FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12859

FusionGeneSummary for FAM76A_WDTC1

check button Fusion gene summary
Fusion gene informationFusion gene name: FAM76A_WDTC1
Fusion gene ID: 12859
HgeneTgene
Gene symbol

FAM76A

WDTC1

Gene ID

199870

23038

Gene namefamily with sequence similarity 76 member AWD and tetratricopeptide repeats 1
Synonyms-ADP|DCAF9
Cytomap

1p35.3

1p36.11

Type of geneprotein-codingprotein-coding
Descriptionprotein FAM76AWD and tetratricopeptide repeats protein 1DDB1 and CUL4 associated factor 9adipose homolog
Modification date2018051920180519
UniProtAcc

Q8TAV0

Q8N5D0

Ensembl transtripts involved in fusion geneENST00000373954, ENST00000419687, 
ENST00000530324, ENST00000234549, 
ENST00000373949, ENST00000010299, 
ENST00000319394, ENST00000361771, 
Fusion gene scores* DoF score2 X 1 X 2=49 X 7 X 9=567
# samples 211
** MAII scorelog2(2/4*10)=2.32192809488736log2(11/567*10)=-2.36584521141757
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FAM76A [Title/Abstract] AND WDTC1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-44-6778-01AFAM76Achr1

28075665

+WDTC1chr1

27631492

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000373954ENST00000319394FAM76Achr1

28075665

+WDTC1chr1

27631492

+
In-frameENST00000373954ENST00000361771FAM76Achr1

28075665

+WDTC1chr1

27631492

+
intron-3CDSENST00000419687ENST00000319394FAM76Achr1

28075665

+WDTC1chr1

27631492

+
intron-3CDSENST00000419687ENST00000361771FAM76Achr1

28075665

+WDTC1chr1

27631492

+
In-frameENST00000530324ENST00000319394FAM76Achr1

28075665

+WDTC1chr1

27631492

+
In-frameENST00000530324ENST00000361771FAM76Achr1

28075665

+WDTC1chr1

27631492

+
intron-3CDSENST00000234549ENST00000319394FAM76Achr1

28075665

+WDTC1chr1

27631492

+
intron-3CDSENST00000234549ENST00000361771FAM76Achr1

28075665

+WDTC1chr1

27631492

+
intron-3CDSENST00000373949ENST00000319394FAM76Achr1

28075665

+WDTC1chr1

27631492

+
intron-3CDSENST00000373949ENST00000361771FAM76Achr1

28075665

+WDTC1chr1

27631492

+
In-frameENST00000010299ENST00000319394FAM76Achr1

28075665

+WDTC1chr1

27631492

+
In-frameENST00000010299ENST00000361771FAM76Achr1

28075665

+WDTC1chr1

27631492

+

Top

FusionProtFeatures for FAM76A_WDTC1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FAM76A

Q8TAV0

WDTC1

Q8N5D0

May function as a substrate receptor for CUL4-DDB1 E3ubiquitin-protein ligase complex. {ECO:0000269|PubMed:16964240}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFAM76Achr1:28075665chr1:27631492ENST00000010299+710147_150233342Compositional biasNote=Poly-Ser
HgeneFAM76Achr1:28075665chr1:27631492ENST00000373954+69147_150199308Compositional biasNote=Poly-Ser
TgeneWDTC1chr1:28075665chr1:27631492ENST00000319394+1316578_617547678RepeatNote=WD 7
TgeneWDTC1chr1:28075665chr1:27631492ENST00000361771+1316578_617546677RepeatNote=WD 7

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFAM76Achr1:28075665chr1:27631492ENST00000010299+710217_299233342Coiled coilOntology_term=ECO:0000255
HgeneFAM76Achr1:28075665chr1:27631492ENST00000234549+19217_299-18313Coiled coilOntology_term=ECO:0000255
HgeneFAM76Achr1:28075665chr1:27631492ENST00000373949+18217_299-18279Coiled coilOntology_term=ECO:0000255
HgeneFAM76Achr1:28075665chr1:27631492ENST00000373954+69217_299199308Coiled coilOntology_term=ECO:0000255
HgeneFAM76Achr1:28075665chr1:27631492ENST00000419687+17217_299-29228Coiled coilOntology_term=ECO:0000255
HgeneFAM76Achr1:28075665chr1:27631492ENST00000234549+19147_150-18313Compositional biasNote=Poly-Ser
HgeneFAM76Achr1:28075665chr1:27631492ENST00000373949+18147_150-18279Compositional biasNote=Poly-Ser
HgeneFAM76Achr1:28075665chr1:27631492ENST00000419687+17147_150-29228Compositional biasNote=Poly-Ser
TgeneWDTC1chr1:28075665chr1:27631492ENST00000319394+1316132_172547678RepeatNote=WD 3
TgeneWDTC1chr1:28075665chr1:27631492ENST00000319394+1316182_222547678RepeatNote=WD 4
TgeneWDTC1chr1:28075665chr1:27631492ENST00000319394+1316265_305547678RepeatNote=WD 5
TgeneWDTC1chr1:28075665chr1:27631492ENST00000319394+1316362_395547678RepeatNote=TPR 1
TgeneWDTC1chr1:28075665chr1:27631492ENST00000319394+1316397_432547678RepeatNote=TPR 2
TgeneWDTC1chr1:28075665chr1:27631492ENST00000319394+131645_84547678RepeatNote=WD 1
TgeneWDTC1chr1:28075665chr1:27631492ENST00000319394+1316535_575547678RepeatNote=WD 6
TgeneWDTC1chr1:28075665chr1:27631492ENST00000319394+131688_129547678RepeatNote=WD 2
TgeneWDTC1chr1:28075665chr1:27631492ENST00000361771+1316132_172546677RepeatNote=WD 3
TgeneWDTC1chr1:28075665chr1:27631492ENST00000361771+1316182_222546677RepeatNote=WD 4
TgeneWDTC1chr1:28075665chr1:27631492ENST00000361771+1316265_305546677RepeatNote=WD 5
TgeneWDTC1chr1:28075665chr1:27631492ENST00000361771+1316362_395546677RepeatNote=TPR 1
TgeneWDTC1chr1:28075665chr1:27631492ENST00000361771+1316397_432546677RepeatNote=TPR 2
TgeneWDTC1chr1:28075665chr1:27631492ENST00000361771+131645_84546677RepeatNote=WD 1
TgeneWDTC1chr1:28075665chr1:27631492ENST00000361771+1316535_575546677RepeatNote=WD 6
TgeneWDTC1chr1:28075665chr1:27631492ENST00000361771+131688_129546677RepeatNote=WD 2


Top

FusionGeneSequence for FAM76A_WDTC1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FAM76A_ENST00000373954_chr1_28075665_+_WDTC1_ENST00000319394_chr1_27631492_+_330aa
MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLTGTPKPCQTCNIIAAFIGNKCQRCTN
SEKKTGPPTSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQTSRLSGGGHTNSQKTLSTSSI
QNEIPKKKSKFESITTNGDSNAQTIVSGSDDGSFFIWEKETTNLVRVLQGDESIVNCLQPHPSYCFLATSGIDPVVRLWNPRPESEDLTG

>In-frame_FAM76A_ENST00000373954_chr1_28075665_+_WDTC1_ENST00000361771_chr1_27631492_+_330aa
MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLTGTPKPCQTCNIIAAFIGNKCQRCTN
SEKKTGPPTSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQTSRLSGGGHTNSQKTLSTSSI
QNEIPKKKSKFESITTNGDSNAQTIVSGSDDGSFFIWEKETTNLVRVLQGDESIVNCLQPHPSYCFLATSGIDPVVRLWNPRPESEDLTG

>In-frame_FAM76A_ENST00000530324_chr1_28075665_+_WDTC1_ENST00000319394_chr1_27631492_+_330aa
MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLTGTPKPCQTCNIIAAFIGNKCQRCTN
SEKKTGPPTSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQTSRLSGGGHTNSQKTLSTSSI
QNEIPKKKSKFESITTNGDSNAQTIVSGSDDGSFFIWEKETTNLVRVLQGDESIVNCLQPHPSYCFLATSGIDPVVRLWNPRPESEDLTG

>In-frame_FAM76A_ENST00000530324_chr1_28075665_+_WDTC1_ENST00000361771_chr1_27631492_+_330aa
MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLTGTPKPCQTCNIIAAFIGNKCQRCTN
SEKKTGPPTSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQTSRLSGGGHTNSQKTLSTSSI
QNEIPKKKSKFESITTNGDSNAQTIVSGSDDGSFFIWEKETTNLVRVLQGDESIVNCLQPHPSYCFLATSGIDPVVRLWNPRPESEDLTG

>In-frame_FAM76A_ENST00000010299_chr1_28075665_+_WDTC1_ENST00000319394_chr1_27631492_+_364aa
MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQERLECNGTISAHCNLHLPGSSDSPASSSRVAGITGIKTNTICK
KCAQNVQLTGTPKPCQTCNIIAAFIGNKCQRCTNSEKKTGPPTSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHL
SSSSRAGHQEKEQTSRLSGGGHTNSQKTLSTSSIQNEIPKKKSKFESITTNGDSNAQTIVSGSDDGSFFIWEKETTNLVRVLQGDESIVN
CLQPHPSYCFLATSGIDPVVRLWNPRPESEDLTGRVVEDMEGASQANQRRMNADPLEVMLLNMGYRITGLSSGGAGASDDEDSSEGQVQC

>In-frame_FAM76A_ENST00000010299_chr1_28075665_+_WDTC1_ENST00000361771_chr1_27631492_+_364aa
MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQERLECNGTISAHCNLHLPGSSDSPASSSRVAGITGIKTNTICK
KCAQNVQLTGTPKPCQTCNIIAAFIGNKCQRCTNSEKKTGPPTSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHL
SSSSRAGHQEKEQTSRLSGGGHTNSQKTLSTSSIQNEIPKKKSKFESITTNGDSNAQTIVSGSDDGSFFIWEKETTNLVRVLQGDESIVN
CLQPHPSYCFLATSGIDPVVRLWNPRPESEDLTGRVVEDMEGASQANQRRMNADPLEVMLLNMGYRITGLSSGGAGASDDEDSSEGQVQC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FAM76A_ENST00000373954_chr1_28075665_+_WDTC1_ENST00000319394_chr1_27631492_+_990nt
ATGGCGGCGCTCTACGCCTGCACCAAGTGCCACCAGCGCTTCCCCTTCGAGGCGCTGTCTCAGGGGCAGCAGCTGTGCAAGGAATGTCGG
ATTGCACACCCTGTTGTGAAGTGCACCTACTGCAGGACTGAGTACCAGCAGGAGAGTAAAACCAATACAATATGCAAGAAATGTGCTCAG
AACGTGCAGTTGTATGGAACGCCCAAACCTTGTCAGTATTGCAACATAATTGCAGCATTTATTGGGAATAAATGCCAGCGCTGCACAAAT
TCAGAAAAGAAGTATGGACCACCCTATTCTTGTGAACAGTGCAAGCAGCAGTGTGCATTTGACAGGAAAGATGATAGAAAGAAGGTAGAT
GGGAAATTGCTGTGCTGGCTGTGCACACTTTCATACAAACGGGTCCTTCAGAAGACCAAAGAGCAGAGGAAACACCTGAGTAGCTCTTCT
CGTGCTGGCCACCAGGAGAAGGAGCAGTATAGTCGCCTGAGTGGTGGTGGCCATTATAACAGCCAGAAAACACTTTCTACATCTTCAATT
CAAAATGAAATCCCAAAGAAAAAGTCCAAGTTTGAGTCAATCACAACTAATGGAGACAGCAACGCTCAGTATATCGTCAGTGGCTCTGAC
GATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCA
CACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGC
CGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGC
TACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGCCGGCCCAGCTAG

>In-frame_FAM76A_ENST00000373954_chr1_28075665_+_WDTC1_ENST00000361771_chr1_27631492_+_990nt
ATGGCGGCGCTCTACGCCTGCACCAAGTGCCACCAGCGCTTCCCCTTCGAGGCGCTGTCTCAGGGGCAGCAGCTGTGCAAGGAATGTCGG
ATTGCACACCCTGTTGTGAAGTGCACCTACTGCAGGACTGAGTACCAGCAGGAGAGTAAAACCAATACAATATGCAAGAAATGTGCTCAG
AACGTGCAGTTGTATGGAACGCCCAAACCTTGTCAGTATTGCAACATAATTGCAGCATTTATTGGGAATAAATGCCAGCGCTGCACAAAT
TCAGAAAAGAAGTATGGACCACCCTATTCTTGTGAACAGTGCAAGCAGCAGTGTGCATTTGACAGGAAAGATGATAGAAAGAAGGTAGAT
GGGAAATTGCTGTGCTGGCTGTGCACACTTTCATACAAACGGGTCCTTCAGAAGACCAAAGAGCAGAGGAAACACCTGAGTAGCTCTTCT
CGTGCTGGCCACCAGGAGAAGGAGCAGTATAGTCGCCTGAGTGGTGGTGGCCATTATAACAGCCAGAAAACACTTTCTACATCTTCAATT
CAAAATGAAATCCCAAAGAAAAAGTCCAAGTTTGAGTCAATCACAACTAATGGAGACAGCAACGCTCAGTATATCGTCAGTGGCTCTGAC
GATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCA
CACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGC
CGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGC
TACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGCCGGCCCAGCTAG

>In-frame_FAM76A_ENST00000530324_chr1_28075665_+_WDTC1_ENST00000319394_chr1_27631492_+_990nt
ATGGCGGCGCTCTACGCCTGCACCAAGTGCCACCAGCGCTTCCCCTTCGAGGCGCTGTCTCAGGGGCAGCAGCTGTGCAAGGAATGTCGG
ATTGCACACCCTGTTGTGAAGTGCACCTACTGCAGGACTGAGTACCAGCAGGAGAGTAAAACCAATACAATATGCAAGAAATGTGCTCAG
AACGTGCAGTTGTATGGAACGCCCAAACCTTGTCAGTATTGCAACATAATTGCAGCATTTATTGGGAATAAATGCCAGCGCTGCACAAAT
TCAGAAAAGAAGTATGGACCACCCTATTCTTGTGAACAGTGCAAGCAGCAGTGTGCATTTGACAGGAAAGATGATAGAAAGAAGGTAGAT
GGGAAATTGCTGTGCTGGCTGTGCACACTTTCATACAAACGGGTCCTTCAGAAGACCAAAGAGCAGAGGAAACACCTGAGTAGCTCTTCT
CGTGCTGGCCACCAGGAGAAGGAGCAGTATAGTCGCCTGAGTGGTGGTGGCCATTATAACAGCCAGAAAACACTTTCTACATCTTCAATT
CAAAATGAAATCCCAAAGAAAAAGTCCAAGTTTGAGTCAATCACAACTAATGGAGACAGCAACGCTCAGTATATCGTCAGTGGCTCTGAC
GATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCA
CACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGC
CGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGC
TACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGCCGGCCCAGCTAG

>In-frame_FAM76A_ENST00000530324_chr1_28075665_+_WDTC1_ENST00000361771_chr1_27631492_+_990nt
ATGGCGGCGCTCTACGCCTGCACCAAGTGCCACCAGCGCTTCCCCTTCGAGGCGCTGTCTCAGGGGCAGCAGCTGTGCAAGGAATGTCGG
ATTGCACACCCTGTTGTGAAGTGCACCTACTGCAGGACTGAGTACCAGCAGGAGAGTAAAACCAATACAATATGCAAGAAATGTGCTCAG
AACGTGCAGTTGTATGGAACGCCCAAACCTTGTCAGTATTGCAACATAATTGCAGCATTTATTGGGAATAAATGCCAGCGCTGCACAAAT
TCAGAAAAGAAGTATGGACCACCCTATTCTTGTGAACAGTGCAAGCAGCAGTGTGCATTTGACAGGAAAGATGATAGAAAGAAGGTAGAT
GGGAAATTGCTGTGCTGGCTGTGCACACTTTCATACAAACGGGTCCTTCAGAAGACCAAAGAGCAGAGGAAACACCTGAGTAGCTCTTCT
CGTGCTGGCCACCAGGAGAAGGAGCAGTATAGTCGCCTGAGTGGTGGTGGCCATTATAACAGCCAGAAAACACTTTCTACATCTTCAATT
CAAAATGAAATCCCAAAGAAAAAGTCCAAGTTTGAGTCAATCACAACTAATGGAGACAGCAACGCTCAGTATATCGTCAGTGGCTCTGAC
GATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCA
CACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGC
CGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGC
TACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGCCGGCCCAGCTAG

>In-frame_FAM76A_ENST00000010299_chr1_28075665_+_WDTC1_ENST00000319394_chr1_27631492_+_1092nt
ATGGCGGCGCTCTACGCCTGCACCAAGTGCCACCAGCGCTTCCCCTTCGAGGCGCTGTCTCAGGGGCAGCAGCTGTGCAAGGAATGTCGG
ATTGCACACCCTGTTGTGAAGTGCACCTACTGCAGGACTGAGTACCAGCAGGAGAGGCTAGAGTGCAATGGCACGATCTCGGCTCACTGC
AACCTCCACCTCCCAGGTTCAAGCGATTCTCCTGCCTCATCCTCCCGAGTAGCTGGGATTACAGGCATTAAAACCAATACAATATGCAAG
AAATGTGCTCAGAACGTGCAGTTGTATGGAACGCCCAAACCTTGTCAGTATTGCAACATAATTGCAGCATTTATTGGGAATAAATGCCAG
CGCTGCACAAATTCAGAAAAGAAGTATGGACCACCCTATTCTTGTGAACAGTGCAAGCAGCAGTGTGCATTTGACAGGAAAGATGATAGA
AAGAAGGTAGATGGGAAATTGCTGTGCTGGCTGTGCACACTTTCATACAAACGGGTCCTTCAGAAGACCAAAGAGCAGAGGAAACACCTG
AGTAGCTCTTCTCGTGCTGGCCACCAGGAGAAGGAGCAGTATAGTCGCCTGAGTGGTGGTGGCCATTATAACAGCCAGAAAACACTTTCT
ACATCTTCAATTCAAAATGAAATCCCAAAGAAAAAGTCCAAGTTTGAGTCAATCACAACTAATGGAGACAGCAACGCTCAGTATATCGTC
AGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAAC
TGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAA
GACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTG
CTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGC

>In-frame_FAM76A_ENST00000010299_chr1_28075665_+_WDTC1_ENST00000361771_chr1_27631492_+_1092nt
ATGGCGGCGCTCTACGCCTGCACCAAGTGCCACCAGCGCTTCCCCTTCGAGGCGCTGTCTCAGGGGCAGCAGCTGTGCAAGGAATGTCGG
ATTGCACACCCTGTTGTGAAGTGCACCTACTGCAGGACTGAGTACCAGCAGGAGAGGCTAGAGTGCAATGGCACGATCTCGGCTCACTGC
AACCTCCACCTCCCAGGTTCAAGCGATTCTCCTGCCTCATCCTCCCGAGTAGCTGGGATTACAGGCATTAAAACCAATACAATATGCAAG
AAATGTGCTCAGAACGTGCAGTTGTATGGAACGCCCAAACCTTGTCAGTATTGCAACATAATTGCAGCATTTATTGGGAATAAATGCCAG
CGCTGCACAAATTCAGAAAAGAAGTATGGACCACCCTATTCTTGTGAACAGTGCAAGCAGCAGTGTGCATTTGACAGGAAAGATGATAGA
AAGAAGGTAGATGGGAAATTGCTGTGCTGGCTGTGCACACTTTCATACAAACGGGTCCTTCAGAAGACCAAAGAGCAGAGGAAACACCTG
AGTAGCTCTTCTCGTGCTGGCCACCAGGAGAAGGAGCAGTATAGTCGCCTGAGTGGTGGTGGCCATTATAACAGCCAGAAAACACTTTCT
ACATCTTCAATTCAAAATGAAATCCCAAAGAAAAAGTCCAAGTTTGAGTCAATCACAACTAATGGAGACAGCAACGCTCAGTATATCGTC
AGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAAC
TGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAA
GACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTG
CTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_FAM76A_ENST00000373954_chr1_28075665_+_WDTC1_ENST00000319394_chr1_27631492_+_3328nt
GCCGCAGCCAGCAGCCTGCAGCCGCCGCCGGGTTGTGCCTCAGACTGTCAGATAAATCGGCGGGCCGGGCCGGCGGGTCGGTGAGCGCGG
CCCGGGCCGGACATGGCGGCGCTCTACGCCTGCACCAAGTGCCACCAGCGCTTCCCCTTCGAGGCGCTGTCTCAGGGGCAGCAGCTGTGC
AAGGAATGTCGGATTGCACACCCTGTTGTGAAGTGCACCTACTGCAGGACTGAGTACCAGCAGGAGAGTAAAACCAATACAATATGCAAG
AAATGTGCTCAGAACGTGCAGTTGTATGGAACGCCCAAACCTTGTCAGTATTGCAACATAATTGCAGCATTTATTGGGAATAAATGCCAG
CGCTGCACAAATTCAGAAAAGAAGTATGGACCACCCTATTCTTGTGAACAGTGCAAGCAGCAGTGTGCATTTGACAGGAAAGATGATAGA
AAGAAGGTAGATGGGAAATTGCTGTGCTGGCTGTGCACACTTTCATACAAACGGGTCCTTCAGAAGACCAAAGAGCAGAGGAAACACCTG
AGTAGCTCTTCTCGTGCTGGCCACCAGGAGAAGGAGCAGTATAGTCGCCTGAGTGGTGGTGGCCATTATAACAGCCAGAAAACACTTTCT
ACATCTTCAATTCAAAATGAAATCCCAAAGAAAAAGTCCAAGTTTGAGTCAATCACAACTAATGGAGACAGCAACGCTCAGTATATCGTC
AGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAAC
TGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAA
GACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTG
CTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGC
CGGCCCAGCTAGACCCTCCAGCCCTGGTCCCCAGCCCCTGCTACTGGCTGGACCCTCTGCCCTGGGCAGGAGGTCAGGGGATTCTGTTTT
GGTTTGTCTTCCCCACCACCCTTTTTTTTCATTTCCCCTGTTTTGTTTGTTAGTTTGGCGTTAGGGGTGGAGGTTGCTACAACTTGCTGG
CTTTCGGACTCTGGGCTGATTGTCCCCTGACTATCCCCAGCCCTGAAAAAAAGAGCAGGAGGGGACACCCCTCCATATGCCCCCCCCCAT
CTCCTGCTTTCATGTCCCTGGAGGGCTCTGGCCTGCCTCAAAACCCCTTCTGCCTCAGGTGGGGAGGAACAAGCTGAACTGTCTTCAGGG
ACTGTCCTGCCCTTTAGCTGGCAGCAGCAGGAGGAGTGGGATTCCCAATTGGTAAGGGCTCGCCTTGGCCTGTTGCCACTCTTGCTCCCT
AGCCTGCAAGGCTAGCTCCCCTGTGGTCTTCAGGAAAGGTTTTGAAAAAGGATGGGTCCCACCCTCCCTCCAGAGCCACCAGTGTTAGAG
CGGAGCCCAAAGGAAGGATGGGAGCCCTGGAGTGGGCAAGACCAGGCCACCTGCTGAGGTCGCTGTGGAGCACCCTCGCTCCTCTCCTGG
CTACTAGCTCTGGCCCTGCACCTACTCTCACTGGCCACCTCTGGAGGCTCTGCCTTTCCCAAGGGCCCTGGCAGAGGGTGGGGCACTGCA
CCTTACCCCACCCATCCATGCCAGCACTTCTGCACTACGGCCATTCTCCTCTTGGGCGCTCCTCAGCCTCACTGTGACCTTTCTGCCAGA
GCTCCCAGCCAGGCCTACTCTGCTGAGGTGGCGCTTCCTGCTAAGGGCCCTTCTCTGCCCTTTCTGCCCTCCTTCCCATCCCACATGCTG
AGCCGCCACAAAGACCAAAGAAGTGATGGCTTTTCTCTGTCCCCTGCTGCTCTGAGGGGAGAGGGGTGGGTCTCCTGAGCCACTCAGATG
GGAAAGTCCCTTACTCGGCCCCTCCCTCCCCAGCAGCCCCAAGCTTTACACTGGATGCAGCGATCAACCCACCACTCACCAGGCCTCTCC
TCCCCTCTGCCCCCGGCTCTTAGCTCCAGCTGCTCCAGGTAGTTGGTTCATCCTTCCCCCTCTCTCCCTCCCTGCTTCCCCTTCAGTGCT
TACTTGGCTCCAGCCCTCCAGCTGCAGCCCCTGGGGAAAAGCAGCCTCCCTTCTCCTCTCCCTCCACTCCCTCGCTCCCTCCCTCAGCCC
CTGTCTCTGCCAGGTGCCTCCTCTCAGTCAGGCTTCAGAGCAGCCCTGGAGACAGGAGGGCCATGTTAAAAGCTTTTTCACAGTTTTAAG
AAGACAAGTGGAGGGTGAGGATAGTGGTGGGGGGTCTGGCACCATCTCATTGCTTTAATCCCAGCAACACAGGTGGCAGCTTCTCCCCCT
TCCTTCCCACCCCAGTCCCTCTTCCCACCCCTCTCTTCTAGCTTGGTAATGAAGTATATTTATTGGTGAAGGAAACAGCTGCTGCTGCTT
CTCCTGCTGCTGGGACCTGCTCCCCTGTCTCTTCTCCGTGACCTTTCTCTAGCCAGGGAGAAGGGAGAGCAGGAGTATTGGGGCTGGGCC
CTGGGGCCCAAGGACCAGCTGGGTCCCCTTTGCTTTCTTGTGTTCCAGCCACCTGCCATTTCCTCCCTGCCTCCCACCCTCCCTCCCTGC
CCCCTGTCCTGCTTCCCACCCCCTGCCTGCCCAGCCTGGGCCCTGCAGTGTGGAGAGACACATAAGCCTTACTGTCCTCTGGGGGCAGGA
GCCGAGCCTTTTTGTTGCTCCGCTCCCAGGAGAGTGAGGGTGACGCAATTGATTAAAACCATTTTGTTCTAGGTGTGGCTGGTGGCATTT
GTGGGGTGCAGATGGGTCTTGGAACCAAAGTGAGGGCACCTGGTCCCTCACCTCTGTAGCTCTATGACTTAGTAACCACACCTCTACTGG
ACAGAATGAGGCCTGCCTTGAAGGGTCACCGTGAGCAGCGGCCACCCAGCCCAGCAGGGCTGAGTGCAGAGCCCAGCTCTCATGGCTGTG
ATTTGTAATCATCAGCTTTCACTCTCTGGCTGTTTTCTCATCAGTAAAATAAGGGACTTGGAATCTTAGTGGTTTTTCAAACCATTTTAC

>In-frame_FAM76A_ENST00000373954_chr1_28075665_+_WDTC1_ENST00000361771_chr1_27631492_+_2953nt
GCCGCAGCCAGCAGCCTGCAGCCGCCGCCGGGTTGTGCCTCAGACTGTCAGATAAATCGGCGGGCCGGGCCGGCGGGTCGGTGAGCGCGG
CCCGGGCCGGACATGGCGGCGCTCTACGCCTGCACCAAGTGCCACCAGCGCTTCCCCTTCGAGGCGCTGTCTCAGGGGCAGCAGCTGTGC
AAGGAATGTCGGATTGCACACCCTGTTGTGAAGTGCACCTACTGCAGGACTGAGTACCAGCAGGAGAGTAAAACCAATACAATATGCAAG
AAATGTGCTCAGAACGTGCAGTTGTATGGAACGCCCAAACCTTGTCAGTATTGCAACATAATTGCAGCATTTATTGGGAATAAATGCCAG
CGCTGCACAAATTCAGAAAAGAAGTATGGACCACCCTATTCTTGTGAACAGTGCAAGCAGCAGTGTGCATTTGACAGGAAAGATGATAGA
AAGAAGGTAGATGGGAAATTGCTGTGCTGGCTGTGCACACTTTCATACAAACGGGTCCTTCAGAAGACCAAAGAGCAGAGGAAACACCTG
AGTAGCTCTTCTCGTGCTGGCCACCAGGAGAAGGAGCAGTATAGTCGCCTGAGTGGTGGTGGCCATTATAACAGCCAGAAAACACTTTCT
ACATCTTCAATTCAAAATGAAATCCCAAAGAAAAAGTCCAAGTTTGAGTCAATCACAACTAATGGAGACAGCAACGCTCAGTATATCGTC
AGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAAC
TGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAA
GACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTG
CTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGC
CGGCCCAGCTAGACCCTCCAGCCCTGGTCCCCAGCCCCTGCTACTGGCTGGACCCTCTGCCCTGGGCAGGAGGTCAGGGGATTCTGTTTT
GGTTTGTCTTCCCCACCACCCTTTTTTTTCATTTCCCCTGTTTTGTTTGTTAGTTTGGCGTTAGGGGTGGAGGTTGCTACAACTTGCTGG
CTTTCGGACTCTGGGCTGATTGTCCCCTGACTATCCCCAGCCCTGAAAAAAAGAGCAGGAGGGGACACCCCTCCATATGCCCCCCCCCAT
CTCCTGCTTTCATGTCCCTGGAGGGCTCTGGCCTGCCTCAAAACCCCTTCTGCCTCAGGTGGGGAGGAACAAGCTGAACTGTCTTCAGGG
ACTGTCCTGCCCTTTAGCTGGCAGCAGCAGGAGGAGTGGGATTCCCAATTGGTAAGGGCTCGCCTTGGCCTGTTGCCACTCTTGCTCCCT
AGCCTGCAAGGCTAGCTCCCCTGTGGTCTTCAGGAAAGGTTTTGAAAAAGGATGGGTCCCACCCTCCCTCCAGAGCCACCAGTGTTAGAG
CGGAGCCCAAAGGAAGGATGGGAGCCCTGGAGTGGGCAAGACCAGGCCACCTGCTGAGGTCGCTGTGGAGCACCCTCGCTCCTCTCCTGG
CTACTAGCTCTGGCCCTGCACCTACTCTCACTGGCCACCTCTGGAGGCTCTGCCTTTCCCAAGGGCCCTGGCAGAGGGTGGGGCACTGCA
CCTTACCCCACCCATCCATGCCAGCACTTCTGCACTACGGCCATTCTCCTCTTGGGCGCTCCTCAGCCTCACTGTGACCTTTCTGCCAGA
GCTCCCAGCCAGGCCTACTCTGCTGAGGTGGCGCTTCCTGCTAAGGGCCCTTCTCTGCCCTTTCTGCCCTCCTTCCCATCCCACATGCTG
AGCCGCCACAAAGACCAAAGAAGTGATGGCTTTTCTCTGTCCCCTGCTGCTCTGAGGGGAGAGGGGTGGGTCTCCTGAGCCACTCAGATG
GGAAAGTCCCTTACTCGGCCCCTCCCTCCCCAGCAGCCCCAAGCTTTACACTGGATGCAGCGATCAACCCACCACTCACCAGGCCTCTCC
TCCCCTCTGCCCCCGGCTCTTAGCTCCAGCTGCTCCAGGTAGTTGGTTCATCCTTCCCCCTCTCTCCCTCCCTGCTTCCCCTTCAGTGCT
TACTTGGCTCCAGCCCTCCAGCTGCAGCCCCTGGGGAAAAGCAGCCTCCCTTCTCCTCTCCCTCCACTCCCTCGCTCCCTCCCTCAGCCC
CTGTCTCTGCCAGGTGCCTCCTCTCAGTCAGGCTTCAGAGCAGCCCTGGAGACAGGAGGGCCATGTTAAAAGCTTTTTCACAGTTTTAAG
AAGACAAGTGGAGGGTGAGGATAGTGGTGGGGGGTCTGGCACCATCTCATTGCTTTAATCCCAGCAACACAGGTGGCAGCTTCTCCCCCT
TCCTTCCCACCCCAGTCCCTCTTCCCACCCCTCTCTTCTAGCTTGGTAATGAAGTATATTTATTGGTGAAGGAAACAGCTGCTGCTGCTT
CTCCTGCTGCTGGGACCTGCTCCCCTGTCTCTTCTCCGTGACCTTTCTCTAGCCAGGGAGAAGGGAGAGCAGGAGTATTGGGGCTGGGCC
CTGGGGCCCAAGGACCAGCTGGGTCCCCTTTGCTTTCTTGTGTTCCAGCCACCTGCCATTTCCTCCCTGCCTCCCACCCTCCCTCCCTGC
CCCCTGTCCTGCTTCCCACCCCCTGCCTGCCCAGCCTGGGCCCTGCAGTGTGGAGAGACACATAAGCCTTACTGTCCTCTGGGGGCAGGA

>In-frame_FAM76A_ENST00000530324_chr1_28075665_+_WDTC1_ENST00000319394_chr1_27631492_+_3279nt
AGATAAATCGGCGGGCCGGGCCGGCGGGTCGGTGAGCGCGGCCCGGGCCGGACATGGCGGCGCTCTACGCCTGCACCAAGTGCCACCAGC
GCTTCCCCTTCGAGGCGCTGTCTCAGGGGCAGCAGCTGTGCAAGGAATGTCGGATTGCACACCCTGTTGTGAAGTGCACCTACTGCAGGA
CTGAGTACCAGCAGGAGAGTAAAACCAATACAATATGCAAGAAATGTGCTCAGAACGTGCAGTTGTATGGAACGCCCAAACCTTGTCAGT
ATTGCAACATAATTGCAGCATTTATTGGGAATAAATGCCAGCGCTGCACAAATTCAGAAAAGAAGTATGGACCACCCTATTCTTGTGAAC
AGTGCAAGCAGCAGTGTGCATTTGACAGGAAAGATGATAGAAAGAAGGTAGATGGGAAATTGCTGTGCTGGCTGTGCACACTTTCATACA
AACGGGTCCTTCAGAAGACCAAAGAGCAGAGGAAACACCTGAGTAGCTCTTCTCGTGCTGGCCACCAGGAGAAGGAGCAGTATAGTCGCC
TGAGTGGTGGTGGCCATTATAACAGCCAGAAAACACTTTCTACATCTTCAATTCAAAATGAAATCCCAAAGAAAAAGTCCAAGTTTGAGT
CAATCACAACTAATGGAGACAGCAACGCTCAGTATATCGTCAGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCA
ACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCG
ATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCA
ACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGG
CCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGCCGGCCCAGCTAGACCCTCCAGCCCTGGTCCCCAGCCCCTGCTACTGGCT
GGACCCTCTGCCCTGGGCAGGAGGTCAGGGGATTCTGTTTTGGTTTGTCTTCCCCACCACCCTTTTTTTTCATTTCCCCTGTTTTGTTTG
TTAGTTTGGCGTTAGGGGTGGAGGTTGCTACAACTTGCTGGCTTTCGGACTCTGGGCTGATTGTCCCCTGACTATCCCCAGCCCTGAAAA
AAAGAGCAGGAGGGGACACCCCTCCATATGCCCCCCCCCATCTCCTGCTTTCATGTCCCTGGAGGGCTCTGGCCTGCCTCAAAACCCCTT
CTGCCTCAGGTGGGGAGGAACAAGCTGAACTGTCTTCAGGGACTGTCCTGCCCTTTAGCTGGCAGCAGCAGGAGGAGTGGGATTCCCAAT
TGGTAAGGGCTCGCCTTGGCCTGTTGCCACTCTTGCTCCCTAGCCTGCAAGGCTAGCTCCCCTGTGGTCTTCAGGAAAGGTTTTGAAAAA
GGATGGGTCCCACCCTCCCTCCAGAGCCACCAGTGTTAGAGCGGAGCCCAAAGGAAGGATGGGAGCCCTGGAGTGGGCAAGACCAGGCCA
CCTGCTGAGGTCGCTGTGGAGCACCCTCGCTCCTCTCCTGGCTACTAGCTCTGGCCCTGCACCTACTCTCACTGGCCACCTCTGGAGGCT
CTGCCTTTCCCAAGGGCCCTGGCAGAGGGTGGGGCACTGCACCTTACCCCACCCATCCATGCCAGCACTTCTGCACTACGGCCATTCTCC
TCTTGGGCGCTCCTCAGCCTCACTGTGACCTTTCTGCCAGAGCTCCCAGCCAGGCCTACTCTGCTGAGGTGGCGCTTCCTGCTAAGGGCC
CTTCTCTGCCCTTTCTGCCCTCCTTCCCATCCCACATGCTGAGCCGCCACAAAGACCAAAGAAGTGATGGCTTTTCTCTGTCCCCTGCTG
CTCTGAGGGGAGAGGGGTGGGTCTCCTGAGCCACTCAGATGGGAAAGTCCCTTACTCGGCCCCTCCCTCCCCAGCAGCCCCAAGCTTTAC
ACTGGATGCAGCGATCAACCCACCACTCACCAGGCCTCTCCTCCCCTCTGCCCCCGGCTCTTAGCTCCAGCTGCTCCAGGTAGTTGGTTC
ATCCTTCCCCCTCTCTCCCTCCCTGCTTCCCCTTCAGTGCTTACTTGGCTCCAGCCCTCCAGCTGCAGCCCCTGGGGAAAAGCAGCCTCC
CTTCTCCTCTCCCTCCACTCCCTCGCTCCCTCCCTCAGCCCCTGTCTCTGCCAGGTGCCTCCTCTCAGTCAGGCTTCAGAGCAGCCCTGG
AGACAGGAGGGCCATGTTAAAAGCTTTTTCACAGTTTTAAGAAGACAAGTGGAGGGTGAGGATAGTGGTGGGGGGTCTGGCACCATCTCA
TTGCTTTAATCCCAGCAACACAGGTGGCAGCTTCTCCCCCTTCCTTCCCACCCCAGTCCCTCTTCCCACCCCTCTCTTCTAGCTTGGTAA
TGAAGTATATTTATTGGTGAAGGAAACAGCTGCTGCTGCTTCTCCTGCTGCTGGGACCTGCTCCCCTGTCTCTTCTCCGTGACCTTTCTC
TAGCCAGGGAGAAGGGAGAGCAGGAGTATTGGGGCTGGGCCCTGGGGCCCAAGGACCAGCTGGGTCCCCTTTGCTTTCTTGTGTTCCAGC
CACCTGCCATTTCCTCCCTGCCTCCCACCCTCCCTCCCTGCCCCCTGTCCTGCTTCCCACCCCCTGCCTGCCCAGCCTGGGCCCTGCAGT
GTGGAGAGACACATAAGCCTTACTGTCCTCTGGGGGCAGGAGCCGAGCCTTTTTGTTGCTCCGCTCCCAGGAGAGTGAGGGTGACGCAAT
TGATTAAAACCATTTTGTTCTAGGTGTGGCTGGTGGCATTTGTGGGGTGCAGATGGGTCTTGGAACCAAAGTGAGGGCACCTGGTCCCTC
ACCTCTGTAGCTCTATGACTTAGTAACCACACCTCTACTGGACAGAATGAGGCCTGCCTTGAAGGGTCACCGTGAGCAGCGGCCACCCAG
CCCAGCAGGGCTGAGTGCAGAGCCCAGCTCTCATGGCTGTGATTTGTAATCATCAGCTTTCACTCTCTGGCTGTTTTCTCATCAGTAAAA
TAAGGGACTTGGAATCTTAGTGGTTTTTCAAACCATTTTACATTGTGACCCAATATACACATGATTACTTGTAGATATGTGTGTGTGTAT

>In-frame_FAM76A_ENST00000530324_chr1_28075665_+_WDTC1_ENST00000361771_chr1_27631492_+_2904nt
AGATAAATCGGCGGGCCGGGCCGGCGGGTCGGTGAGCGCGGCCCGGGCCGGACATGGCGGCGCTCTACGCCTGCACCAAGTGCCACCAGC
GCTTCCCCTTCGAGGCGCTGTCTCAGGGGCAGCAGCTGTGCAAGGAATGTCGGATTGCACACCCTGTTGTGAAGTGCACCTACTGCAGGA
CTGAGTACCAGCAGGAGAGTAAAACCAATACAATATGCAAGAAATGTGCTCAGAACGTGCAGTTGTATGGAACGCCCAAACCTTGTCAGT
ATTGCAACATAATTGCAGCATTTATTGGGAATAAATGCCAGCGCTGCACAAATTCAGAAAAGAAGTATGGACCACCCTATTCTTGTGAAC
AGTGCAAGCAGCAGTGTGCATTTGACAGGAAAGATGATAGAAAGAAGGTAGATGGGAAATTGCTGTGCTGGCTGTGCACACTTTCATACA
AACGGGTCCTTCAGAAGACCAAAGAGCAGAGGAAACACCTGAGTAGCTCTTCTCGTGCTGGCCACCAGGAGAAGGAGCAGTATAGTCGCC
TGAGTGGTGGTGGCCATTATAACAGCCAGAAAACACTTTCTACATCTTCAATTCAAAATGAAATCCCAAAGAAAAAGTCCAAGTTTGAGT
CAATCACAACTAATGGAGACAGCAACGCTCAGTATATCGTCAGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCA
ACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCG
ATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCA
ACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGG
CCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGCCGGCCCAGCTAGACCCTCCAGCCCTGGTCCCCAGCCCCTGCTACTGGCT
GGACCCTCTGCCCTGGGCAGGAGGTCAGGGGATTCTGTTTTGGTTTGTCTTCCCCACCACCCTTTTTTTTCATTTCCCCTGTTTTGTTTG
TTAGTTTGGCGTTAGGGGTGGAGGTTGCTACAACTTGCTGGCTTTCGGACTCTGGGCTGATTGTCCCCTGACTATCCCCAGCCCTGAAAA
AAAGAGCAGGAGGGGACACCCCTCCATATGCCCCCCCCCATCTCCTGCTTTCATGTCCCTGGAGGGCTCTGGCCTGCCTCAAAACCCCTT
CTGCCTCAGGTGGGGAGGAACAAGCTGAACTGTCTTCAGGGACTGTCCTGCCCTTTAGCTGGCAGCAGCAGGAGGAGTGGGATTCCCAAT
TGGTAAGGGCTCGCCTTGGCCTGTTGCCACTCTTGCTCCCTAGCCTGCAAGGCTAGCTCCCCTGTGGTCTTCAGGAAAGGTTTTGAAAAA
GGATGGGTCCCACCCTCCCTCCAGAGCCACCAGTGTTAGAGCGGAGCCCAAAGGAAGGATGGGAGCCCTGGAGTGGGCAAGACCAGGCCA
CCTGCTGAGGTCGCTGTGGAGCACCCTCGCTCCTCTCCTGGCTACTAGCTCTGGCCCTGCACCTACTCTCACTGGCCACCTCTGGAGGCT
CTGCCTTTCCCAAGGGCCCTGGCAGAGGGTGGGGCACTGCACCTTACCCCACCCATCCATGCCAGCACTTCTGCACTACGGCCATTCTCC
TCTTGGGCGCTCCTCAGCCTCACTGTGACCTTTCTGCCAGAGCTCCCAGCCAGGCCTACTCTGCTGAGGTGGCGCTTCCTGCTAAGGGCC
CTTCTCTGCCCTTTCTGCCCTCCTTCCCATCCCACATGCTGAGCCGCCACAAAGACCAAAGAAGTGATGGCTTTTCTCTGTCCCCTGCTG
CTCTGAGGGGAGAGGGGTGGGTCTCCTGAGCCACTCAGATGGGAAAGTCCCTTACTCGGCCCCTCCCTCCCCAGCAGCCCCAAGCTTTAC
ACTGGATGCAGCGATCAACCCACCACTCACCAGGCCTCTCCTCCCCTCTGCCCCCGGCTCTTAGCTCCAGCTGCTCCAGGTAGTTGGTTC
ATCCTTCCCCCTCTCTCCCTCCCTGCTTCCCCTTCAGTGCTTACTTGGCTCCAGCCCTCCAGCTGCAGCCCCTGGGGAAAAGCAGCCTCC
CTTCTCCTCTCCCTCCACTCCCTCGCTCCCTCCCTCAGCCCCTGTCTCTGCCAGGTGCCTCCTCTCAGTCAGGCTTCAGAGCAGCCCTGG
AGACAGGAGGGCCATGTTAAAAGCTTTTTCACAGTTTTAAGAAGACAAGTGGAGGGTGAGGATAGTGGTGGGGGGTCTGGCACCATCTCA
TTGCTTTAATCCCAGCAACACAGGTGGCAGCTTCTCCCCCTTCCTTCCCACCCCAGTCCCTCTTCCCACCCCTCTCTTCTAGCTTGGTAA
TGAAGTATATTTATTGGTGAAGGAAACAGCTGCTGCTGCTTCTCCTGCTGCTGGGACCTGCTCCCCTGTCTCTTCTCCGTGACCTTTCTC
TAGCCAGGGAGAAGGGAGAGCAGGAGTATTGGGGCTGGGCCCTGGGGCCCAAGGACCAGCTGGGTCCCCTTTGCTTTCTTGTGTTCCAGC
CACCTGCCATTTCCTCCCTGCCTCCCACCCTCCCTCCCTGCCCCCTGTCCTGCTTCCCACCCCCTGCCTGCCCAGCCTGGGCCCTGCAGT
GTGGAGAGACACATAAGCCTTACTGTCCTCTGGGGGCAGGAGCCGAGCCTTTTTGTTGCTCCGCTCCCAGGAGAGTGAGGGTGACGCAAT

>In-frame_FAM76A_ENST00000010299_chr1_28075665_+_WDTC1_ENST00000319394_chr1_27631492_+_3352nt
CGGTGAGCGCGGCCCGGGCCGGACATGGCGGCGCTCTACGCCTGCACCAAGTGCCACCAGCGCTTCCCCTTCGAGGCGCTGTCTCAGGGG
CAGCAGCTGTGCAAGGAATGTCGGATTGCACACCCTGTTGTGAAGTGCACCTACTGCAGGACTGAGTACCAGCAGGAGAGGCTAGAGTGC
AATGGCACGATCTCGGCTCACTGCAACCTCCACCTCCCAGGTTCAAGCGATTCTCCTGCCTCATCCTCCCGAGTAGCTGGGATTACAGGC
ATTAAAACCAATACAATATGCAAGAAATGTGCTCAGAACGTGCAGTTGTATGGAACGCCCAAACCTTGTCAGTATTGCAACATAATTGCA
GCATTTATTGGGAATAAATGCCAGCGCTGCACAAATTCAGAAAAGAAGTATGGACCACCCTATTCTTGTGAACAGTGCAAGCAGCAGTGT
GCATTTGACAGGAAAGATGATAGAAAGAAGGTAGATGGGAAATTGCTGTGCTGGCTGTGCACACTTTCATACAAACGGGTCCTTCAGAAG
ACCAAAGAGCAGAGGAAACACCTGAGTAGCTCTTCTCGTGCTGGCCACCAGGAGAAGGAGCAGTATAGTCGCCTGAGTGGTGGTGGCCAT
TATAACAGCCAGAAAACACTTTCTACATCTTCAATTCAAAATGAAATCCCAAAGAAAAAGTCCAAGTTTGAGTCAATCACAACTAATGGA
GACAGCAACGCTCAGTATATCGTCAGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTC
CAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTC
TGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAAT
GCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGAC
AGCTCTGAGGGCCAGGTGCAGTGCCGGCCCAGCTAGACCCTCCAGCCCTGGTCCCCAGCCCCTGCTACTGGCTGGACCCTCTGCCCTGGG
CAGGAGGTCAGGGGATTCTGTTTTGGTTTGTCTTCCCCACCACCCTTTTTTTTCATTTCCCCTGTTTTGTTTGTTAGTTTGGCGTTAGGG
GTGGAGGTTGCTACAACTTGCTGGCTTTCGGACTCTGGGCTGATTGTCCCCTGACTATCCCCAGCCCTGAAAAAAAGAGCAGGAGGGGAC
ACCCCTCCATATGCCCCCCCCCATCTCCTGCTTTCATGTCCCTGGAGGGCTCTGGCCTGCCTCAAAACCCCTTCTGCCTCAGGTGGGGAG
GAACAAGCTGAACTGTCTTCAGGGACTGTCCTGCCCTTTAGCTGGCAGCAGCAGGAGGAGTGGGATTCCCAATTGGTAAGGGCTCGCCTT
GGCCTGTTGCCACTCTTGCTCCCTAGCCTGCAAGGCTAGCTCCCCTGTGGTCTTCAGGAAAGGTTTTGAAAAAGGATGGGTCCCACCCTC
CCTCCAGAGCCACCAGTGTTAGAGCGGAGCCCAAAGGAAGGATGGGAGCCCTGGAGTGGGCAAGACCAGGCCACCTGCTGAGGTCGCTGT
GGAGCACCCTCGCTCCTCTCCTGGCTACTAGCTCTGGCCCTGCACCTACTCTCACTGGCCACCTCTGGAGGCTCTGCCTTTCCCAAGGGC
CCTGGCAGAGGGTGGGGCACTGCACCTTACCCCACCCATCCATGCCAGCACTTCTGCACTACGGCCATTCTCCTCTTGGGCGCTCCTCAG
CCTCACTGTGACCTTTCTGCCAGAGCTCCCAGCCAGGCCTACTCTGCTGAGGTGGCGCTTCCTGCTAAGGGCCCTTCTCTGCCCTTTCTG
CCCTCCTTCCCATCCCACATGCTGAGCCGCCACAAAGACCAAAGAAGTGATGGCTTTTCTCTGTCCCCTGCTGCTCTGAGGGGAGAGGGG
TGGGTCTCCTGAGCCACTCAGATGGGAAAGTCCCTTACTCGGCCCCTCCCTCCCCAGCAGCCCCAAGCTTTACACTGGATGCAGCGATCA
ACCCACCACTCACCAGGCCTCTCCTCCCCTCTGCCCCCGGCTCTTAGCTCCAGCTGCTCCAGGTAGTTGGTTCATCCTTCCCCCTCTCTC
CCTCCCTGCTTCCCCTTCAGTGCTTACTTGGCTCCAGCCCTCCAGCTGCAGCCCCTGGGGAAAAGCAGCCTCCCTTCTCCTCTCCCTCCA
CTCCCTCGCTCCCTCCCTCAGCCCCTGTCTCTGCCAGGTGCCTCCTCTCAGTCAGGCTTCAGAGCAGCCCTGGAGACAGGAGGGCCATGT
TAAAAGCTTTTTCACAGTTTTAAGAAGACAAGTGGAGGGTGAGGATAGTGGTGGGGGGTCTGGCACCATCTCATTGCTTTAATCCCAGCA
ACACAGGTGGCAGCTTCTCCCCCTTCCTTCCCACCCCAGTCCCTCTTCCCACCCCTCTCTTCTAGCTTGGTAATGAAGTATATTTATTGG
TGAAGGAAACAGCTGCTGCTGCTTCTCCTGCTGCTGGGACCTGCTCCCCTGTCTCTTCTCCGTGACCTTTCTCTAGCCAGGGAGAAGGGA
GAGCAGGAGTATTGGGGCTGGGCCCTGGGGCCCAAGGACCAGCTGGGTCCCCTTTGCTTTCTTGTGTTCCAGCCACCTGCCATTTCCTCC
CTGCCTCCCACCCTCCCTCCCTGCCCCCTGTCCTGCTTCCCACCCCCTGCCTGCCCAGCCTGGGCCCTGCAGTGTGGAGAGACACATAAG
CCTTACTGTCCTCTGGGGGCAGGAGCCGAGCCTTTTTGTTGCTCCGCTCCCAGGAGAGTGAGGGTGACGCAATTGATTAAAACCATTTTG
TTCTAGGTGTGGCTGGTGGCATTTGTGGGGTGCAGATGGGTCTTGGAACCAAAGTGAGGGCACCTGGTCCCTCACCTCTGTAGCTCTATG
ACTTAGTAACCACACCTCTACTGGACAGAATGAGGCCTGCCTTGAAGGGTCACCGTGAGCAGCGGCCACCCAGCCCAGCAGGGCTGAGTG
CAGAGCCCAGCTCTCATGGCTGTGATTTGTAATCATCAGCTTTCACTCTCTGGCTGTTTTCTCATCAGTAAAATAAGGGACTTGGAATCT
TAGTGGTTTTTCAAACCATTTTACATTGTGACCCAATATACACATGATTACTTGTAGATATGTGTGTGTGTATATATATATAAAAAAAAT

>In-frame_FAM76A_ENST00000010299_chr1_28075665_+_WDTC1_ENST00000361771_chr1_27631492_+_2977nt
CGGTGAGCGCGGCCCGGGCCGGACATGGCGGCGCTCTACGCCTGCACCAAGTGCCACCAGCGCTTCCCCTTCGAGGCGCTGTCTCAGGGG
CAGCAGCTGTGCAAGGAATGTCGGATTGCACACCCTGTTGTGAAGTGCACCTACTGCAGGACTGAGTACCAGCAGGAGAGGCTAGAGTGC
AATGGCACGATCTCGGCTCACTGCAACCTCCACCTCCCAGGTTCAAGCGATTCTCCTGCCTCATCCTCCCGAGTAGCTGGGATTACAGGC
ATTAAAACCAATACAATATGCAAGAAATGTGCTCAGAACGTGCAGTTGTATGGAACGCCCAAACCTTGTCAGTATTGCAACATAATTGCA
GCATTTATTGGGAATAAATGCCAGCGCTGCACAAATTCAGAAAAGAAGTATGGACCACCCTATTCTTGTGAACAGTGCAAGCAGCAGTGT
GCATTTGACAGGAAAGATGATAGAAAGAAGGTAGATGGGAAATTGCTGTGCTGGCTGTGCACACTTTCATACAAACGGGTCCTTCAGAAG
ACCAAAGAGCAGAGGAAACACCTGAGTAGCTCTTCTCGTGCTGGCCACCAGGAGAAGGAGCAGTATAGTCGCCTGAGTGGTGGTGGCCAT
TATAACAGCCAGAAAACACTTTCTACATCTTCAATTCAAAATGAAATCCCAAAGAAAAAGTCCAAGTTTGAGTCAATCACAACTAATGGA
GACAGCAACGCTCAGTATATCGTCAGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTC
CAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTC
TGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAAT
GCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGAC
AGCTCTGAGGGCCAGGTGCAGTGCCGGCCCAGCTAGACCCTCCAGCCCTGGTCCCCAGCCCCTGCTACTGGCTGGACCCTCTGCCCTGGG
CAGGAGGTCAGGGGATTCTGTTTTGGTTTGTCTTCCCCACCACCCTTTTTTTTCATTTCCCCTGTTTTGTTTGTTAGTTTGGCGTTAGGG
GTGGAGGTTGCTACAACTTGCTGGCTTTCGGACTCTGGGCTGATTGTCCCCTGACTATCCCCAGCCCTGAAAAAAAGAGCAGGAGGGGAC
ACCCCTCCATATGCCCCCCCCCATCTCCTGCTTTCATGTCCCTGGAGGGCTCTGGCCTGCCTCAAAACCCCTTCTGCCTCAGGTGGGGAG
GAACAAGCTGAACTGTCTTCAGGGACTGTCCTGCCCTTTAGCTGGCAGCAGCAGGAGGAGTGGGATTCCCAATTGGTAAGGGCTCGCCTT
GGCCTGTTGCCACTCTTGCTCCCTAGCCTGCAAGGCTAGCTCCCCTGTGGTCTTCAGGAAAGGTTTTGAAAAAGGATGGGTCCCACCCTC
CCTCCAGAGCCACCAGTGTTAGAGCGGAGCCCAAAGGAAGGATGGGAGCCCTGGAGTGGGCAAGACCAGGCCACCTGCTGAGGTCGCTGT
GGAGCACCCTCGCTCCTCTCCTGGCTACTAGCTCTGGCCCTGCACCTACTCTCACTGGCCACCTCTGGAGGCTCTGCCTTTCCCAAGGGC
CCTGGCAGAGGGTGGGGCACTGCACCTTACCCCACCCATCCATGCCAGCACTTCTGCACTACGGCCATTCTCCTCTTGGGCGCTCCTCAG
CCTCACTGTGACCTTTCTGCCAGAGCTCCCAGCCAGGCCTACTCTGCTGAGGTGGCGCTTCCTGCTAAGGGCCCTTCTCTGCCCTTTCTG
CCCTCCTTCCCATCCCACATGCTGAGCCGCCACAAAGACCAAAGAAGTGATGGCTTTTCTCTGTCCCCTGCTGCTCTGAGGGGAGAGGGG
TGGGTCTCCTGAGCCACTCAGATGGGAAAGTCCCTTACTCGGCCCCTCCCTCCCCAGCAGCCCCAAGCTTTACACTGGATGCAGCGATCA
ACCCACCACTCACCAGGCCTCTCCTCCCCTCTGCCCCCGGCTCTTAGCTCCAGCTGCTCCAGGTAGTTGGTTCATCCTTCCCCCTCTCTC
CCTCCCTGCTTCCCCTTCAGTGCTTACTTGGCTCCAGCCCTCCAGCTGCAGCCCCTGGGGAAAAGCAGCCTCCCTTCTCCTCTCCCTCCA
CTCCCTCGCTCCCTCCCTCAGCCCCTGTCTCTGCCAGGTGCCTCCTCTCAGTCAGGCTTCAGAGCAGCCCTGGAGACAGGAGGGCCATGT
TAAAAGCTTTTTCACAGTTTTAAGAAGACAAGTGGAGGGTGAGGATAGTGGTGGGGGGTCTGGCACCATCTCATTGCTTTAATCCCAGCA
ACACAGGTGGCAGCTTCTCCCCCTTCCTTCCCACCCCAGTCCCTCTTCCCACCCCTCTCTTCTAGCTTGGTAATGAAGTATATTTATTGG
TGAAGGAAACAGCTGCTGCTGCTTCTCCTGCTGCTGGGACCTGCTCCCCTGTCTCTTCTCCGTGACCTTTCTCTAGCCAGGGAGAAGGGA
GAGCAGGAGTATTGGGGCTGGGCCCTGGGGCCCAAGGACCAGCTGGGTCCCCTTTGCTTTCTTGTGTTCCAGCCACCTGCCATTTCCTCC
CTGCCTCCCACCCTCCCTCCCTGCCCCCTGTCCTGCTTCCCACCCCCTGCCTGCCCAGCCTGGGCCCTGCAGTGTGGAGAGACACATAAG
CCTTACTGTCCTCTGGGGGCAGGAGCCGAGCCTTTTTGTTGCTCCGCTCCCAGGAGAGTGAGGGTGACGCAATTGATTAAAACCATTTTG


Top

FusionGenePPI for FAM76A_WDTC1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FAM76AELAVL1WDTC1USP3, DDB1, CUL4A, DDA1, TADA2A, MED4, CUL3, SLC25A22, BCKDK, MRPS11, FBXW11, XPO1, STXBP4, CUL4B, MIPEP, ETNK1, PPP1R21, CCT6A, CCT3, CCT2, TCP1, CCT4, PDCL, ARHGAP44, SEPT3, CCT7, CCT5, CCT6B, DFNB31


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FAM76A_WDTC1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FAM76A_WDTC1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource