FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13128

FusionGeneSummary for FBXL5_RAB28

check button Fusion gene summary
Fusion gene informationFusion gene name: FBXL5_RAB28
Fusion gene ID: 13128
HgeneTgene
Gene symbol

FBXL5

RAB28

Gene ID

26234

9364

Gene nameF-box and leucine rich repeat protein 5RAB28, member RAS oncogene family
SynonymsFBL4|FBL5|FLR1CORD18
Cytomap

4p15.32

4p15.33

Type of geneprotein-codingprotein-coding
DescriptionF-box/LRR-repeat protein 5F-box protein FBL4/FBL5p45SKP2-like proteinras-related protein Rab-28
Modification date2018052320180526
UniProtAcc

Q9UKA1

P51157

Ensembl transtripts involved in fusion geneENST00000341285, ENST00000412094, 
ENST00000382358, ENST00000514541, 
ENST00000330852, ENST00000288723, 
ENST00000338176, 
Fusion gene scores* DoF score1 X 1 X 1=13 X 2 X 3=18
# samples 13
** MAII scorelog2(1/1*10)=3.32192809488736log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: FBXL5 [Title/Abstract] AND RAB28 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFBXL5

GO:0016567

protein ubiquitination

17532294|19762596|19762597

HgeneFBXL5

GO:0031146

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

17532294|19762596|19762597


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-M7-A724-01AFBXL5chr4

15656827

-RAB28chr4

13481150

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000341285ENST00000330852FBXL5chr4

