FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13114

FusionGeneSummary for FBXL20_UVRAG

check button Fusion gene summary
Fusion gene informationFusion gene name: FBXL20_UVRAG
Fusion gene ID: 13114
HgeneTgene
Gene symbol

FBXL20

UVRAG

Gene ID

84961

7405

Gene nameF-box and leucine rich repeat protein 20UV radiation resistance associated
SynonymsFbl2|Fbl20DHTX|VPS38|p63
Cytomap

17q12

11q13.5

Type of geneprotein-codingprotein-coding
DescriptionF-box/LRR-repeat protein 20F-box protein FBL2UV radiation resistance-associated gene proteinbeclin 1 binding proteindisrupted in heterotaxy
Modification date2018052320180523
UniProtAcc

Q96IG2

Q9P2Y5

Ensembl transtripts involved in fusion geneENST00000583610, ENST00000394294, 
ENST00000264658, ENST00000577399, 
ENST00000356136, ENST00000528420, 
ENST00000533454, ENST00000531818, 
ENST00000532130, ENST00000539288, 
ENST00000525872, ENST00000538870, 
Fusion gene scores* DoF score40 X 12 X 14=672024 X 13 X 11=3432
# samples 3825
** MAII scorelog2(38/6720*10)=-4.14438990933518
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(25/3432*10)=-3.77904955283746
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FBXL20 [Title/Abstract] AND UVRAG [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneUVRAG

GO:0071900

regulation of protein serine/threonine kinase activity

22542840

TgeneUVRAG

GO:0097680

double-strand break repair via classical nonhomologous end joining

22542840


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCSTCGA-NA-A5I1-01AFBXL20chr17

37557614

-UVRAGchr11

75826968

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000583610ENST00000356136FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000583610ENST00000528420FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000583610ENST00000533454FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000583610ENST00000531818FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000583610ENST00000532130FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000583610ENST00000539288FBXL20chr17

37557614

-UVRAGchr11

75826968

+
5CDS-intronENST00000583610ENST00000525872FBXL20chr17

37557614

-UVRAGchr11

75826968

+
5CDS-5UTRENST00000583610ENST00000538870FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000394294ENST00000356136FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000394294ENST00000528420FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000394294ENST00000533454FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000394294ENST00000531818FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000394294ENST00000532130FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000394294ENST00000539288FBXL20chr17

37557614

-UVRAGchr11

75826968

+
5CDS-intronENST00000394294ENST00000525872FBXL20chr17

37557614

-UVRAGchr11

75826968

+
5CDS-5UTRENST00000394294ENST00000538870FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000264658ENST00000356136FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000264658ENST00000528420FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000264658ENST00000533454FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000264658ENST00000531818FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000264658ENST00000532130FBXL20chr17

37557614

-UVRAGchr11

75826968

+
In-frameENST00000264658ENST00000539288FBXL20chr17

37557614

-UVRAGchr11

75826968

+
5CDS-intronENST00000264658ENST00000525872FBXL20chr17

37557614

-UVRAGchr11

75826968

+
5CDS-5UTRENST00000264658ENST00000538870FBXL20chr17

37557614

-UVRAGchr11

75826968

+
intron-3CDSENST00000577399ENST00000356136FBXL20chr17

37557614

-UVRAGchr11

75826968

+
intron-3CDSENST00000577399ENST00000528420FBXL20chr17

37557614

-UVRAGchr11

75826968

+
intron-3CDSENST00000577399ENST00000533454FBXL20chr17

37557614

-UVRAGchr11

75826968

+
intron-3CDSENST00000577399ENST00000531818FBXL20chr17

37557614

-UVRAGchr11

75826968

+
intron-3CDSENST00000577399ENST00000532130FBXL20chr17

37557614

-UVRAGchr11

75826968

+
intron-3CDSENST00000577399ENST00000539288FBXL20chr17

37557614

-UVRAGchr11

75826968

+
intron-intronENST00000577399ENST00000525872FBXL20chr17

37557614

-UVRAGchr11

75826968

+
intron-5UTRENST00000577399ENST00000538870FBXL20chr17

37557614

-UVRAGchr11

75826968

+

Top

FusionProtFeatures for FBXL20_UVRAG


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FBXL20

Q96IG2

UVRAG

Q9P2Y5

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Role in neuraltransmission (By similarity). {ECO:0000250}. Versatile protein that is involved in regulation ofdifferent cellular pathways implicated in membrane trafficking.Involved in regulation of the COPI-dependent retrograde transportfrom Golgi and the endoplasmic reticulum by associating with theNRZ complex; the function is dependent on its binding tophosphatidylinositol 3-phosphate (PtdIns(3)P) (PubMed:24056303).During autophagy acts as regulatory subunit of the alternativePI3K complex II (PI3KC3-C2) that mediates formation ofphosphatidylinositol 3-phosphate and is believed to be involved inmaturation of autophagosomes and endocytosis. Activates lipidkinase activity of PIK3C3. Involved in the regulation ofdegradative endocytic trafficking and cytokinesis, and inregulation of ATG9A transport from the Golgi to the autophagosome;the functions seems to implicate its association with PI3KC3-C2(PubMed:16799551, PubMed:20643123, PubMed:24056303). Involved inmaturation of autophagosomes and degradative endocytic traffickingindependently of BECN1 but depending on its association with aclass C Vps complex (possibly the HOPS complex); the associationis also proposed to promote autophagosome recruitment andactivation of Rab7 and endosome-endosome fusion events(PubMed:18552835). Enhances class C Vps complex (possibly HOPScomplex) association with a SNARE complex and promotes fusogenicSNARE complex formation during late endocytic membrane fusion(PubMed:24550300). In case of negative-strand RNA virus infectionis required for efficient virus entry, promotes endocytictransport of virions and is implicated in a VAMP8-specificfusogenic SNARE complex assembly (PubMed:24550300).{ECO:0000269|PubMed:18552835, ECO:0000269|PubMed:20643123,ECO:0000269|PubMed:24056303, ECO:0000305}. Involved in maintaining chromosomal stability. PromotesDNA double-strand break (DSB) repair by association with DNA-dependent protein kinase complex DNA-PK and activating it in non-homologous end joining (NHEJ) (PubMed:22542840). Required forcentrosome stability and proper chromosome segregation(PubMed:22542840). {ECO:0000269|PubMed:22542840}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-11522_6814437DomainF-box
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-11422_6814405DomainF-box
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-11622_6814411DomainF-box
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-115101_12614437RepeatNote=LRR 2
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-115127_15214437RepeatNote=LRR 3
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-115153_17814437RepeatNote=LRR 4
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-115179_20414437RepeatNote=LRR 5
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-115205_23014437RepeatNote=LRR 6
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-115231_25614437RepeatNote=LRR 7
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-115257_28214437RepeatNote=LRR 8
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-115283_30814437RepeatNote=LRR 9
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-115309_33414437RepeatNote=LRR 10
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-115335_36314437RepeatNote=LRR 11
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-115364_38814437RepeatNote=LRR 12
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-115389_41414437RepeatNote=LRR 13
HgeneFBXL20chr17:37557614chr11:75826968ENST00000264658-11574_10014437RepeatNote=LRR 1
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-114101_12614405RepeatNote=LRR 2
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-114127_15214405RepeatNote=LRR 3
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-114153_17814405RepeatNote=LRR 4
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-114179_20414405RepeatNote=LRR 5
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-114205_23014405RepeatNote=LRR 6
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-114231_25614405RepeatNote=LRR 7
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-114257_28214405RepeatNote=LRR 8
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-114283_30814405RepeatNote=LRR 9
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-114309_33414405RepeatNote=LRR 10
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-114335_36314405RepeatNote=LRR 11
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-114364_38814405RepeatNote=LRR 12
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-114389_41414405RepeatNote=LRR 13
HgeneFBXL20chr17:37557614chr11:75826968ENST00000394294-11474_10014405RepeatNote=LRR 1
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-116101_12614411RepeatNote=LRR 2
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-116127_15214411RepeatNote=LRR 3
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-116153_17814411RepeatNote=LRR 4
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-116179_20414411RepeatNote=LRR 5
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-116205_23014411RepeatNote=LRR 6
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-116231_25614411RepeatNote=LRR 7
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-116257_28214411RepeatNote=LRR 8
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-116283_30814411RepeatNote=LRR 9
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-116309_33414411RepeatNote=LRR 10
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-116335_36314411RepeatNote=LRR 11
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-116364_38814411RepeatNote=LRR 12
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-116389_41414411RepeatNote=LRR 13
HgeneFBXL20chr17:37557614chr11:75826968ENST00000583610-11674_10014411RepeatNote=LRR 1
TgeneUVRAGchr17:37557614chr11:75826968ENST00000356136+1215224_305435700Coiled coilOntology_term=ECO:0000255
TgeneUVRAGchr17:37557614chr11:75826968ENST00000356136+121544_128435700DomainNote=C2


Top

FusionGeneSequence for FBXL20_UVRAG


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000356136_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000528420_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000533454_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000531818_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000532130_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000539288_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000356136_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000528420_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000533454_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000531818_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000532130_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000539288_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000356136_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000528420_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000533454_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000531818_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000532130_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000539288_chr11_75826968_+_279aa
MRRDVNGVTKSRFELRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSEN
ERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLL
PSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000356136_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000528420_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000533454_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000531818_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000532130_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000539288_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000356136_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000528420_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000533454_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000531818_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000532130_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000539288_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000356136_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000528420_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000533454_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000531818_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000532130_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000539288_chr11_75826968_+_837nt
ATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTT
CCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAA
AGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAAT
GAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAG
AGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGC
TTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTA
CCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAA
GCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTG
GCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000356136_chr11_75826968_+_2873nt
GTTTTTGTTTTGGGTTGAAGTTGAGGCTGAGGAGAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGAGGTGGTG
GAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTCCCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGGAACTCCC
GGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCCGCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGGGACGTGA
ACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACT
TCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGG
GTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACA
AAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTC
TATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACG
CGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCG
GGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCG
GGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACG
AACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTT
CCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTTTGTGATA
ATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTGGGAATGAAGGAGGGACTCAGGATCATTGTTATCAG
TGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTAAAGCAAAAATCACCCTCTAGTTGAAAGAGCTTACA
GCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATCCTCAGAGGGAAGATGATAATATATAAATAATATAA
TGAACACACCCTTAGTTTCTCATAAGCATTTGCCCTCACCATGGTTTATAAAACTTTGGGAAAACGGAATATTCAGAAATAGGTTTCCGC
CATGTACTGAAAGGTCTGTGGCCATCTGTGAGGTAGATGAAGAAGCAGCATAGTGGTCTCCTTACATCTAGGCCTAACTGTCCCTCTTCC
TGCCCCCGGGTACCACAGTCCACCTTTAGACCCTACTGTCGCCCCATCTTCTCCGTGGATGGGCCATGCGTCCTGAAAACAGGACATCAG
ATTCACTGGTTCTGTAACCCAGTAGCTGTGACGTTCCATCTCTTCTAACCAGCCATGGCCTTCCCCTCCTCTGCCATACCCTTAATGCGG
CCCTCAGATTAGATGAAAAACTTGCTCCTGGTGGATCCCAAGGGACCCTCAAGGACCTCGAGGTTACTGCAGTCAGATGCCATCTCATCC
CCTGTGGGGGCCAAAGTTTTTATGTGGGCAGATGCTGTGGTCAGGAACTAGGCATGCTTTCTGGCAATGCACTCACCAGACAAAAATCCC
TTGATGTAAATCCCATGTTAATTTATTAAATTTCAGTCAGAAGGTCAGCATTTACATGACAGAATGTATGTAGAGAGTTGGGGTGTCTGG
TAGGCAAACTGCAAGGCAGTTGAGATAGTTGGATTAAGAGGCTAGACGAGACATAGAATACTATTGGTATGTGTGCAATTTCATGAATAT
TAAATTATGTTTCGAAGTCCAGTTGTCATTCCCGCATTCAGATTTCATTTGCTGTTGCTTTATACGTTACGTACCCAAGGACATTGCCTC
AGGGTTGCAAACTCTTTAAAGGAAAATTTATCCATATATCCATGTATTATATAGAAGAATAAAAATTGAGTTTACTTCACCCGACCTGAT
TTTTTTTTACCAGCTTGGAAATTCCTCTTGAACCTACGTCTCCATATGTCACATCATGACAGGACTAGCCTGAACAAAAGCCATGTCTAT
CTAAGCGGAGGCTGTTGACTTCATTCAGTTTGCATATTGTATATAGCAACACAAACACTTGACAGGTATATACTCCAGTCGCCACATTTG
TCCTGCATAACAGCTTCACTCACAGGCCTCACCGTCACTTTATTTTGTGTCCAAGCATTCCTGGGCTCAAGTTTAATGTATAGCTACATT
GTTGTTTTCCATGTAGAGAACTCACAGGATGACTACATCACAAATAAACCCAACTCTCAGGCAGTCGAAAGCTTTAACTGGATCTGCAGA
AGCCCATCTTCCTCCACATGAAGAAGTGGGGCTCCTTCACCTAGAGCAGGAGCTTCTCTGCAGTGTACTGTCTGTCGCTCATTTTGGAGT

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000528420_chr11_75826968_+_1472nt
GTTTTTGTTTTGGGTTGAAGTTGAGGCTGAGGAGAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGAGGTGGTG
GAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTCCCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGGAACTCCC
GGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCCGCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGGGACGTGA
ACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACT
TCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGG
GTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACA
AAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTC
TATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACG
CGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCG
GGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCG
GGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACG
AACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTT
CCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTTTGTGATA
ATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTGGGAATGAAGGAGGGACTCAGGATCATTGTTATCAG
TGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTAAAGCAAAAATCACCCTCTAGTTGAAAGAGCTTACA
GCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATCCTCAGAGGGAAGATGATAATATATAAATAATATAA

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000533454_chr11_75826968_+_1178nt
GTTTTTGTTTTGGGTTGAAGTTGAGGCTGAGGAGAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGAGGTGGTG
GAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTCCCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGGAACTCCC
GGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCCGCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGGGACGTGA
ACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACT
TCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGG
GTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACA
AAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTC
TATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACG
CGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCG
GGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCG
GGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACG
AACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTT
CCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTTTGTGATA

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000531818_chr11_75826968_+_2329nt
GTTTTTGTTTTGGGTTGAAGTTGAGGCTGAGGAGAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGAGGTGGTG
GAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTCCCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGGAACTCCC
GGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCCGCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGGGACGTGA
ACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACT
TCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGG
GTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACA
AAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTC
TATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACG
CGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCG
GGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCG
GGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACG
AACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTT
CCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTTTGTGATA
ATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTGGGAATGAAGGAGGGACTCAGGATCATTGTTATCAG
TGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTAAAGCAAAAATCACCCTCTAGTTGAAAGAGCTTACA
GCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATCCTCAGAGGGAAGATGATAATATATAAATAATATAA
TGAACACACCCTTAGTTTCTCATAAGCATTTGCCCTCACCATGGTTTATAAAACTTTGGGAAAACGGAATATTCAGAAATAGGTTTCCGC
CATGTACTGAAAGGTCTGTGGCCATCTGTGAGGTAGATGAAGAAGCAGCATAGTGGTCTCCTTACATCTAGGCCTAACTGTCCCTCTTCC
TGCCCCCGGGTACCACAGTCCACCTTTAGACCCTACTGTCGCCCCATCTTCTCCGTGGATGGGCCATGCGTCCTGAAAACAGGACATCAG
ATTCACTGGTTCTGTAACCCAGTAGCTGTGACGTTCCATCTCTTCTAACCAGCCATGGCCTTCCCCTCCTCTGCCATACCCTTAATGCGG
CCCTCAGATTAGATGAAAAACTTGCTCCTGGTGGATCCCAAGGGACCCTCAAGGACCTCGAGGTTACTGCAGTCAGATGCCATCTCATCC
CCTGTGGGGGCCAAAGTTTTTATGTGGGCAGATGCTGTGGTCAGGAACTAGGCATGCTTTCTGGCAATGCACTCACCAGACAAAAATCCC
TTGATGTAAATCCCATGTTAATTTATTAAATTTCAGTCAGAAGGTCAGCATTTACATGACAGAATGTATGTAGAGAGTTGGGGTGTCTGG
TAGGCAAACTGCAAGGCAGTTGAGATAGTTGGATTAAGAGGCTAGACGAGACATAGAATACTATTGGTATGTGTGCAATTTCATGAATAT
TAAATTATGTTTCGAAGTCCAGTTGTCATTCCCGCATTCAGATTTCATTTGCTGTTGCTTTATACGTTACGTACCCAAGGACATTGCCTC

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000532130_chr11_75826968_+_1461nt
GTTTTTGTTTTGGGTTGAAGTTGAGGCTGAGGAGAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGAGGTGGTG
GAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTCCCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGGAACTCCC
GGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCCGCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGGGACGTGA
ACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACT
TCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGG
GTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACA
AAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTC
TATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACG
CGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCG
GGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCG
GGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACG
AACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTT
CCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTTTGTGATA
ATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTGGGAATGAAGGAGGGACTCAGGATCATTGTTATCAG
TGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTAAAGCAAAAATCACCCTCTAGTTGAAAGAGCTTACA
GCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATCCTCAGAGGGAAGATGATAATATATAAATAATATAA

>In-frame_FBXL20_ENST00000583610_chr17_37557614_-_UVRAG_ENST00000539288_chr11_75826968_+_1178nt
GTTTTTGTTTTGGGTTGAAGTTGAGGCTGAGGAGAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGAGGTGGTG
GAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTCCCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGGAACTCCC
GGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCCGCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGGGACGTGA
ACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACT
TCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGG
GTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACA
AAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTC
TATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACG
CGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCG
GGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCG
GGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACG
AACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTT
CCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTTTGTGATA

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000356136_chr11_75826968_+_2840nt
GAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGAGGTGGTGGAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTC
CCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGGAACTCCCGGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCC
GCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGAT
ATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACA
GACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTT
CACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAG
CCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCT
CCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAG
CCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCC
ACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATC
AGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCC
GAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGA
CTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTTTGTGATAATGATGACACAAAATGAATATTAATGGAGGATA
TTCCTCGGAAAAACAGACTTTGGGAATGAAGGAGGGACTCAGGATCATTGTTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTG
CTTTTCGGGCCTGATGATTTTAAAGCAAAAATCACCCTCTAGTTGAAAGAGCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTT
TTATTTACCCTTGTATGTTATCCTCAGAGGGAAGATGATAATATATAAATAATATAATGAACACACCCTTAGTTTCTCATAAGCATTTGC
CCTCACCATGGTTTATAAAACTTTGGGAAAACGGAATATTCAGAAATAGGTTTCCGCCATGTACTGAAAGGTCTGTGGCCATCTGTGAGG
TAGATGAAGAAGCAGCATAGTGGTCTCCTTACATCTAGGCCTAACTGTCCCTCTTCCTGCCCCCGGGTACCACAGTCCACCTTTAGACCC
TACTGTCGCCCCATCTTCTCCGTGGATGGGCCATGCGTCCTGAAAACAGGACATCAGATTCACTGGTTCTGTAACCCAGTAGCTGTGACG
TTCCATCTCTTCTAACCAGCCATGGCCTTCCCCTCCTCTGCCATACCCTTAATGCGGCCCTCAGATTAGATGAAAAACTTGCTCCTGGTG
GATCCCAAGGGACCCTCAAGGACCTCGAGGTTACTGCAGTCAGATGCCATCTCATCCCCTGTGGGGGCCAAAGTTTTTATGTGGGCAGAT
GCTGTGGTCAGGAACTAGGCATGCTTTCTGGCAATGCACTCACCAGACAAAAATCCCTTGATGTAAATCCCATGTTAATTTATTAAATTT
CAGTCAGAAGGTCAGCATTTACATGACAGAATGTATGTAGAGAGTTGGGGTGTCTGGTAGGCAAACTGCAAGGCAGTTGAGATAGTTGGA
TTAAGAGGCTAGACGAGACATAGAATACTATTGGTATGTGTGCAATTTCATGAATATTAAATTATGTTTCGAAGTCCAGTTGTCATTCCC
GCATTCAGATTTCATTTGCTGTTGCTTTATACGTTACGTACCCAAGGACATTGCCTCAGGGTTGCAAACTCTTTAAAGGAAAATTTATCC
ATATATCCATGTATTATATAGAAGAATAAAAATTGAGTTTACTTCACCCGACCTGATTTTTTTTTACCAGCTTGGAAATTCCTCTTGAAC
CTACGTCTCCATATGTCACATCATGACAGGACTAGCCTGAACAAAAGCCATGTCTATCTAAGCGGAGGCTGTTGACTTCATTCAGTTTGC
ATATTGTATATAGCAACACAAACACTTGACAGGTATATACTCCAGTCGCCACATTTGTCCTGCATAACAGCTTCACTCACAGGCCTCACC
GTCACTTTATTTTGTGTCCAAGCATTCCTGGGCTCAAGTTTAATGTATAGCTACATTGTTGTTTTCCATGTAGAGAACTCACAGGATGAC
TACATCACAAATAAACCCAACTCTCAGGCAGTCGAAAGCTTTAACTGGATCTGCAGAAGCCCATCTTCCTCCACATGAAGAAGTGGGGCT
CCTTCACCTAGAGCAGGAGCTTCTCTGCAGTGTACTGTCTGTCGCTCATTTTGGAGTCAGTGTGGGTGGAGACAGCATCGTGGATATGCA

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000528420_chr11_75826968_+_1439nt
GAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGAGGTGGTGGAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTC
CCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGGAACTCCCGGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCC
GCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGAT
ATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACA
GACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTT
CACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAG
CCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCT
CCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAG
CCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCC
ACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATC
AGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCC
GAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGA
CTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTTTGTGATAATGATGACACAAAATGAATATTAATGGAGGATA
TTCCTCGGAAAAACAGACTTTGGGAATGAAGGAGGGACTCAGGATCATTGTTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTG
CTTTTCGGGCCTGATGATTTTAAAGCAAAAATCACCCTCTAGTTGAAAGAGCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTT

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000533454_chr11_75826968_+_1145nt
GAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGAGGTGGTGGAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTC
CCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGGAACTCCCGGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCC
GCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGAT
ATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACA
GACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTT
CACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAG
CCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCT
CCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAG
CCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCC
ACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATC
AGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCC
GAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGA

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000531818_chr11_75826968_+_2296nt
GAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGAGGTGGTGGAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTC
CCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGGAACTCCCGGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCC
GCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGAT
ATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACA
GACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTT
CACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAG
CCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCT
CCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAG
CCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCC
ACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATC
AGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCC
GAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGA
CTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTTTGTGATAATGATGACACAAAATGAATATTAATGGAGGATA
TTCCTCGGAAAAACAGACTTTGGGAATGAAGGAGGGACTCAGGATCATTGTTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTG
CTTTTCGGGCCTGATGATTTTAAAGCAAAAATCACCCTCTAGTTGAAAGAGCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTT
TTATTTACCCTTGTATGTTATCCTCAGAGGGAAGATGATAATATATAAATAATATAATGAACACACCCTTAGTTTCTCATAAGCATTTGC
CCTCACCATGGTTTATAAAACTTTGGGAAAACGGAATATTCAGAAATAGGTTTCCGCCATGTACTGAAAGGTCTGTGGCCATCTGTGAGG
TAGATGAAGAAGCAGCATAGTGGTCTCCTTACATCTAGGCCTAACTGTCCCTCTTCCTGCCCCCGGGTACCACAGTCCACCTTTAGACCC
TACTGTCGCCCCATCTTCTCCGTGGATGGGCCATGCGTCCTGAAAACAGGACATCAGATTCACTGGTTCTGTAACCCAGTAGCTGTGACG
TTCCATCTCTTCTAACCAGCCATGGCCTTCCCCTCCTCTGCCATACCCTTAATGCGGCCCTCAGATTAGATGAAAAACTTGCTCCTGGTG
GATCCCAAGGGACCCTCAAGGACCTCGAGGTTACTGCAGTCAGATGCCATCTCATCCCCTGTGGGGGCCAAAGTTTTTATGTGGGCAGAT
GCTGTGGTCAGGAACTAGGCATGCTTTCTGGCAATGCACTCACCAGACAAAAATCCCTTGATGTAAATCCCATGTTAATTTATTAAATTT
CAGTCAGAAGGTCAGCATTTACATGACAGAATGTATGTAGAGAGTTGGGGTGTCTGGTAGGCAAACTGCAAGGCAGTTGAGATAGTTGGA
TTAAGAGGCTAGACGAGACATAGAATACTATTGGTATGTGTGCAATTTCATGAATATTAAATTATGTTTCGAAGTCCAGTTGTCATTCCC
GCATTCAGATTTCATTTGCTGTTGCTTTATACGTTACGTACCCAAGGACATTGCCTCAGGGTTGCAAACTCTTTAAAGGAAAATTTATCC

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000532130_chr11_75826968_+_1428nt
GAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGAGGTGGTGGAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTC
CCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGGAACTCCCGGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCC
GCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGAT
ATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACA
GACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTT
CACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAG
CCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCT
CCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAG
CCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCC
ACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATC
AGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCC
GAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGA
CTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTTTGTGATAATGATGACACAAAATGAATATTAATGGAGGATA
TTCCTCGGAAAAACAGACTTTGGGAATGAAGGAGGGACTCAGGATCATTGTTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTG
CTTTTCGGGCCTGATGATTTTAAAGCAAAAATCACCCTCTAGTTGAAAGAGCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTT

>In-frame_FBXL20_ENST00000394294_chr17_37557614_-_UVRAG_ENST00000539288_chr11_75826968_+_1145nt
GAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGAGGTGGTGGAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTC
CCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGGAACTCCCGGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCC
GCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGGGACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGAT
ATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACA
GACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTT
CACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAG
CCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCT
CCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAG
CCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCC
ACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATC
AGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCC
GAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGA

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000356136_chr11_75826968_+_2880nt
GGGGAGTGTTTTTGTTTTGGGTTGAAGTTGAGGCTGAGGAGAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGA
GGTGGTGGAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTCCCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGG
AACTCCCGGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCCGCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGG
GACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTG
AAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATA
TTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTT
CAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATA
ACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGA
GGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAG
CAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAA
ATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAG
TGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGC
AGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTT
TGTGATAATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTGGGAATGAAGGAGGGACTCAGGATCATTG
TTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTAAAGCAAAAATCACCCTCTAGTTGAAAGA
GCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATCCTCAGAGGGAAGATGATAATATATAAAT
AATATAATGAACACACCCTTAGTTTCTCATAAGCATTTGCCCTCACCATGGTTTATAAAACTTTGGGAAAACGGAATATTCAGAAATAGG
TTTCCGCCATGTACTGAAAGGTCTGTGGCCATCTGTGAGGTAGATGAAGAAGCAGCATAGTGGTCTCCTTACATCTAGGCCTAACTGTCC
CTCTTCCTGCCCCCGGGTACCACAGTCCACCTTTAGACCCTACTGTCGCCCCATCTTCTCCGTGGATGGGCCATGCGTCCTGAAAACAGG
ACATCAGATTCACTGGTTCTGTAACCCAGTAGCTGTGACGTTCCATCTCTTCTAACCAGCCATGGCCTTCCCCTCCTCTGCCATACCCTT
AATGCGGCCCTCAGATTAGATGAAAAACTTGCTCCTGGTGGATCCCAAGGGACCCTCAAGGACCTCGAGGTTACTGCAGTCAGATGCCAT
CTCATCCCCTGTGGGGGCCAAAGTTTTTATGTGGGCAGATGCTGTGGTCAGGAACTAGGCATGCTTTCTGGCAATGCACTCACCAGACAA
AAATCCCTTGATGTAAATCCCATGTTAATTTATTAAATTTCAGTCAGAAGGTCAGCATTTACATGACAGAATGTATGTAGAGAGTTGGGG
TGTCTGGTAGGCAAACTGCAAGGCAGTTGAGATAGTTGGATTAAGAGGCTAGACGAGACATAGAATACTATTGGTATGTGTGCAATTTCA
TGAATATTAAATTATGTTTCGAAGTCCAGTTGTCATTCCCGCATTCAGATTTCATTTGCTGTTGCTTTATACGTTACGTACCCAAGGACA
TTGCCTCAGGGTTGCAAACTCTTTAAAGGAAAATTTATCCATATATCCATGTATTATATAGAAGAATAAAAATTGAGTTTACTTCACCCG
ACCTGATTTTTTTTTACCAGCTTGGAAATTCCTCTTGAACCTACGTCTCCATATGTCACATCATGACAGGACTAGCCTGAACAAAAGCCA
TGTCTATCTAAGCGGAGGCTGTTGACTTCATTCAGTTTGCATATTGTATATAGCAACACAAACACTTGACAGGTATATACTCCAGTCGCC
ACATTTGTCCTGCATAACAGCTTCACTCACAGGCCTCACCGTCACTTTATTTTGTGTCCAAGCATTCCTGGGCTCAAGTTTAATGTATAG
CTACATTGTTGTTTTCCATGTAGAGAACTCACAGGATGACTACATCACAAATAAACCCAACTCTCAGGCAGTCGAAAGCTTTAACTGGAT
CTGCAGAAGCCCATCTTCCTCCACATGAAGAAGTGGGGCTCCTTCACCTAGAGCAGGAGCTTCTCTGCAGTGTACTGTCTGTCGCTCATT
TTGGAGTCAGTGTGGGTGGAGACAGCATCGTGGATATGCACGTGCTGCGGGGCCCTCCAGGGAAGTAACATTTACCAAAAAAAAAGAAAA

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000528420_chr11_75826968_+_1479nt
GGGGAGTGTTTTTGTTTTGGGTTGAAGTTGAGGCTGAGGAGAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGA
GGTGGTGGAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTCCCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGG
AACTCCCGGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCCGCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGG
GACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTG
AAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATA
TTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTT
CAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATA
ACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGA
GGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAG
CAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAA
ATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAG
TGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGC
AGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTT
TGTGATAATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTGGGAATGAAGGAGGGACTCAGGATCATTG
TTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTAAAGCAAAAATCACCCTCTAGTTGAAAGA
GCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATCCTCAGAGGGAAGATGATAATATATAAAT

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000533454_chr11_75826968_+_1185nt
GGGGAGTGTTTTTGTTTTGGGTTGAAGTTGAGGCTGAGGAGAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGA
GGTGGTGGAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTCCCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGG
AACTCCCGGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCCGCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGG
GACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTG
AAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATA
TTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTT
CAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATA
ACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGA
GGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAG
CAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAA
ATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAG
TGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGC
AGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTT

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000531818_chr11_75826968_+_2336nt
GGGGAGTGTTTTTGTTTTGGGTTGAAGTTGAGGCTGAGGAGAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGA
GGTGGTGGAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTCCCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGG
AACTCCCGGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCCGCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGG
GACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTG
AAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATA
TTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTT
CAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATA
ACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGA
GGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAG
CAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAA
ATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAG
TGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGC
AGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTT
TGTGATAATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTGGGAATGAAGGAGGGACTCAGGATCATTG
TTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTAAAGCAAAAATCACCCTCTAGTTGAAAGA
GCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATCCTCAGAGGGAAGATGATAATATATAAAT
AATATAATGAACACACCCTTAGTTTCTCATAAGCATTTGCCCTCACCATGGTTTATAAAACTTTGGGAAAACGGAATATTCAGAAATAGG
TTTCCGCCATGTACTGAAAGGTCTGTGGCCATCTGTGAGGTAGATGAAGAAGCAGCATAGTGGTCTCCTTACATCTAGGCCTAACTGTCC
CTCTTCCTGCCCCCGGGTACCACAGTCCACCTTTAGACCCTACTGTCGCCCCATCTTCTCCGTGGATGGGCCATGCGTCCTGAAAACAGG
ACATCAGATTCACTGGTTCTGTAACCCAGTAGCTGTGACGTTCCATCTCTTCTAACCAGCCATGGCCTTCCCCTCCTCTGCCATACCCTT
AATGCGGCCCTCAGATTAGATGAAAAACTTGCTCCTGGTGGATCCCAAGGGACCCTCAAGGACCTCGAGGTTACTGCAGTCAGATGCCAT
CTCATCCCCTGTGGGGGCCAAAGTTTTTATGTGGGCAGATGCTGTGGTCAGGAACTAGGCATGCTTTCTGGCAATGCACTCACCAGACAA
AAATCCCTTGATGTAAATCCCATGTTAATTTATTAAATTTCAGTCAGAAGGTCAGCATTTACATGACAGAATGTATGTAGAGAGTTGGGG
TGTCTGGTAGGCAAACTGCAAGGCAGTTGAGATAGTTGGATTAAGAGGCTAGACGAGACATAGAATACTATTGGTATGTGTGCAATTTCA
TGAATATTAAATTATGTTTCGAAGTCCAGTTGTCATTCCCGCATTCAGATTTCATTTGCTGTTGCTTTATACGTTACGTACCCAAGGACA

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000532130_chr11_75826968_+_1468nt
GGGGAGTGTTTTTGTTTTGGGTTGAAGTTGAGGCTGAGGAGAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGA
GGTGGTGGAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTCCCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGG
AACTCCCGGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCCGCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGG
GACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTG
AAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATA
TTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTT
CAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATA
ACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGA
GGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAG
CAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAA
ATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAG
TGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGC
AGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTT
TGTGATAATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTGGGAATGAAGGAGGGACTCAGGATCATTG
TTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTAAAGCAAAAATCACCCTCTAGTTGAAAGA
GCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATCCTCAGAGGGAAGATGATAATATATAAAT

>In-frame_FBXL20_ENST00000264658_chr17_37557614_-_UVRAG_ENST00000539288_chr11_75826968_+_1185nt
GGGGAGTGTTTTTGTTTTGGGTTGAAGTTGAGGCTGAGGAGAGAGCCGAGCTAGCGACGAGCAGTCGTTGCGGCCGCCGGCGCCGCGGGA
GGTGGTGGAGGCCTAGCCGGAGCCGAGAGGTCTCTTGTTCCCGTCCCACGGTCCCGGCGTCACCCCTCCGGCGCCCAGTCCCCGTCCCGG
AACTCCCGGGCCTGTCCTGGGCCCCCGGTCTGTGCACTCCGCTCGCCGCAGCGCCCGGCCCGGGCCGCACCCGCCGGCCCCATGAGGAGG
GACGTGAACGGAGTGACCAAGAGCAGGTTTGAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTG
AAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATA
TTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTT
CAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATA
ACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGA
GGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAG
CAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAA
ATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAG
TGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCAGCTTCCGCCGGCCGCGC
AGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAAAGCTGCACTTAACCCTT


Top

FusionGenePPI for FBXL20_UVRAG


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FBXL20CUL1, KRAS, YPEL3, PVR, YPEL1, RABGGTBUVRAGBECN1, PIK3C3, VPS33A, VPS18, PIK3R4, PTPRA, KIAA0226, TGFBRAP1, VPS16, VPS11, VPS33B, VPS39, YWHAE, RALB, USP18, XPO1, MYO1C, DDB1, DDB2, CUL4A, RBX1, KIAA0226L


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FBXL20_UVRAG


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FBXL20_UVRAG


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource