FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12978

FusionGeneSummary for FAS_CTNND2

check button Fusion gene summary
Fusion gene informationFusion gene name: FAS_CTNND2
Fusion gene ID: 12978
HgeneTgene
Gene symbol

FAS

CTNND2

Gene ID

2194

1501

Gene namefatty acid synthasecatenin delta 2
SynonymsFAS|OA-519|SDR27X1GT24|NPRAP
Cytomap

17q25.3

5p15.2

Type of geneprotein-codingprotein-coding
Descriptionfatty acid synthaseshort chain dehydrogenase/reductase family 27X, member 1catenin delta-2T-cell delta-catenincatenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein)neurojungin
Modification date2018052220180523
UniProtAcc

P25445

Q9UQB3

Ensembl transtripts involved in fusion geneENST00000355740, ENST00000352159, 
ENST00000357339, ENST00000355279, 
ENST00000313771, 
ENST00000304623, 
ENST00000359640, ENST00000511377, 
ENST00000458100, ENST00000503622, 
ENST00000495388, 
Fusion gene scores* DoF score1 X 1 X 1=112 X 8 X 8=768
# samples 112
** MAII scorelog2(1/1*10)=3.32192809488736log2(12/768*10)=-2.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FAS [Title/Abstract] AND CTNND2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E9-A247-01AFASchr10

90762951

+CTNND2chr5

11023091

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000355740ENST00000304623FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000355740ENST00000359640FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000355740ENST00000511377FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000355740ENST00000458100FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000355740ENST00000503622FASchr10

90762951

+CTNND2chr5

11023091

-
5CDS-5UTRENST00000355740ENST00000495388FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000352159ENST00000304623FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000352159ENST00000359640FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000352159ENST00000511377FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000352159ENST00000458100FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000352159ENST00000503622FASchr10

90762951

+CTNND2chr5

11023091

-
5CDS-5UTRENST00000352159ENST00000495388FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000357339ENST00000304623FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000357339ENST00000359640FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000357339ENST00000511377FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000357339ENST00000458100FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000357339ENST00000503622FASchr10

90762951

+CTNND2chr5

11023091

-
5CDS-5UTRENST00000357339ENST00000495388FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000355279ENST00000304623FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000355279ENST00000359640FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000355279ENST00000511377FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000355279ENST00000458100FASchr10

90762951

+CTNND2chr5

11023091

-
In-frameENST00000355279ENST00000503622FASchr10

90762951

+CTNND2chr5

11023091

-
5CDS-5UTRENST00000355279ENST00000495388FASchr10

90762951

+CTNND2chr5

11023091

-
3UTR-3CDSENST00000313771ENST00000304623FASchr10

90762951

+CTNND2chr5

11023091

-
3UTR-3CDSENST00000313771ENST00000359640FASchr10

90762951

+CTNND2chr5

11023091

-
3UTR-3CDSENST00000313771ENST00000511377FASchr10

90762951

+CTNND2chr5

11023091

-
3UTR-3CDSENST00000313771ENST00000458100FASchr10

90762951

+CTNND2chr5

11023091

-
3UTR-3CDSENST00000313771ENST00000503622FASchr10

90762951

+CTNND2chr5

11023091

-
3UTR-5UTRENST00000313771ENST00000495388FASchr10

90762951

+CTNND2chr5

11023091

-

Top

FusionProtFeatures for FAS_CTNND2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FAS

P25445

CTNND2

Q9UQB3


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCTNND2chr10:90762951chr5:11023091ENST00000304623-1522975_10189291226RepeatNote=ARM 9
TgeneCTNND2chr10:90762951chr5:11023091ENST00000359640-1421882_9218711168RepeatNote=ARM 8
TgeneCTNND2chr10:90762951chr5:11023091ENST00000359640-1421975_10188711168RepeatNote=ARM 9

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFASchr10:90762951chr5:11023091ENST00000355279+28230_31465221DomainDeath
HgeneFASchr10:90762951chr5:11023091ENST00000355740+29230_31465336DomainDeath
HgeneFASchr10:90762951chr5:11023091ENST00000357339+28230_31465315DomainDeath
HgeneFASchr10:90762951chr5:11023091ENST00000355279+28128_16665221RepeatNote=TNFR-Cys 3
HgeneFASchr10:90762951chr5:11023091ENST00000355279+2847_8365221RepeatNote=TNFR-Cys 1
HgeneFASchr10:90762951chr5:11023091ENST00000355279+2884_12765221RepeatNote=TNFR-Cys 2
HgeneFASchr10:90762951chr5:11023091ENST00000355740+29128_16665336RepeatNote=TNFR-Cys 3
HgeneFASchr10:90762951chr5:11023091ENST00000355740+2947_8365336RepeatNote=TNFR-Cys 1
HgeneFASchr10:90762951chr5:11023091ENST00000355740+2984_12765336RepeatNote=TNFR-Cys 2
HgeneFASchr10:90762951chr5:11023091ENST00000357339+28128_16665315RepeatNote=TNFR-Cys 3
HgeneFASchr10:90762951chr5:11023091ENST00000357339+2847_8365315RepeatNote=TNFR-Cys 1
HgeneFASchr10:90762951chr5:11023091ENST00000357339+2884_12765315RepeatNote=TNFR-Cys 2
HgeneFASchr10:90762951chr5:11023091ENST00000355279+28191_33565221Topological domainCytoplasmic
HgeneFASchr10:90762951chr5:11023091ENST00000355279+2826_17365221Topological domainExtracellular
HgeneFASchr10:90762951chr5:11023091ENST00000355740+29191_33565336Topological domainCytoplasmic
HgeneFASchr10:90762951chr5:11023091ENST00000355740+2926_17365336Topological domainExtracellular
HgeneFASchr10:90762951chr5:11023091ENST00000357339+28191_33565315Topological domainCytoplasmic
HgeneFASchr10:90762951chr5:11023091ENST00000357339+2826_17365315Topological domainExtracellular
HgeneFASchr10:90762951chr5:11023091ENST00000355279+28174_19065221TransmembraneHelical
HgeneFASchr10:90762951chr5:11023091ENST00000355740+29174_19065336TransmembraneHelical
HgeneFASchr10:90762951chr5:11023091ENST00000357339+28174_19065315TransmembraneHelical
TgeneCTNND2chr10:90762951chr5:11023091ENST00000304623-152249_849291226Coiled coilOntology_term=ECO:0000255
TgeneCTNND2chr10:90762951chr5:11023091ENST00000359640-142149_848711168Coiled coilOntology_term=ECO:0000255
TgeneCTNND2chr10:90762951chr5:11023091ENST00000304623-1522216_2269291226Compositional biasNote=Poly-Pro
TgeneCTNND2chr10:90762951chr5:11023091ENST00000304623-1522811_8179291226Compositional biasNote=Poly-Lys
TgeneCTNND2chr10:90762951chr5:11023091ENST00000359640-1421216_2268711168Compositional biasNote=Poly-Pro
TgeneCTNND2chr10:90762951chr5:11023091ENST00000359640-1421811_8178711168Compositional biasNote=Poly-Lys
TgeneCTNND2chr10:90762951chr5:11023091ENST00000304623-1522394_4389291226RepeatNote=ARM 1
TgeneCTNND2chr10:90762951chr5:11023091ENST00000304623-1522540_5799291226RepeatNote=ARM 2
TgeneCTNND2chr10:90762951chr5:11023091ENST00000304623-1522582_6219291226RepeatNote=ARM 3
TgeneCTNND2chr10:90762951chr5:11023091ENST00000304623-1522626_6669291226RepeatNote=ARM 4
TgeneCTNND2chr10:90762951chr5:11023091ENST00000304623-1522682_7249291226RepeatNote=ARM 5
TgeneCTNND2chr10:90762951chr5:11023091ENST00000304623-1522728_7739291226RepeatNote=ARM 6
TgeneCTNND2chr10:90762951chr5:11023091ENST00000304623-1522835_8759291226RepeatNote=ARM 7
TgeneCTNND2chr10:90762951chr5:11023091ENST00000304623-1522882_9219291226RepeatNote=ARM 8
TgeneCTNND2chr10:90762951chr5:11023091ENST00000359640-1421394_4388711168RepeatNote=ARM 1
TgeneCTNND2chr10:90762951chr5:11023091ENST00000359640-1421540_5798711168RepeatNote=ARM 2
TgeneCTNND2chr10:90762951chr5:11023091ENST00000359640-1421582_6218711168RepeatNote=ARM 3
TgeneCTNND2chr10:90762951chr5:11023091ENST00000359640-1421626_6668711168RepeatNote=ARM 4
TgeneCTNND2chr10:90762951chr5:11023091ENST00000359640-1421682_7248711168RepeatNote=ARM 5
TgeneCTNND2chr10:90762951chr5:11023091ENST00000359640-1421728_7738711168RepeatNote=ARM 6
TgeneCTNND2chr10:90762951chr5:11023091ENST00000359640-1421835_8758711168RepeatNote=ARM 7


Top

FusionGeneSequence for FAS_CTNND2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000304623_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000359640_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000511377_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000458100_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000503622_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000304623_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000359640_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000511377_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000458100_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000503622_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000304623_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000359640_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000511377_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000458100_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000503622_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000304623_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000359640_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000511377_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000458100_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000503622_chr5_11023091_-_362aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGKYAMRDLVHRLPGGNNSNNTASKA
MSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIE
RDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLTRNSTGAPAED
IKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNTETSHYPASPDSW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000304623_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000359640_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000511377_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000458100_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000503622_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000304623_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000359640_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000511377_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000458100_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000503622_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000304623_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000359640_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000511377_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000458100_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000503622_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000304623_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000359640_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000511377_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000458100_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000503622_chr5_11023091_-_1086nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000304623_chr5_11023091_-_2919nt
GCAAGAGTGACACACAGGTGTTCAAAGACGCTTCTGGGGAGTGAGGGAAGCGGTTTACGAGTGACTTGGCTGGAGCCTCAGGGGCGGGCA
CTGGCACGGAACACACCCTGAGGCCAGCCCTGGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAG
TTGGGGAAGCTCTTTCACTTCGGAGGATTGCTCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAG
ATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCA
GAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCT
TCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGAT
TACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACA
CTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATG
GTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCC
TGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGA
GTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTC
AACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAG
AAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCC
CGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAA
CTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCAT
ACCACAAGACATTTCTTTCTGTTTTGTTTTTTTCTCCTGCAAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTA
AGGAAATATTAAGAGCTATTTTAGAAAGCTAAATGAATCGCAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACA
GTGGGCAGCACCTTTCTAGCGTGAGCTGTAGAGTAACGAGAAGTGCTTTATACTGAACGTGGTTGATGGGAGGAGAGACGAGGCATTCGG
GCCGGTGGGGCGTAAGGGTTATCGTTAAGCACAAGACACAGAATAGTTTACACACTGTGTGGGGGACGGCTTCTCACGCTTTGTTTACTC
TCTTCATCCGTTGTGACTCTAGGCTTCAGGTTGCATTGGGGTTCCTCTGTACAGCAAGATGTTTCTTGCCTTTTGTTAATGCATTGTTGT
AAAGTATTTGATGTACATTACAGATTAAAGAAGAAAAGCGCGTTGTGTATATTACACCAATGCCGCCGTGTTTCCTCATCTATGGTTCTA
AATATTGCTTCAATTTCAAACTTTTGAAAGATGTATGGATTTCCAGTTTTTCTTTACTTTCTCCCAGTATGTTTTAACAAAAAAAAAAAA
AAGCAGGAAAAAAGGAATATTTAGCAGTATTGTTCGTTCTGATATGTGAATTTGTTTGTGACAACTAAACAAGGCATTCAGCAGTTTCTG
ACAATTAACATACATCATTCCACACTCCTTGTCAACAAAGTGCTTTTTCACTGCCTAAAATTTTAGATGTAGATATTTGAAATAGATTTT
TTCATTTATACCAGTTTTCTTTATGATGATACAGTGTTAAAAGAAAATAAATTACAATTGATCTGTCATCCATATTTGCTAAGAATGTCT
ATTTCCAAGAACCTATATCTTACAAAATACACATTCTTGCTTGTGTGTCTGTGTGTGTGGGTGTATGTATGTCCACGTACTAGAAAAATT
ACCTGTGTGAGATTTTATTTTGACAGAAGCTATTTCATTTGCTGTTCATCTTGTACAAACTTTGTTTTTGGTTTTTTAGTATAAATGTAC
ATCAGTTTGTTCCTTTTGTACTGTATCTATTCTTCTGACCATCTAGTGACTCAGGATATTAGGCCAGTTGAAGTGGAGTTATAGGATTTT
CACACATTCACGCATACTTGGATATCAACCCTCTCTACAGGTCCGTTTCCTTACACATTTTATCCCCTCAGAACACGATAAACCATGGCC
AATTCAGTTTCACTTTGGGGCCAATTACTTGAAGTATCCACAGAAAATGTAAACTGCTCGCCTTATTCCCCCAAACTTTTTGTTCATGTG
GCAGGGAGCAGTACACAACTATGGAATAGATTATTAAAACTGAACTTGAAGCTAACGTTAGAATAGTGGTTAACAGAGCTAAGAAATAAG
GCTAACCATCGAAAAGAACATGGGCCGCGGGTAAACTAGCTTTGCTCTTTAGATGCAAGTGGCTGAGGCCAATAGGTGCCTAGTAAATGT

>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000359640_chr5_11023091_-_2893nt
GCAAGAGTGACACACAGGTGTTCAAAGACGCTTCTGGGGAGTGAGGGAAGCGGTTTACGAGTGACTTGGCTGGAGCCTCAGGGGCGGGCA
CTGGCACGGAACACACCCTGAGGCCAGCCCTGGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAG
TTGGGGAAGCTCTTTCACTTCGGAGGATTGCTCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAG
ATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCA
GAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCT
TCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGAT
TACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACA
CTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATG
GTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCC
TGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGA
GTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTC
AACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAG
AAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCC
CGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAA
CTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCAT
ACCACAAGACATTTCTTTCTGTTTTGTTTTTTTCTCCTGCAAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTA
AGGAAATATTAAGAGCTATTTTAGAAAGCTAAATGAATCGCAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACA
GTGGGCAGCACCTTTCTAGCGTGAGCTGTAGAGTAACGAGAAGTGCTTTATACTGAACGTGGTTGATGGGAGGAGAGACGAGGCATTCGG
GCCGGTGGGGCGTAAGGGTTATCGTTAAGCACAAGACACAGAATAGTTTACACACTGTGTGGGGGACGGCTTCTCACGCTTTGTTTACTC
TCTTCATCCGTTGTGACTCTAGGCTTCAGGTTGCATTGGGGTTCCTCTGTACAGCAAGATGTTTCTTGCCTTTTGTTAATGCATTGTTGT
AAAGTATTTGATGTACATTACAGATTAAAGAAGAAAAGCGCGTTGTGTATATTACACCAATGCCGCCGTGTTTCCTCATCTATGGTTCTA
AATATTGCTTCAATTTCAAACTTTTGAAAGATGTATGGATTTCCAGTTTTTCTTTACTTTCTCCCAGTATGTTTTAACAAAAAAAAAAAA
AAGCAGGAAAAAAGGAATATTTAGCAGTATTGTTCGTTCTGATATGTGAATTTGTTTGTGACAACTAAACAAGGCATTCAGCAGTTTCTG
ACAATTAACATACATCATTCCACACTCCTTGTCAACAAAGTGCTTTTTCACTGCCTAAAATTTTAGATGTAGATATTTGAAATAGATTTT
TTCATTTATACCAGTTTTCTTTATGATGATACAGTGTTAAAAGAAAATAAATTACAATTGATCTGTCATCCATATTTGCTAAGAATGTCT
ATTTCCAAGAACCTATATCTTACAAAATACACATTCTTGCTTGTGTGTCTGTGTGTGTGGGTGTATGTATGTCCACGTACTAGAAAAATT
ACCTGTGTGAGATTTTATTTTGACAGAAGCTATTTCATTTGCTGTTCATCTTGTACAAACTTTGTTTTTGGTTTTTTAGTATAAATGTAC
ATCAGTTTGTTCCTTTTGTACTGTATCTATTCTTCTGACCATCTAGTGACTCAGGATATTAGGCCAGTTGAAGTGGAGTTATAGGATTTT
CACACATTCACGCATACTTGGATATCAACCCTCTCTACAGGTCCGTTTCCTTACACATTTTATCCCCTCAGAACACGATAAACCATGGCC
AATTCAGTTTCACTTTGGGGCCAATTACTTGAAGTATCCACAGAAAATGTAAACTGCTCGCCTTATTCCCCCAAACTTTTTGTTCATGTG
GCAGGGAGCAGTACACAACTATGGAATAGATTATTAAAACTGAACTTGAAGCTAACGTTAGAATAGTGGTTAACAGAGCTAAGAAATAAG
GCTAACCATCGAAAAGAACATGGGCCGCGGGTAAACTAGCTTTGCTCTTTAGATGCAAGTGGCTGAGGCCAATAGGTGCCTAGTAAATGT

>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000511377_chr5_11023091_-_1864nt
GCAAGAGTGACACACAGGTGTTCAAAGACGCTTCTGGGGAGTGAGGGAAGCGGTTTACGAGTGACTTGGCTGGAGCCTCAGGGGCGGGCA
CTGGCACGGAACACACCCTGAGGCCAGCCCTGGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAG
TTGGGGAAGCTCTTTCACTTCGGAGGATTGCTCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAG
ATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCA
GAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCT
TCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGAT
TACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACA
CTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATG
GTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCC
TGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGA
GTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTC
AACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAG
AAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCC
CGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAA
CTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCAT
ACCACAAGACATTTCTTTCTGTTTTGTTTTTTTCTCCTGCAAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTA
AGGAAATATTAAGAGCTATTTTAGAAAGCTAAATGAATCGCAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACA
GTGGGCAGCACCTTTCTAGCGTGAGCTGTAGAGTAACGAGAAGTGCTTTATACTGAACGTGGTTGATGGGAGGAGAGACGAGGCATTCGG
GCCGGTGGGGCGTAAGGGTTATCGTTAAGCACAAGACACAGAATAGTTTACACACTGTGTGGGGGACGGCTTCTCACGCTTTGTTTACTC
TCTTCATCCGTTGTGACTCTAGGCTTCAGGTTGCATTGGGGTTCCTCTGTACAGCAAGATGTTTCTTGCCTTTTGTTAATGCATTGTTGT

>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000458100_chr5_11023091_-_1570nt
GCAAGAGTGACACACAGGTGTTCAAAGACGCTTCTGGGGAGTGAGGGAAGCGGTTTACGAGTGACTTGGCTGGAGCCTCAGGGGCGGGCA
CTGGCACGGAACACACCCTGAGGCCAGCCCTGGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAG
TTGGGGAAGCTCTTTCACTTCGGAGGATTGCTCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAG
ATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCA
GAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCT
TCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGAT
TACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACA
CTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATG
GTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCC
TGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGA
GTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTC
AACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAG
AAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCC
CGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAA
CTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCAT
ACCACAAGACATTTCTTTCTGTTTTGTTTTTTTCTCCTGCAAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTA
AGGAAATATTAAGAGCTATTTTAGAAAGCTAAATGAATCGCAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACA

>In-frame_FAS_ENST00000355740_chr10_90762951_+_CTNND2_ENST00000503622_chr5_11023091_-_1419nt
GCAAGAGTGACACACAGGTGTTCAAAGACGCTTCTGGGGAGTGAGGGAAGCGGTTTACGAGTGACTTGGCTGGAGCCTCAGGGGCGGGCA
CTGGCACGGAACACACCCTGAGGCCAGCCCTGGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAG
TTGGGGAAGCTCTTTCACTTCGGAGGATTGCTCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAG
ATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCA
GAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCT
TCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGAT
TACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACA
CTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATG
GTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCC
TGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGA
GTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTC
AACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAG
AAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCC
CGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAA
CTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCAT

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000304623_chr5_11023091_-_2889nt
CTTCTGGGGAGTGAGGGAAGCGGTTTACGAGTGACTTGGCTGGAGCCTCAGGGGCGGGCACTGGCACGGAACACACCCTGAGGCCAGCCC
TGGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAGTTGGGGAAGCTCTTTCACTTCGGAGGATTG
CTCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGT
GACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCA
ATTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGC
AAGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTT
ACGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCA
GGTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTC
AACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGC
AAGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGG
AGCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCC
CGCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCA
GAATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCT
CAAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCC
CGACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTT
TTTCTCCTGCAAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTAAGGAAATATTAAGAGCTATTTTAGAAAGCT
AAATGAATCGCAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACAGTGGGCAGCACCTTTCTAGCGTGAGCTGTA
GAGTAACGAGAAGTGCTTTATACTGAACGTGGTTGATGGGAGGAGAGACGAGGCATTCGGGCCGGTGGGGCGTAAGGGTTATCGTTAAGC
ACAAGACACAGAATAGTTTACACACTGTGTGGGGGACGGCTTCTCACGCTTTGTTTACTCTCTTCATCCGTTGTGACTCTAGGCTTCAGG
TTGCATTGGGGTTCCTCTGTACAGCAAGATGTTTCTTGCCTTTTGTTAATGCATTGTTGTAAAGTATTTGATGTACATTACAGATTAAAG
AAGAAAAGCGCGTTGTGTATATTACACCAATGCCGCCGTGTTTCCTCATCTATGGTTCTAAATATTGCTTCAATTTCAAACTTTTGAAAG
ATGTATGGATTTCCAGTTTTTCTTTACTTTCTCCCAGTATGTTTTAACAAAAAAAAAAAAAAGCAGGAAAAAAGGAATATTTAGCAGTAT
TGTTCGTTCTGATATGTGAATTTGTTTGTGACAACTAAACAAGGCATTCAGCAGTTTCTGACAATTAACATACATCATTCCACACTCCTT
GTCAACAAAGTGCTTTTTCACTGCCTAAAATTTTAGATGTAGATATTTGAAATAGATTTTTTCATTTATACCAGTTTTCTTTATGATGAT
ACAGTGTTAAAAGAAAATAAATTACAATTGATCTGTCATCCATATTTGCTAAGAATGTCTATTTCCAAGAACCTATATCTTACAAAATAC
ACATTCTTGCTTGTGTGTCTGTGTGTGTGGGTGTATGTATGTCCACGTACTAGAAAAATTACCTGTGTGAGATTTTATTTTGACAGAAGC
TATTTCATTTGCTGTTCATCTTGTACAAACTTTGTTTTTGGTTTTTTAGTATAAATGTACATCAGTTTGTTCCTTTTGTACTGTATCTAT
TCTTCTGACCATCTAGTGACTCAGGATATTAGGCCAGTTGAAGTGGAGTTATAGGATTTTCACACATTCACGCATACTTGGATATCAACC
CTCTCTACAGGTCCGTTTCCTTACACATTTTATCCCCTCAGAACACGATAAACCATGGCCAATTCAGTTTCACTTTGGGGCCAATTACTT
GAAGTATCCACAGAAAATGTAAACTGCTCGCCTTATTCCCCCAAACTTTTTGTTCATGTGGCAGGGAGCAGTACACAACTATGGAATAGA
TTATTAAAACTGAACTTGAAGCTAACGTTAGAATAGTGGTTAACAGAGCTAAGAAATAAGGCTAACCATCGAAAAGAACATGGGCCGCGG
GTAAACTAGCTTTGCTCTTTAGATGCAAGTGGCTGAGGCCAATAGGTGCCTAGTAAATGTTAACTGTTCTTGGAAAAAATAAAAACATCA

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000359640_chr5_11023091_-_2863nt
CTTCTGGGGAGTGAGGGAAGCGGTTTACGAGTGACTTGGCTGGAGCCTCAGGGGCGGGCACTGGCACGGAACACACCCTGAGGCCAGCCC
TGGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAGTTGGGGAAGCTCTTTCACTTCGGAGGATTG
CTCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGT
GACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCA
ATTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGC
AAGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTT
ACGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCA
GGTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTC
AACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGC
AAGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGG
AGCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCC
CGCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCA
GAATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCT
CAAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCC
CGACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTT
TTTCTCCTGCAAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTAAGGAAATATTAAGAGCTATTTTAGAAAGCT
AAATGAATCGCAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACAGTGGGCAGCACCTTTCTAGCGTGAGCTGTA
GAGTAACGAGAAGTGCTTTATACTGAACGTGGTTGATGGGAGGAGAGACGAGGCATTCGGGCCGGTGGGGCGTAAGGGTTATCGTTAAGC
ACAAGACACAGAATAGTTTACACACTGTGTGGGGGACGGCTTCTCACGCTTTGTTTACTCTCTTCATCCGTTGTGACTCTAGGCTTCAGG
TTGCATTGGGGTTCCTCTGTACAGCAAGATGTTTCTTGCCTTTTGTTAATGCATTGTTGTAAAGTATTTGATGTACATTACAGATTAAAG
AAGAAAAGCGCGTTGTGTATATTACACCAATGCCGCCGTGTTTCCTCATCTATGGTTCTAAATATTGCTTCAATTTCAAACTTTTGAAAG
ATGTATGGATTTCCAGTTTTTCTTTACTTTCTCCCAGTATGTTTTAACAAAAAAAAAAAAAAGCAGGAAAAAAGGAATATTTAGCAGTAT
TGTTCGTTCTGATATGTGAATTTGTTTGTGACAACTAAACAAGGCATTCAGCAGTTTCTGACAATTAACATACATCATTCCACACTCCTT
GTCAACAAAGTGCTTTTTCACTGCCTAAAATTTTAGATGTAGATATTTGAAATAGATTTTTTCATTTATACCAGTTTTCTTTATGATGAT
ACAGTGTTAAAAGAAAATAAATTACAATTGATCTGTCATCCATATTTGCTAAGAATGTCTATTTCCAAGAACCTATATCTTACAAAATAC
ACATTCTTGCTTGTGTGTCTGTGTGTGTGGGTGTATGTATGTCCACGTACTAGAAAAATTACCTGTGTGAGATTTTATTTTGACAGAAGC
TATTTCATTTGCTGTTCATCTTGTACAAACTTTGTTTTTGGTTTTTTAGTATAAATGTACATCAGTTTGTTCCTTTTGTACTGTATCTAT
TCTTCTGACCATCTAGTGACTCAGGATATTAGGCCAGTTGAAGTGGAGTTATAGGATTTTCACACATTCACGCATACTTGGATATCAACC
CTCTCTACAGGTCCGTTTCCTTACACATTTTATCCCCTCAGAACACGATAAACCATGGCCAATTCAGTTTCACTTTGGGGCCAATTACTT
GAAGTATCCACAGAAAATGTAAACTGCTCGCCTTATTCCCCCAAACTTTTTGTTCATGTGGCAGGGAGCAGTACACAACTATGGAATAGA
TTATTAAAACTGAACTTGAAGCTAACGTTAGAATAGTGGTTAACAGAGCTAAGAAATAAGGCTAACCATCGAAAAGAACATGGGCCGCGG

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000511377_chr5_11023091_-_1834nt
CTTCTGGGGAGTGAGGGAAGCGGTTTACGAGTGACTTGGCTGGAGCCTCAGGGGCGGGCACTGGCACGGAACACACCCTGAGGCCAGCCC
TGGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAGTTGGGGAAGCTCTTTCACTTCGGAGGATTG
CTCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGT
GACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCA
ATTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGC
AAGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTT
ACGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCA
GGTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTC
AACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGC
AAGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGG
AGCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCC
CGCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCA
GAATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCT
CAAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCC
CGACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTT
TTTCTCCTGCAAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTAAGGAAATATTAAGAGCTATTTTAGAAAGCT
AAATGAATCGCAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACAGTGGGCAGCACCTTTCTAGCGTGAGCTGTA
GAGTAACGAGAAGTGCTTTATACTGAACGTGGTTGATGGGAGGAGAGACGAGGCATTCGGGCCGGTGGGGCGTAAGGGTTATCGTTAAGC
ACAAGACACAGAATAGTTTACACACTGTGTGGGGGACGGCTTCTCACGCTTTGTTTACTCTCTTCATCCGTTGTGACTCTAGGCTTCAGG
TTGCATTGGGGTTCCTCTGTACAGCAAGATGTTTCTTGCCTTTTGTTAATGCATTGTTGTAAAGTATTTGATGTACATTACAGATTAAAG

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000458100_chr5_11023091_-_1540nt
CTTCTGGGGAGTGAGGGAAGCGGTTTACGAGTGACTTGGCTGGAGCCTCAGGGGCGGGCACTGGCACGGAACACACCCTGAGGCCAGCCC
TGGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAGTTGGGGAAGCTCTTTCACTTCGGAGGATTG
CTCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGT
GACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCA
ATTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGC
AAGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTT
ACGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCA
GGTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTC
AACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGC
AAGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGG
AGCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCC
CGCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCA
GAATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCT
CAAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCC
CGACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTT
TTTCTCCTGCAAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTAAGGAAATATTAAGAGCTATTTTAGAAAGCT
AAATGAATCGCAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACAGTGGGCAGCACCTTTCTAGCGTGAGCTGTA

>In-frame_FAS_ENST00000352159_chr10_90762951_+_CTNND2_ENST00000503622_chr5_11023091_-_1389nt
CTTCTGGGGAGTGAGGGAAGCGGTTTACGAGTGACTTGGCTGGAGCCTCAGGGGCGGGCACTGGCACGGAACACACCCTGAGGCCAGCCC
TGGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAGTTGGGGAAGCTCTTTCACTTCGGAGGATTG
CTCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGT
GACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCA
ATTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGC
AAGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTT
ACGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCA
GGTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTC
AACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGC
AAGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGG
AGCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCC
CGCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCA
GAATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCT
CAAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCC
CGACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTT

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000304623_chr5_11023091_-_2798nt
GGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAGTTGGGGAAGCTCTTTCACTTCGGAGGATTGC
TCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTG
ACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAA
TTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCA
AGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTA
CGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAG
GTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCA
ACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCA
AGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGA
GCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCC
GCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAG
AATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTC
AAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCC
GACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTTT
TTCTCCTGCAAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTAAGGAAATATTAAGAGCTATTTTAGAAAGCTA
AATGAATCGCAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACAGTGGGCAGCACCTTTCTAGCGTGAGCTGTAG
AGTAACGAGAAGTGCTTTATACTGAACGTGGTTGATGGGAGGAGAGACGAGGCATTCGGGCCGGTGGGGCGTAAGGGTTATCGTTAAGCA
CAAGACACAGAATAGTTTACACACTGTGTGGGGGACGGCTTCTCACGCTTTGTTTACTCTCTTCATCCGTTGTGACTCTAGGCTTCAGGT
TGCATTGGGGTTCCTCTGTACAGCAAGATGTTTCTTGCCTTTTGTTAATGCATTGTTGTAAAGTATTTGATGTACATTACAGATTAAAGA
AGAAAAGCGCGTTGTGTATATTACACCAATGCCGCCGTGTTTCCTCATCTATGGTTCTAAATATTGCTTCAATTTCAAACTTTTGAAAGA
TGTATGGATTTCCAGTTTTTCTTTACTTTCTCCCAGTATGTTTTAACAAAAAAAAAAAAAAGCAGGAAAAAAGGAATATTTAGCAGTATT
GTTCGTTCTGATATGTGAATTTGTTTGTGACAACTAAACAAGGCATTCAGCAGTTTCTGACAATTAACATACATCATTCCACACTCCTTG
TCAACAAAGTGCTTTTTCACTGCCTAAAATTTTAGATGTAGATATTTGAAATAGATTTTTTCATTTATACCAGTTTTCTTTATGATGATA
CAGTGTTAAAAGAAAATAAATTACAATTGATCTGTCATCCATATTTGCTAAGAATGTCTATTTCCAAGAACCTATATCTTACAAAATACA
CATTCTTGCTTGTGTGTCTGTGTGTGTGGGTGTATGTATGTCCACGTACTAGAAAAATTACCTGTGTGAGATTTTATTTTGACAGAAGCT
ATTTCATTTGCTGTTCATCTTGTACAAACTTTGTTTTTGGTTTTTTAGTATAAATGTACATCAGTTTGTTCCTTTTGTACTGTATCTATT
CTTCTGACCATCTAGTGACTCAGGATATTAGGCCAGTTGAAGTGGAGTTATAGGATTTTCACACATTCACGCATACTTGGATATCAACCC
TCTCTACAGGTCCGTTTCCTTACACATTTTATCCCCTCAGAACACGATAAACCATGGCCAATTCAGTTTCACTTTGGGGCCAATTACTTG
AAGTATCCACAGAAAATGTAAACTGCTCGCCTTATTCCCCCAAACTTTTTGTTCATGTGGCAGGGAGCAGTACACAACTATGGAATAGAT
TATTAAAACTGAACTTGAAGCTAACGTTAGAATAGTGGTTAACAGAGCTAAGAAATAAGGCTAACCATCGAAAAGAACATGGGCCGCGGG
TAAACTAGCTTTGCTCTTTAGATGCAAGTGGCTGAGGCCAATAGGTGCCTAGTAAATGTTAACTGTTCTTGGAAAAAATAAAAACATCAG

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000359640_chr5_11023091_-_2772nt
GGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAGTTGGGGAAGCTCTTTCACTTCGGAGGATTGC
TCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTG
ACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAA
TTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCA
AGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTA
CGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAG
GTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCA
ACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCA
AGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGA
GCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCC
GCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAG
AATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTC
AAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCC
GACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTTT
TTCTCCTGCAAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTAAGGAAATATTAAGAGCTATTTTAGAAAGCTA
AATGAATCGCAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACAGTGGGCAGCACCTTTCTAGCGTGAGCTGTAG
AGTAACGAGAAGTGCTTTATACTGAACGTGGTTGATGGGAGGAGAGACGAGGCATTCGGGCCGGTGGGGCGTAAGGGTTATCGTTAAGCA
CAAGACACAGAATAGTTTACACACTGTGTGGGGGACGGCTTCTCACGCTTTGTTTACTCTCTTCATCCGTTGTGACTCTAGGCTTCAGGT
TGCATTGGGGTTCCTCTGTACAGCAAGATGTTTCTTGCCTTTTGTTAATGCATTGTTGTAAAGTATTTGATGTACATTACAGATTAAAGA
AGAAAAGCGCGTTGTGTATATTACACCAATGCCGCCGTGTTTCCTCATCTATGGTTCTAAATATTGCTTCAATTTCAAACTTTTGAAAGA
TGTATGGATTTCCAGTTTTTCTTTACTTTCTCCCAGTATGTTTTAACAAAAAAAAAAAAAAGCAGGAAAAAAGGAATATTTAGCAGTATT
GTTCGTTCTGATATGTGAATTTGTTTGTGACAACTAAACAAGGCATTCAGCAGTTTCTGACAATTAACATACATCATTCCACACTCCTTG
TCAACAAAGTGCTTTTTCACTGCCTAAAATTTTAGATGTAGATATTTGAAATAGATTTTTTCATTTATACCAGTTTTCTTTATGATGATA
CAGTGTTAAAAGAAAATAAATTACAATTGATCTGTCATCCATATTTGCTAAGAATGTCTATTTCCAAGAACCTATATCTTACAAAATACA
CATTCTTGCTTGTGTGTCTGTGTGTGTGGGTGTATGTATGTCCACGTACTAGAAAAATTACCTGTGTGAGATTTTATTTTGACAGAAGCT
ATTTCATTTGCTGTTCATCTTGTACAAACTTTGTTTTTGGTTTTTTAGTATAAATGTACATCAGTTTGTTCCTTTTGTACTGTATCTATT
CTTCTGACCATCTAGTGACTCAGGATATTAGGCCAGTTGAAGTGGAGTTATAGGATTTTCACACATTCACGCATACTTGGATATCAACCC
TCTCTACAGGTCCGTTTCCTTACACATTTTATCCCCTCAGAACACGATAAACCATGGCCAATTCAGTTTCACTTTGGGGCCAATTACTTG
AAGTATCCACAGAAAATGTAAACTGCTCGCCTTATTCCCCCAAACTTTTTGTTCATGTGGCAGGGAGCAGTACACAACTATGGAATAGAT
TATTAAAACTGAACTTGAAGCTAACGTTAGAATAGTGGTTAACAGAGCTAAGAAATAAGGCTAACCATCGAAAAGAACATGGGCCGCGGG

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000511377_chr5_11023091_-_1743nt
GGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAGTTGGGGAAGCTCTTTCACTTCGGAGGATTGC
TCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTG
ACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAA
TTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCA
AGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTA
CGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAG
GTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCA
ACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCA
AGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGA
GCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCC
GCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAG
AATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTC
AAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCC
GACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTTT
TTCTCCTGCAAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTAAGGAAATATTAAGAGCTATTTTAGAAAGCTA
AATGAATCGCAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACAGTGGGCAGCACCTTTCTAGCGTGAGCTGTAG
AGTAACGAGAAGTGCTTTATACTGAACGTGGTTGATGGGAGGAGAGACGAGGCATTCGGGCCGGTGGGGCGTAAGGGTTATCGTTAAGCA
CAAGACACAGAATAGTTTACACACTGTGTGGGGGACGGCTTCTCACGCTTTGTTTACTCTCTTCATCCGTTGTGACTCTAGGCTTCAGGT
TGCATTGGGGTTCCTCTGTACAGCAAGATGTTTCTTGCCTTTTGTTAATGCATTGTTGTAAAGTATTTGATGTACATTACAGATTAAAGA

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000458100_chr5_11023091_-_1449nt
GGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAGTTGGGGAAGCTCTTTCACTTCGGAGGATTGC
TCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTG
ACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAA
TTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCA
AGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTA
CGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAG
GTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCA
ACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCA
AGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGA
GCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCC
GCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAG
AATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTC
AAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCC
GACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTTT
TTCTCCTGCAAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTAAGGAAATATTAAGAGCTATTTTAGAAAGCTA
AATGAATCGCAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACAGTGGGCAGCACCTTTCTAGCGTGAGCTGTAG

>In-frame_FAS_ENST00000357339_chr10_90762951_+_CTNND2_ENST00000503622_chr5_11023091_-_1298nt
GGCTGCCCAGGCGGAGCTGCCTCTTCTCCCGCGGGTTGGTGGACCCGCTCAGTACGGAGTTGGGGAAGCTCTTTCACTTCGGAGGATTGC
TCAACAACCATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTG
ACTGACATCAACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAA
TTCTGCCATAAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCA
AGCAAGGCCATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTA
CGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAG
GTCCTCAACAGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCA
ACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCA
AGTGCCCCAGCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGA
GCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCC
GCTGAAGACATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAG
AATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTC
AAGTCCACCGGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCC
GACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTTT

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000304623_chr5_11023091_-_2699nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG
GTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTTTTTCTCCTGC
AAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTAAGGAAATATTAAGAGCTATTTTAGAAAGCTAAATGAATCG
CAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACAGTGGGCAGCACCTTTCTAGCGTGAGCTGTAGAGTAACGAG
AAGTGCTTTATACTGAACGTGGTTGATGGGAGGAGAGACGAGGCATTCGGGCCGGTGGGGCGTAAGGGTTATCGTTAAGCACAAGACACA
GAATAGTTTACACACTGTGTGGGGGACGGCTTCTCACGCTTTGTTTACTCTCTTCATCCGTTGTGACTCTAGGCTTCAGGTTGCATTGGG
GTTCCTCTGTACAGCAAGATGTTTCTTGCCTTTTGTTAATGCATTGTTGTAAAGTATTTGATGTACATTACAGATTAAAGAAGAAAAGCG
CGTTGTGTATATTACACCAATGCCGCCGTGTTTCCTCATCTATGGTTCTAAATATTGCTTCAATTTCAAACTTTTGAAAGATGTATGGAT
TTCCAGTTTTTCTTTACTTTCTCCCAGTATGTTTTAACAAAAAAAAAAAAAAGCAGGAAAAAAGGAATATTTAGCAGTATTGTTCGTTCT
GATATGTGAATTTGTTTGTGACAACTAAACAAGGCATTCAGCAGTTTCTGACAATTAACATACATCATTCCACACTCCTTGTCAACAAAG
TGCTTTTTCACTGCCTAAAATTTTAGATGTAGATATTTGAAATAGATTTTTTCATTTATACCAGTTTTCTTTATGATGATACAGTGTTAA
AAGAAAATAAATTACAATTGATCTGTCATCCATATTTGCTAAGAATGTCTATTTCCAAGAACCTATATCTTACAAAATACACATTCTTGC
TTGTGTGTCTGTGTGTGTGGGTGTATGTATGTCCACGTACTAGAAAAATTACCTGTGTGAGATTTTATTTTGACAGAAGCTATTTCATTT
GCTGTTCATCTTGTACAAACTTTGTTTTTGGTTTTTTAGTATAAATGTACATCAGTTTGTTCCTTTTGTACTGTATCTATTCTTCTGACC
ATCTAGTGACTCAGGATATTAGGCCAGTTGAAGTGGAGTTATAGGATTTTCACACATTCACGCATACTTGGATATCAACCCTCTCTACAG
GTCCGTTTCCTTACACATTTTATCCCCTCAGAACACGATAAACCATGGCCAATTCAGTTTCACTTTGGGGCCAATTACTTGAAGTATCCA
CAGAAAATGTAAACTGCTCGCCTTATTCCCCCAAACTTTTTGTTCATGTGGCAGGGAGCAGTACACAACTATGGAATAGATTATTAAAAC
TGAACTTGAAGCTAACGTTAGAATAGTGGTTAACAGAGCTAAGAAATAAGGCTAACCATCGAAAAGAACATGGGCCGCGGGTAAACTAGC

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000359640_chr5_11023091_-_2673nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG
GTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTTTTTCTCCTGC
AAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTAAGGAAATATTAAGAGCTATTTTAGAAAGCTAAATGAATCG
CAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACAGTGGGCAGCACCTTTCTAGCGTGAGCTGTAGAGTAACGAG
AAGTGCTTTATACTGAACGTGGTTGATGGGAGGAGAGACGAGGCATTCGGGCCGGTGGGGCGTAAGGGTTATCGTTAAGCACAAGACACA
GAATAGTTTACACACTGTGTGGGGGACGGCTTCTCACGCTTTGTTTACTCTCTTCATCCGTTGTGACTCTAGGCTTCAGGTTGCATTGGG
GTTCCTCTGTACAGCAAGATGTTTCTTGCCTTTTGTTAATGCATTGTTGTAAAGTATTTGATGTACATTACAGATTAAAGAAGAAAAGCG
CGTTGTGTATATTACACCAATGCCGCCGTGTTTCCTCATCTATGGTTCTAAATATTGCTTCAATTTCAAACTTTTGAAAGATGTATGGAT
TTCCAGTTTTTCTTTACTTTCTCCCAGTATGTTTTAACAAAAAAAAAAAAAAGCAGGAAAAAAGGAATATTTAGCAGTATTGTTCGTTCT
GATATGTGAATTTGTTTGTGACAACTAAACAAGGCATTCAGCAGTTTCTGACAATTAACATACATCATTCCACACTCCTTGTCAACAAAG
TGCTTTTTCACTGCCTAAAATTTTAGATGTAGATATTTGAAATAGATTTTTTCATTTATACCAGTTTTCTTTATGATGATACAGTGTTAA
AAGAAAATAAATTACAATTGATCTGTCATCCATATTTGCTAAGAATGTCTATTTCCAAGAACCTATATCTTACAAAATACACATTCTTGC
TTGTGTGTCTGTGTGTGTGGGTGTATGTATGTCCACGTACTAGAAAAATTACCTGTGTGAGATTTTATTTTGACAGAAGCTATTTCATTT
GCTGTTCATCTTGTACAAACTTTGTTTTTGGTTTTTTAGTATAAATGTACATCAGTTTGTTCCTTTTGTACTGTATCTATTCTTCTGACC
ATCTAGTGACTCAGGATATTAGGCCAGTTGAAGTGGAGTTATAGGATTTTCACACATTCACGCATACTTGGATATCAACCCTCTCTACAG
GTCCGTTTCCTTACACATTTTATCCCCTCAGAACACGATAAACCATGGCCAATTCAGTTTCACTTTGGGGCCAATTACTTGAAGTATCCA
CAGAAAATGTAAACTGCTCGCCTTATTCCCCCAAACTTTTTGTTCATGTGGCAGGGAGCAGTACACAACTATGGAATAGATTATTAAAAC
TGAACTTGAAGCTAACGTTAGAATAGTGGTTAACAGAGCTAAGAAATAAGGCTAACCATCGAAAAGAACATGGGCCGCGGGTAAACTAGC

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000511377_chr5_11023091_-_1644nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG
GTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTTTTTCTCCTGC
AAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTAAGGAAATATTAAGAGCTATTTTAGAAAGCTAAATGAATCG
CAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACAGTGGGCAGCACCTTTCTAGCGTGAGCTGTAGAGTAACGAG
AAGTGCTTTATACTGAACGTGGTTGATGGGAGGAGAGACGAGGCATTCGGGCCGGTGGGGCGTAAGGGTTATCGTTAAGCACAAGACACA
GAATAGTTTACACACTGTGTGGGGGACGGCTTCTCACGCTTTGTTTACTCTCTTCATCCGTTGTGACTCTAGGCTTCAGGTTGCATTGGG
GTTCCTCTGTACAGCAAGATGTTTCTTGCCTTTTGTTAATGCATTGTTGTAAAGTATTTGATGTACATTACAGATTAAAGAAGAAAAGCG

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000458100_chr5_11023091_-_1350nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG
GTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTTTTTCTCCTGC
AAATTTAGTTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTAAGGAAATATTAAGAGCTATTTTAGAAAGCTAAATGAATCG
CAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATCCTAAATATGACAGTGGGCAGCACCTTTCTAGCGTGAGCTGTAGAGTAACGAG

>In-frame_FAS_ENST00000355279_chr10_90762951_+_CTNND2_ENST00000503622_chr5_11023091_-_1199nt
ATGCTGGGCATCTGGACCCTCCTACCTCTGGTTCTTACGTCTGTTGCTAGATTATCGTCCAAAAGTGTTAATGCCCAAGTGACTGACATC
AACTCCAAGGGATTGGAATTGAGGAAGACTGTTACTACAGTTGAGACTCAGAACTTGGAAGGCCTGCATCATGATGGCCAATTCTGCCAT
AAGCCCTGTCCTCCAGGCAAATACGCCATGCGAGACCTAGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCC
ATGTCGGATGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAACGCCAAGGCCTTACGGGATGCC
GGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAAAGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAAC
AGCATGTGGCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGTAGCCTCGTCTTCAACCATCGAG
AGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCCCTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCA
GCTTCACCTCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGCCACCTACCACGGAGCTAAAGGC
GAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAACACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGAC
ATCAAACACAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTACCAGCCATTTCAGAATTCCACA
AGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCACCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACC
GGCAACTACGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTACCCGGCCTCCCCCGACTCCTGG
GTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGCATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTTTTTCTCCTGC


Top

FusionGenePPI for FAS_CTNND2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FASSUMO1, BID, TNFRSF10B, EZR, FADD, FASLG, MAPK8, MSN, CASP10, CASP8, RHOA, ARHGDIA, TNFRSF1A, C14orf1, LRIF1, EEF1A1, CRMP1, FAS, RIPK1, CFLAR, PDCD6, UBE2I, HIPK3, FAF1, NOL3, FAIM2, FYN, CASP8AP2, TNFSF13, LCK, FBF1, BRE, TNF, KRIT1, TRAF3, FAF2, MAP3K5, DAXX, TRADD, PRAM1, RARA, PML, SQSTM1, TP63, CAV1, GADD45A, APOA5, CCND3, ATP6V0B, BAG6, TMX1, HNRNPC, TCAP, MBD4, UBQLN1, PRKAG1, TUBB4A, TUBB3, TUBB2A, TUBB2B, COX16, MDN1, ALDH1L2, EHD1, RUFY1, NDUFAF1, SPATA5, MAP1S, GPD1L, ECSIT, PDXDC1, CHD1L, SPATA5L1, WDR11, RHOBTB3, UGDH, CTU2, UFSP2, INTS2, ACAD9, C17orf75, METTL13, FAM118B, ARF5, FAM91A1, DPH1, MOCS3, CDYL, RB1, PEX1, WRB, C19orf52, ALDH16A1, SFXN5, ABHD11, RAP1A, CTNNB1, PRKCA, GPN3, PIK3R1, SRC, YES1CTNND2PDZD2, LRRC7, ATN1, ZBTB33, NUDT21, TTR, LNX1, CLK1, MCM2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneFASchr10:90762951chr5:11023091ENST00000355279+28230_25465221CALM
HgeneFASchr10:90762951chr5:11023091ENST00000355740+29230_25465336CALM
HgeneFASchr10:90762951chr5:11023091ENST00000357339+28230_25465315CALM
HgeneFASchr10:90762951chr5:11023091ENST00000355279+28212_31765221HIPK3
HgeneFASchr10:90762951chr5:11023091ENST00000355740+29212_31765336HIPK3
HgeneFASchr10:90762951chr5:11023091ENST00000357339+28212_31765315HIPK3


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FAS_CTNND2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FAS_CTNND2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFASC1328840Autoimmune Lymphoproliferative Syndrome11CTD_human;ORPHANET;UNIPROT
HgeneFASC0004364Autoimmune Diseases3CTD_human
HgeneFASC0878544Cardiomyopathies3CTD_human
HgeneFASC0005695Bladder Neoplasm1CTD_human
HgeneFASC0007193Cardiomyopathy, Dilated1CTD_human
HgeneFASC0011853Diabetes Mellitus, Experimental1CTD_human
HgeneFASC0011860Diabetes Mellitus, Non-Insulin-Dependent1CTD_human
HgeneFASC0018939Hematological Disease1CTD_human
HgeneFASC0020532Hypersplenism1CTD_human
HgeneFASC0023467Leukemia, Myelocytic, Acute1CTD_human
HgeneFASC0024121Lung Neoplasms1CTD_human
HgeneFASC0024535Malaria, Falciparum1CTD_human
HgeneFASC0026896Myasthenia Gravis1CTD_human
HgeneFASC0027540Necrosis1CTD_human
HgeneFASC0027697Nephritis1CTD_human
HgeneFASC0032963Pregnancy Complications, Cardiovascular1CTD_human
HgeneFASC0033687Proteinuria1CTD_human
HgeneFASC0036341Schizophrenia1PSYGENET
HgeneFASC0039338Taste Disorders1CTD_human
HgeneFASC0079744Diffuse Large B-Cell Lymphoma1CTD_human
HgeneFASC0079773Lymphoma, T-Cell, Cutaneous1CTD_human
HgeneFASC0162557Liver Failure, Acute1CTD_human
HgeneFASC0242488Acute Lung Injury1CTD_human
HgeneFASC0242698Ventricular Dysfunction, Left1CTD_human
HgeneFASC0400966Non-alcoholic Fatty Liver Disease1CTD_human
TgeneCTNND2C0005586Bipolar Disorder1PSYGENET
TgeneCTNND2C0007621Neoplastic Cell Transformation1CTD_human
TgeneCTNND2C0017636Glioblastoma1CTD_human
TgeneCTNND2C0036341Schizophrenia1PSYGENET
TgeneCTNND2C0041696Unipolar Depression1PSYGENET
TgeneCTNND2C1269683Major Depressive Disorder1PSYGENET