15656827

-RAB28chr4

13481150

-
In-frameENST00000341285ENST00000288723FBXL5chr4

15656827

-RAB28chr4

13481150

-
In-frameENST00000341285ENST00000338176FBXL5chr4

15656827

-RAB28chr4

13481150

-
In-frameENST00000412094ENST00000330852FBXL5chr4

15656827

-RAB28chr4

13481150

-
In-frameENST00000412094ENST00000288723FBXL5chr4

15656827

-RAB28chr4

13481150

-
In-frameENST00000412094ENST00000338176FBXL5chr4

15656827

-RAB28chr4

13481150

-
5UTR-3CDSENST00000382358ENST00000330852FBXL5chr4

15656827

-RAB28chr4

13481150

-
5UTR-3CDSENST00000382358ENST00000288723FBXL5chr4

15656827

-RAB28chr4

13481150

-
5UTR-3CDSENST00000382358ENST00000338176FBXL5chr4

15656827

-RAB28chr4

13481150

-
intron-3CDSENST00000514541ENST00000330852FBXL5chr4

15656827

-RAB28chr4

13481150

-
intron-3CDSENST00000514541ENST00000288723FBXL5chr4

15656827

-RAB28chr4

13481150

-
intron-3CDSENST00000514541ENST00000338176FBXL5chr4

15656827

-RAB28chr4

13481150

-

Top

FusionProtFeatures for FBXL5_RAB28


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FBXL5

Q9UKA1

RAB28

P51157


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRAB28chr4:15656827chr4:13481150ENST00000288723-0841_4925432MotifEffector region
TgeneRAB28chr4:15656827chr4:13481150ENST00000330852-0741_4925222MotifEffector region
TgeneRAB28chr4:15656827chr4:13481150ENST00000338176-0841_4925409MotifEffector region
TgeneRAB28chr4:15656827chr4:13481150ENST00000288723-08129_13225432Nucleotide bindingGTP
TgeneRAB28chr4:15656827chr4:13481150ENST00000288723-08159_16125432Nucleotide bindingGTP
TgeneRAB28chr4:15656827chr4:13481150ENST00000288723-0868_7225432Nucleotide bindingGTP
TgeneRAB28chr4:15656827chr4:13481150ENST00000330852-07129_13225222Nucleotide bindingGTP
TgeneRAB28chr4:15656827chr4:13481150ENST00000330852-07159_16125222Nucleotide bindingGTP
TgeneRAB28chr4:15656827chr4:13481150ENST00000330852-0768_7225222Nucleotide bindingGTP
TgeneRAB28chr4:15656827chr4:13481150ENST00000338176-08129_13225409Nucleotide bindingGTP
TgeneRAB28chr4:15656827chr4:13481150ENST00000338176-08159_16125409Nucleotide bindingGTP
TgeneRAB28chr4:15656827chr4:13481150ENST00000338176-0868_7225409Nucleotide bindingGTP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFBXL5chr4:15656827chr4:13481150ENST00000341285-111202_24828692DomainF-box
HgeneFBXL5chr4:15656827chr4:13481150ENST00000382358-112202_248-133566DomainF-box
HgeneFBXL5chr4:15656827chr4:13481150ENST00000412094-111202_24828675DomainF-box
HgeneFBXL5chr4:15656827chr4:13481150ENST00000341285-1111_15928692RegionNote=Hemerythrin-like
HgeneFBXL5chr4:15656827chr4:13481150ENST00000382358-1121_159-133566RegionNote=Hemerythrin-like
HgeneFBXL5chr4:15656827chr4:13481150ENST00000412094-1111_15928675RegionNote=Hemerythrin-like
HgeneFBXL5chr4:15656827chr4:13481150ENST00000341285-111340_36428692RepeatNote=LRR 1
HgeneFBXL5chr4:15656827chr4:13481150ENST00000341285-111365_39228692RepeatNote=LRR 2
HgeneFBXL5chr4:15656827chr4:13481150ENST00000341285-111393_41828692RepeatNote=LRR 3
HgeneFBXL5chr4:15656827chr4:13481150ENST00000341285-111479_50828692RepeatNote=LRR 4
HgeneFBXL5chr4:15656827chr4:13481150ENST00000341285-111576_60728692RepeatNote=LRR 5
HgeneFBXL5chr4:15656827chr4:13481150ENST00000341285-111608_63528692RepeatNote=LRR 6
HgeneFBXL5chr4:15656827chr4:13481150ENST00000341285-111636_66128692RepeatNote=LRR 7
HgeneFBXL5chr4:15656827chr4:13481150ENST00000382358-112340_364-133566RepeatNote=LRR 1
HgeneFBXL5chr4:15656827chr4:13481150ENST00000382358-112365_392-133566RepeatNote=LRR 2
HgeneFBXL5chr4:15656827chr4:13481150ENST00000382358-112393_418-133566RepeatNote=LRR 3
HgeneFBXL5chr4:15656827chr4:13481150ENST00000382358-112479_508-133566RepeatNote=LRR 4
HgeneFBXL5chr4:15656827chr4:13481150ENST00000382358-112576_607-133566RepeatNote=LRR 5
HgeneFBXL5chr4:15656827chr4:13481150ENST00000382358-112608_635-133566RepeatNote=LRR 6
HgeneFBXL5chr4:15656827chr4:13481150ENST00000382358-112636_661-133566RepeatNote=LRR 7
HgeneFBXL5chr4:15656827chr4:13481150ENST00000412094-111340_36428675RepeatNote=LRR 1
HgeneFBXL5chr4:15656827chr4:13481150ENST00000412094-111365_39228675RepeatNote=LRR 2
HgeneFBXL5chr4:15656827chr4:13481150ENST00000412094-111393_41828675RepeatNote=LRR 3
HgeneFBXL5chr4:15656827chr4:13481150ENST00000412094-111479_50828675RepeatNote=LRR 4
HgeneFBXL5chr4:15656827chr4:13481150ENST00000412094-111576_60728675RepeatNote=LRR 5
HgeneFBXL5chr4:15656827chr4:13481150ENST00000412094-111608_63528675RepeatNote=LRR 6
HgeneFBXL5chr4:15656827chr4:13481150ENST00000412094-111636_66128675RepeatNote=LRR 7
TgeneRAB28chr4:15656827chr4:13481150ENST00000288723-0819_2725432Nucleotide bindingGTP
TgeneRAB28chr4:15656827chr4:13481150ENST00000330852-0719_2725222Nucleotide bindingGTP
TgeneRAB28chr4:15656827chr4:13481150ENST00000338176-0819_2725409Nucleotide bindingGTP


Top

FusionGeneSequence for FBXL5_RAB28


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FBXL5_ENST00000341285_chr4_15656827_-_RAB28_ENST00000330852_chr4_13481150_-_225aa
MAPFPEEVDVFTAPHWRMKQLVGLYCDKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQ
GVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEI

>In-frame_FBXL5_ENST00000341285_chr4_15656827_-_RAB28_ENST00000288723_chr4_13481150_-_28aa

>In-frame_FBXL5_ENST00000341285_chr4_15656827_-_RAB28_ENST00000338176_chr4_13481150_-_28aa

>In-frame_FBXL5_ENST00000412094_chr4_15656827_-_RAB28_ENST00000330852_chr4_13481150_-_225aa
MAPFPEEVDVFTAPHWRMKQLVGLYCDKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQ
GVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEI

>In-frame_FBXL5_ENST00000412094_chr4_15656827_-_RAB28_ENST00000288723_chr4_13481150_-_28aa

>In-frame_FBXL5_ENST00000412094_chr4_15656827_-_RAB28_ENST00000338176_chr4_13481150_-_28aa


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FBXL5_ENST00000341285_chr4_15656827_-_RAB28_ENST00000330852_chr4_13481150_-_675nt
ATGGCGCCCTTTCCTGAAGAAGTGGACGTCTTCACCGCCCCACACTGGCGGATGAAGCAGCTGGTGGGGCTCTACTGCGACAAGACCTCC
TTAACTACGTGTTTTGCTCAAGAAACTTTTGGGAAACAGTACAAACAAACTATAGGACTGGATTTCTTTTTGAGAAGGATAACATTGCCA
GGAAACTTGAATGTTACCCTTCAAATTTGGGATATAGGAGGGCAGACAATAGGAGGCAAAATGTTGGATAAATATATCTATGGAGCACAG
GGAGTCCTCTTGGTATATGATATTACAAATTATCAAAGCTTTGAGAATTTAGAAGATTGGTATACTGTGGTGAAGAAAGTGAGCGAGGAG
TCAGAAACTCAGCCACTGGTTGCCTTGGTAGGCAATAAAATTGATTTGGAGCATATGCGAACAATAAAACCTGAAAAACACTTACGGTTT
TGCCAGGAAAATGGTTTTAGTAGCCACTTTGTCTCAGCCAAGACAGGAGACTCTGTCTTCCTGTGCTTTCAGAAAGTTGCTGCTGAAATC
CTTGGGATCAAATTAAACAAAGCAGAAATAGAACAGTCACAGAGGGTGGTGAAGGCAGATATTGTAAACTACAACCAGGAACCTATGTCA

>In-frame_FBXL5_ENST00000341285_chr4_15656827_-_RAB28_ENST00000288723_chr4_13481150_-_84nt

>In-frame_FBXL5_ENST00000341285_chr4_15656827_-_RAB28_ENST00000338176_chr4_13481150_-_84nt

>In-frame_FBXL5_ENST00000412094_chr4_15656827_-_RAB28_ENST00000330852_chr4_13481150_-_675nt
ATGGCGCCCTTTCCTGAAGAAGTGGACGTCTTCACCGCCCCACACTGGCGGATGAAGCAGCTGGTGGGGCTCTACTGCGACAAGACCTCC
TTAACTACGTGTTTTGCTCAAGAAACTTTTGGGAAACAGTACAAACAAACTATAGGACTGGATTTCTTTTTGAGAAGGATAACATTGCCA
GGAAACTTGAATGTTACCCTTCAAATTTGGGATATAGGAGGGCAGACAATAGGAGGCAAAATGTTGGATAAATATATCTATGGAGCACAG
GGAGTCCTCTTGGTATATGATATTACAAATTATCAAAGCTTTGAGAATTTAGAAGATTGGTATACTGTGGTGAAGAAAGTGAGCGAGGAG
TCAGAAACTCAGCCACTGGTTGCCTTGGTAGGCAATAAAATTGATTTGGAGCATATGCGAACAATAAAACCTGAAAAACACTTACGGTTT
TGCCAGGAAAATGGTTTTAGTAGCCACTTTGTCTCAGCCAAGACAGGAGACTCTGTCTTCCTGTGCTTTCAGAAAGTTGCTGCTGAAATC
CTTGGGATCAAATTAAACAAAGCAGAAATAGAACAGTCACAGAGGGTGGTGAAGGCAGATATTGTAAACTACAACCAGGAACCTATGTCA

>In-frame_FBXL5_ENST00000412094_chr4_15656827_-_RAB28_ENST00000288723_chr4_13481150_-_84nt

>In-frame_FBXL5_ENST00000412094_chr4_15656827_-_RAB28_ENST00000338176_chr4_13481150_-_84nt


* Fusion transcript sequences (Full-length transcript).
>In-frame_FBXL5_ENST00000341285_chr4_15656827_-_RAB28_ENST00000330852_chr4_13481150_-_1634nt
ACCGGGCGCGCGCGCCGACGGGGCGGGCGCATGCGCAAGGGGGCGCGCCGCCTCTGCCCCGCGGCGAGGGTGTCTATGGAGAGGCGGCGG
CCGCGGCTGCTGAGGCGGAGGCTGAGGCAGTGGCGATGGCGCCCTTTCCTGAAGAAGTGGACGTCTTCACCGCCCCACACTGGCGGATGA
AGCAGCTGGTGGGGCTCTACTGCGACAAGACCTCCTTAACTACGTGTTTTGCTCAAGAAACTTTTGGGAAACAGTACAAACAAACTATAG
GACTGGATTTCTTTTTGAGAAGGATAACATTGCCAGGAAACTTGAATGTTACCCTTCAAATTTGGGATATAGGAGGGCAGACAATAGGAG
GCAAAATGTTGGATAAATATATCTATGGAGCACAGGGAGTCCTCTTGGTATATGATATTACAAATTATCAAAGCTTTGAGAATTTAGAAG
ATTGGTATACTGTGGTGAAGAAAGTGAGCGAGGAGTCAGAAACTCAGCCACTGGTTGCCTTGGTAGGCAATAAAATTGATTTGGAGCATA
TGCGAACAATAAAACCTGAAAAACACTTACGGTTTTGCCAGGAAAATGGTTTTAGTAGCCACTTTGTCTCAGCCAAGACAGGAGACTCTG
TCTTCCTGTGCTTTCAGAAAGTTGCTGCTGAAATCCTTGGGATCAAATTAAACAAAGCAGAAATAGAACAGTCACAGAGGGTGGTGAAGG
CAGATATTGTAAACTACAACCAGGAACCTATGTCAAGGACTGTTAACCCTCCTAGAAGCTCTATGTGTGCAGTTCAGTGAGCGCATTTTT
CTTTTGTGTTGATAGTTCTGGCTGCCCTTCACCTCTGGGTGGGCCCGAGGACTTCTAGGAACTTGTTTTATCAGTGACCATCTCTGTAGT
TCAGTTAACACTTTACTCCCAACTTGCTTCATCATTGCTATTGCCTCACAGTGGCAGGCAGCTCCTTGGATTTGAAAGAATTCAACTTTG
GGACCACACACTTTGAATTCAAAATGGAAAACCCATTCCCTGGAATTAGACTGCTTCATTGCAAAAGAATGATGTTGTTTCTTTGTATGT
CCTTGCTTCTTTTTTCATTGATGTAAATTTTTTTAACTTAATATGAAAACTCTCCAAGTCTTGATCATCAGCCAGGATTTTGCCACAGCA
ATTTCATTCTCTTATCGGAACTTGTATGTGTCAAAGTATACTTCAGAGTGCAAACATTAAGCAAGTAATATATTTTACCTACAGATACTT
ATGAAGACATTCTTTCGCTATCGTGAGTAAAAGTATATAAAGCTGTTTCTAACTGAAAATGCTTGAAATAAGCCTGTAATAGAAATATTT
TTTCATTTTTTAAAAAAGGGCCTAAATTGTTTATATTGTAGTTTGTAACTCACAAAGTAATATTTGATATTGTATTTTTATTACTGTATC
GTTGTCGTTATGTATTGTGTAATACTCAGGTTTGAAGGCTTTCTGAATTCTGATAAATGTTCAGCTGATGCTCCACGTGGAATTTCTCTT
GCAAACTGCATAAGAGTACTCCCGAGAATGAGTTATGACATTGTGGATCAGACTGTACCTGATGTTCAGATGTTTTTCTTTCACAAATAA

>In-frame_FBXL5_ENST00000341285_chr4_15656827_-_RAB28_ENST00000288723_chr4_13481150_-_1729nt
ACCGGGCGCGCGCGCCGACGGGGCGGGCGCATGCGCAAGGGGGCGCGCCGCCTCTGCCCCGCGGCGAGGGTGTCTATGGAGAGGCGGCGG
CCGCGGCTGCTGAGGCGGAGGCTGAGGCAGTGGCGATGGCGCCCTTTCCTGAAGAAGTGGACGTCTTCACCGCCCCACACTGGCGGATGA
AGCAGCTGGTGGGGCTCTACTGCGACAAGACCTCCTTAACTACGTGTTTTGCTCAAGAAACTTTTGGGAAACAGTACAAACAAACTATAG
GACTGGATTTCTTTTTGAGAAGGATAACATTGCCAGGAAACTTGAATGTTACCCTTCAAATTTGGGATATAGGAGGGCAGACAATAGGAG
GCAAAATGTTGGATAAATATATCTATGGAGCACAGGGAGTCCTCTTGGTATATGATATTACAAATTATCAAAGCTTTGAGAATTTAGAAG
ATTGGTATACTGTGGTGAAGAAAGTGAGCGAGGAGTCAGAAACTCAGCCACTGGTTGCCTTGGTAGGCAATAAAATTGATTTGGAGCATA
TGCGAACAATAAAACCTGAAAAACACTTACGGTTTTGCCAGGAAAATGGTTTTAGTAGCCACTTTGTCTCAGCCAAGACAGGAGACTCTG
TCTTCCTGTGCTTTCAGAAAGTTGCTGCTGAAATCCTTGGGATCAAATTAAACAAAGCAGAAATAGAACAGTCACAGCGTATTGTCAGGG
CAGAAATAGTGAAGTACCCGGAAGAAGAAAATCAACATACCACCTCTACTCAGAGTAGAATCTGTTCAGTACAGTAGTGCAGAGGGTGGT
GAAGGCAGATATTGTAAACTACAACCAGGAACCTATGTCAAGGACTGTTAACCCTCCTAGAAGCTCTATGTGTGCAGTTCAGTGAGCGCA
TTTTTCTTTTGTGTTGATAGTTCTGGCTGCCCTTCACCTCTGGGTGGGCCCGAGGACTTCTAGGAACTTGTTTTATCAGTGACCATCTCT
GTAGTTCAGTTAACACTTTACTCCCAACTTGCTTCATCATTGCTATTGCCTCACAGTGGCAGGCAGCTCCTTGGATTTGAAAGAATTCAA
CTTTGGGACCACACACTTTGAATTCAAAATGGAAAACCCATTCCCTGGAATTAGACTGCTTCATTGCAAAAGAATGATGTTGTTTCTTTG
TATGTCCTTGCTTCTTTTTTCATTGATGTAAATTTTTTTAACTTAATATGAAAACTCTCCAAGTCTTGATCATCAGCCAGGATTTTGCCA
CAGCAATTTCATTCTCTTATCGGAACTTGTATGTGTCAAAGTATACTTCAGAGTGCAAACATTAAGCAAGTAATATATTTTACCTACAGA
TACTTATGAAGACATTCTTTCGCTATCGTGAGTAAAAGTATATAAAGCTGTTTCTAACTGAAAATGCTTGAAATAAGCCTGTAATAGAAA
TATTTTTTCATTTTTTAAAAAAGGGCCTAAATTGTTTATATTGTAGTTTGTAACTCACAAAGTAATATTTGATATTGTATTTTTATTACT
GTATCGTTGTCGTTATGTATTGTGTAATACTCAGGTTTGAAGGCTTTCTGAATTCTGATAAATGTTCAGCTGATGCTCCACGTGGAATTT
CTCTTGCAAACTGCATAAGAGTACTCCCGAGAATGAGTTATGACATTGTGGATCAGACTGTACCTGATGTTCAGATGTTTTTCTTTCACA

>In-frame_FBXL5_ENST00000341285_chr4_15656827_-_RAB28_ENST00000338176_chr4_13481150_-_1706nt
ACCGGGCGCGCGCGCCGACGGGGCGGGCGCATGCGCAAGGGGGCGCGCCGCCTCTGCCCCGCGGCGAGGGTGTCTATGGAGAGGCGGCGG
CCGCGGCTGCTGAGGCGGAGGCTGAGGCAGTGGCGATGGCGCCCTTTCCTGAAGAAGTGGACGTCTTCACCGCCCCACACTGGCGGATGA
AGCAGCTGGTGGGGCTCTACTGCGACAAGACCTCCTTAACTACGTGTTTTGCTCAAGAAACTTTTGGGAAACAGTACAAACAAACTATAG
GACTGGATTTCTTTTTGAGAAGGATAACATTGCCAGGAAACTTGAATGTTACCCTTCAAATTTGGGATATAGGAGGGCAGACAATAGGAG
GCAAAATGTTGGATAAATATATCTATGGAGCACAGGGAGTCCTCTTGGTATATGATATTACAAATTATCAAAGCTTTGAGAATTTAGAAG
ATTGGTATACTGTGGTGAAGAAAGTGAGCGAGGAGTCAGAAACTCAGCCACTGGTTGCCTTGGTAGGCAATAAAATTGATTTGGAGCATA
TGCGAACAATAAAACCTGAAAAACACTTACGGTTTTGCCAGGAAAATGGTTTTAGTAGCCACTTTGTCTCAGCCAAGACAGGAGACTCTG
TCTTCCTGTGCTTTCAGAAAGTTGCTGCTGAAATCCTTGGGATCAAATTAAACAAAGCAGAAATAGAACAGTCACAGGGCCATTTCATTA
TTTTCATTTCATCAACTAATAGAGAATAATCGAGTGTGCTTTGTGGCTCTAAAAATAAAGAGGGTGGTGAAGGCAGATATTGTAAACTAC
AACCAGGAACCTATGTCAAGGACTGTTAACCCTCCTAGAAGCTCTATGTGTGCAGTTCAGTGAGCGCATTTTTCTTTTGTGTTGATAGTT
CTGGCTGCCCTTCACCTCTGGGTGGGCCCGAGGACTTCTAGGAACTTGTTTTATCAGTGACCATCTCTGTAGTTCAGTTAACACTTTACT
CCCAACTTGCTTCATCATTGCTATTGCCTCACAGTGGCAGGCAGCTCCTTGGATTTGAAAGAATTCAACTTTGGGACCACACACTTTGAA
TTCAAAATGGAAAACCCATTCCCTGGAATTAGACTGCTTCATTGCAAAAGAATGATGTTGTTTCTTTGTATGTCCTTGCTTCTTTTTTCA
TTGATGTAAATTTTTTTAACTTAATATGAAAACTCTCCAAGTCTTGATCATCAGCCAGGATTTTGCCACAGCAATTTCATTCTCTTATCG
GAACTTGTATGTGTCAAAGTATACTTCAGAGTGCAAACATTAAGCAAGTAATATATTTTACCTACAGATACTTATGAAGACATTCTTTCG
CTATCGTGAGTAAAAGTATATAAAGCTGTTTCTAACTGAAAATGCTTGAAATAAGCCTGTAATAGAAATATTTTTTCATTTTTTAAAAAA
GGGCCTAAATTGTTTATATTGTAGTTTGTAACTCACAAAGTAATATTTGATATTGTATTTTTATTACTGTATCGTTGTCGTTATGTATTG
TGTAATACTCAGGTTTGAAGGCTTTCTGAATTCTGATAAATGTTCAGCTGATGCTCCACGTGGAATTTCTCTTGCAAACTGCATAAGAGT

>In-frame_FBXL5_ENST00000412094_chr4_15656827_-_RAB28_ENST00000330852_chr4_13481150_-_1604nt
ATGCGCAAGGGGGCGCGCCGCCTCTGCCCCGCGGCGAGGGTGTCTATGGAGAGGCGGCGGCCGCGGCTGCTGAGGCGGAGGCTGAGGCAG
TGGCGATGGCGCCCTTTCCTGAAGAAGTGGACGTCTTCACCGCCCCACACTGGCGGATGAAGCAGCTGGTGGGGCTCTACTGCGACAAGA
CCTCCTTAACTACGTGTTTTGCTCAAGAAACTTTTGGGAAACAGTACAAACAAACTATAGGACTGGATTTCTTTTTGAGAAGGATAACAT
TGCCAGGAAACTTGAATGTTACCCTTCAAATTTGGGATATAGGAGGGCAGACAATAGGAGGCAAAATGTTGGATAAATATATCTATGGAG
CACAGGGAGTCCTCTTGGTATATGATATTACAAATTATCAAAGCTTTGAGAATTTAGAAGATTGGTATACTGTGGTGAAGAAAGTGAGCG
AGGAGTCAGAAACTCAGCCACTGGTTGCCTTGGTAGGCAATAAAATTGATTTGGAGCATATGCGAACAATAAAACCTGAAAAACACTTAC
GGTTTTGCCAGGAAAATGGTTTTAGTAGCCACTTTGTCTCAGCCAAGACAGGAGACTCTGTCTTCCTGTGCTTTCAGAAAGTTGCTGCTG
AAATCCTTGGGATCAAATTAAACAAAGCAGAAATAGAACAGTCACAGAGGGTGGTGAAGGCAGATATTGTAAACTACAACCAGGAACCTA
TGTCAAGGACTGTTAACCCTCCTAGAAGCTCTATGTGTGCAGTTCAGTGAGCGCATTTTTCTTTTGTGTTGATAGTTCTGGCTGCCCTTC
ACCTCTGGGTGGGCCCGAGGACTTCTAGGAACTTGTTTTATCAGTGACCATCTCTGTAGTTCAGTTAACACTTTACTCCCAACTTGCTTC
ATCATTGCTATTGCCTCACAGTGGCAGGCAGCTCCTTGGATTTGAAAGAATTCAACTTTGGGACCACACACTTTGAATTCAAAATGGAAA
ACCCATTCCCTGGAATTAGACTGCTTCATTGCAAAAGAATGATGTTGTTTCTTTGTATGTCCTTGCTTCTTTTTTCATTGATGTAAATTT
TTTTAACTTAATATGAAAACTCTCCAAGTCTTGATCATCAGCCAGGATTTTGCCACAGCAATTTCATTCTCTTATCGGAACTTGTATGTG
TCAAAGTATACTTCAGAGTGCAAACATTAAGCAAGTAATATATTTTACCTACAGATACTTATGAAGACATTCTTTCGCTATCGTGAGTAA
AAGTATATAAAGCTGTTTCTAACTGAAAATGCTTGAAATAAGCCTGTAATAGAAATATTTTTTCATTTTTTAAAAAAGGGCCTAAATTGT
TTATATTGTAGTTTGTAACTCACAAAGTAATATTTGATATTGTATTTTTATTACTGTATCGTTGTCGTTATGTATTGTGTAATACTCAGG
TTTGAAGGCTTTCTGAATTCTGATAAATGTTCAGCTGATGCTCCACGTGGAATTTCTCTTGCAAACTGCATAAGAGTACTCCCGAGAATG

>In-frame_FBXL5_ENST00000412094_chr4_15656827_-_RAB28_ENST00000288723_chr4_13481150_-_1699nt
ATGCGCAAGGGGGCGCGCCGCCTCTGCCCCGCGGCGAGGGTGTCTATGGAGAGGCGGCGGCCGCGGCTGCTGAGGCGGAGGCTGAGGCAG
TGGCGATGGCGCCCTTTCCTGAAGAAGTGGACGTCTTCACCGCCCCACACTGGCGGATGAAGCAGCTGGTGGGGCTCTACTGCGACAAGA
CCTCCTTAACTACGTGTTTTGCTCAAGAAACTTTTGGGAAACAGTACAAACAAACTATAGGACTGGATTTCTTTTTGAGAAGGATAACAT
TGCCAGGAAACTTGAATGTTACCCTTCAAATTTGGGATATAGGAGGGCAGACAATAGGAGGCAAAATGTTGGATAAATATATCTATGGAG
CACAGGGAGTCCTCTTGGTATATGATATTACAAATTATCAAAGCTTTGAGAATTTAGAAGATTGGTATACTGTGGTGAAGAAAGTGAGCG
AGGAGTCAGAAACTCAGCCACTGGTTGCCTTGGTAGGCAATAAAATTGATTTGGAGCATATGCGAACAATAAAACCTGAAAAACACTTAC
GGTTTTGCCAGGAAAATGGTTTTAGTAGCCACTTTGTCTCAGCCAAGACAGGAGACTCTGTCTTCCTGTGCTTTCAGAAAGTTGCTGCTG
AAATCCTTGGGATCAAATTAAACAAAGCAGAAATAGAACAGTCACAGCGTATTGTCAGGGCAGAAATAGTGAAGTACCCGGAAGAAGAAA
ATCAACATACCACCTCTACTCAGAGTAGAATCTGTTCAGTACAGTAGTGCAGAGGGTGGTGAAGGCAGATATTGTAAACTACAACCAGGA
ACCTATGTCAAGGACTGTTAACCCTCCTAGAAGCTCTATGTGTGCAGTTCAGTGAGCGCATTTTTCTTTTGTGTTGATAGTTCTGGCTGC
CCTTCACCTCTGGGTGGGCCCGAGGACTTCTAGGAACTTGTTTTATCAGTGACCATCTCTGTAGTTCAGTTAACACTTTACTCCCAACTT
GCTTCATCATTGCTATTGCCTCACAGTGGCAGGCAGCTCCTTGGATTTGAAAGAATTCAACTTTGGGACCACACACTTTGAATTCAAAAT
GGAAAACCCATTCCCTGGAATTAGACTGCTTCATTGCAAAAGAATGATGTTGTTTCTTTGTATGTCCTTGCTTCTTTTTTCATTGATGTA
AATTTTTTTAACTTAATATGAAAACTCTCCAAGTCTTGATCATCAGCCAGGATTTTGCCACAGCAATTTCATTCTCTTATCGGAACTTGT
ATGTGTCAAAGTATACTTCAGAGTGCAAACATTAAGCAAGTAATATATTTTACCTACAGATACTTATGAAGACATTCTTTCGCTATCGTG
AGTAAAAGTATATAAAGCTGTTTCTAACTGAAAATGCTTGAAATAAGCCTGTAATAGAAATATTTTTTCATTTTTTAAAAAAGGGCCTAA
ATTGTTTATATTGTAGTTTGTAACTCACAAAGTAATATTTGATATTGTATTTTTATTACTGTATCGTTGTCGTTATGTATTGTGTAATAC
TCAGGTTTGAAGGCTTTCTGAATTCTGATAAATGTTCAGCTGATGCTCCACGTGGAATTTCTCTTGCAAACTGCATAAGAGTACTCCCGA

>In-frame_FBXL5_ENST00000412094_chr4_15656827_-_RAB28_ENST00000338176_chr4_13481150_-_1676nt
ATGCGCAAGGGGGCGCGCCGCCTCTGCCCCGCGGCGAGGGTGTCTATGGAGAGGCGGCGGCCGCGGCTGCTGAGGCGGAGGCTGAGGCAG
TGGCGATGGCGCCCTTTCCTGAAGAAGTGGACGTCTTCACCGCCCCACACTGGCGGATGAAGCAGCTGGTGGGGCTCTACTGCGACAAGA
CCTCCTTAACTACGTGTTTTGCTCAAGAAACTTTTGGGAAACAGTACAAACAAACTATAGGACTGGATTTCTTTTTGAGAAGGATAACAT
TGCCAGGAAACTTGAATGTTACCCTTCAAATTTGGGATATAGGAGGGCAGACAATAGGAGGCAAAATGTTGGATAAATATATCTATGGAG
CACAGGGAGTCCTCTTGGTATATGATATTACAAATTATCAAAGCTTTGAGAATTTAGAAGATTGGTATACTGTGGTGAAGAAAGTGAGCG
AGGAGTCAGAAACTCAGCCACTGGTTGCCTTGGTAGGCAATAAAATTGATTTGGAGCATATGCGAACAATAAAACCTGAAAAACACTTAC
GGTTTTGCCAGGAAAATGGTTTTAGTAGCCACTTTGTCTCAGCCAAGACAGGAGACTCTGTCTTCCTGTGCTTTCAGAAAGTTGCTGCTG
AAATCCTTGGGATCAAATTAAACAAAGCAGAAATAGAACAGTCACAGGGCCATTTCATTATTTTCATTTCATCAACTAATAGAGAATAAT
CGAGTGTGCTTTGTGGCTCTAAAAATAAAGAGGGTGGTGAAGGCAGATATTGTAAACTACAACCAGGAACCTATGTCAAGGACTGTTAAC
CCTCCTAGAAGCTCTATGTGTGCAGTTCAGTGAGCGCATTTTTCTTTTGTGTTGATAGTTCTGGCTGCCCTTCACCTCTGGGTGGGCCCG
AGGACTTCTAGGAACTTGTTTTATCAGTGACCATCTCTGTAGTTCAGTTAACACTTTACTCCCAACTTGCTTCATCATTGCTATTGCCTC
ACAGTGGCAGGCAGCTCCTTGGATTTGAAAGAATTCAACTTTGGGACCACACACTTTGAATTCAAAATGGAAAACCCATTCCCTGGAATT
AGACTGCTTCATTGCAAAAGAATGATGTTGTTTCTTTGTATGTCCTTGCTTCTTTTTTCATTGATGTAAATTTTTTTAACTTAATATGAA
AACTCTCCAAGTCTTGATCATCAGCCAGGATTTTGCCACAGCAATTTCATTCTCTTATCGGAACTTGTATGTGTCAAAGTATACTTCAGA
GTGCAAACATTAAGCAAGTAATATATTTTACCTACAGATACTTATGAAGACATTCTTTCGCTATCGTGAGTAAAAGTATATAAAGCTGTT
TCTAACTGAAAATGCTTGAAATAAGCCTGTAATAGAAATATTTTTTCATTTTTTAAAAAAGGGCCTAAATTGTTTATATTGTAGTTTGTA
ACTCACAAAGTAATATTTGATATTGTATTTTTATTACTGTATCGTTGTCGTTATGTATTGTGTAATACTCAGGTTTGAAGGCTTTCTGAA
TTCTGATAAATGTTCAGCTGATGCTCCACGTGGAATTTCTCTTGCAAACTGCATAAGAGTACTCCCGAGAATGAGTTATGACATTGTGGA


Top

FusionGenePPI for FBXL5_RAB28


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FBXL5SKP1, DCTN1, CUL1, ACO1, IREB2, CSNK2B, PLK1, RBX1, COPS5, BTG1, SMURF1, EP300, ORC4, FAM96B, MMS19, MUS81, SNAI1, HERC2, FBXL5, NABP2, CITED2, ARHGDIB, NEURL4, ZNF106, ECI2, MAP7D1, COPS2, APPBP2, CENPF, COPS6, ARIH1, TTC9C, KLHDC3, COPS3, ACTBL2, CTNNA2, GCA, CIAO1, ACTBRAB28APP, DUSP12, DUSP23, FBXO42, PDE6D, NCOA3, CTSV, CCDC144A, HMMR, KIF7, HSF1, MNS1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FBXL5_RAB28


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FBXL5_RAB28


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource