9_CD74


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFBXO9C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneCD74C0007131Non-Small Cell Lung Carcinoma1CTD_human
TgeneCD74C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneCD74C0162557Liver Failure, Acute1CTD_human
TgeneCD74C1458155Mammary Neoplasms1CTD_human