FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12567

FusionGeneSummary for FAM135A_LAMA2

check button Fusion gene summary
Fusion gene informationFusion gene name: FAM135A_LAMA2
Fusion gene ID: 12567
HgeneTgene
Gene symbol

FAM135A

LAMA2

Gene ID

57579

3908

Gene namefamily with sequence similarity 135 member Alaminin subunit alpha 2
SynonymsKIAA1411LAMM
Cytomap

6q13

6q22.33

Type of geneprotein-codingprotein-coding
Descriptionprotein FAM135Alaminin subunit alpha-2laminin M chainlaminin, alpha 2laminin-12 subunit alphalaminin-2 subunit alphalaminin-4 subunit alphamerosin heavy chainmutant laminin subunit alpha 2
Modification date2018052320180522
UniProtAcc

Q9P2D6

P24043

Ensembl transtripts involved in fusion geneENST00000418814, ENST00000370479, 
ENST00000505769, ENST00000457062, 
ENST00000361499, ENST00000505868, 
ENST00000508844, 
ENST00000421865, 
ENST00000498257, 
Fusion gene scores* DoF score7 X 5 X 6=21010 X 9 X 6=540
# samples 79
** MAII scorelog2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/540*10)=-2.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FAM135A [Title/Abstract] AND LAMA2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVESCATCGA-M9-A5M8-01AFAM135Achr6

71162274

+LAMA2chr6

129371063

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000418814ENST00000421865FAM135Achr6

71162274

+LAMA2chr6

129371063

+
5CDS-intronENST00000418814ENST00000498257FAM135Achr6

71162274

+LAMA2chr6

129371063

+
intron-3CDSENST00000370479ENST00000421865FAM135Achr6

71162274

+LAMA2chr6

129371063

+
intron-intronENST00000370479ENST00000498257FAM135Achr6

71162274

+LAMA2chr6

129371063

+
In-frameENST00000505769ENST00000421865FAM135Achr6

71162274

+LAMA2chr6

129371063

+
5CDS-intronENST00000505769ENST00000498257FAM135Achr6

71162274

+LAMA2chr6

129371063

+
intron-3CDSENST00000457062ENST00000421865FAM135Achr6

71162274

+LAMA2chr6

129371063

+
intron-intronENST00000457062ENST00000498257FAM135Achr6

71162274

+LAMA2chr6

129371063

+
In-frameENST00000361499ENST00000421865FAM135Achr6

71162274

+LAMA2chr6

129371063

+
5CDS-intronENST00000361499ENST00000498257FAM135Achr6

71162274

+LAMA2chr6

129371063

+
In-frameENST00000505868ENST00000421865FAM135Achr6

71162274

+LAMA2chr6

129371063

+
5CDS-intronENST00000505868ENST00000498257FAM135Achr6

71162274

+LAMA2chr6

129371063

+
intron-3CDSENST00000508844ENST00000421865FAM135Achr6

71162274

+LAMA2chr6

129371063

+
intron-intronENST00000508844ENST00000498257FAM135Achr6

71162274

+LAMA2chr6

129371063

+

Top

FusionProtFeatures for FAM135A_LAMA2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FAM135A

Q9P2D6

LAMA2

P24043

Binding to cells via a high affinity receptor, lamininis thought to mediate the attachment, migration and organizationof cells into tissues during embryonic development by interactingwith other extracellular matrix components.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0651630_2150373123Coiled coilOntology_term=ECO:0000255
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0651014_1059373123DomainLaminin EGF-like 11
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0651060_1105373123DomainLaminin EGF-like 12
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0651106_1165373123DomainLaminin EGF-like 13
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0651166_1175373123DomainLaminin EGF-like 14%3B first part
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0651176_1379373123DomainLaminin IV type A 2
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0651380_1419373123DomainLaminin EGF-like 14%3B second part
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0651420_1468373123DomainLaminin EGF-like 15
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0651469_1526373123DomainLaminin EGF-like 16
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0651527_1573373123DomainLaminin EGF-like 17
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0652145_2328373123DomainLaminin G-like 1
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0652340_2521373123DomainLaminin G-like 2
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0652526_2710373123DomainLaminin G-like 3
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0652763_2934373123DomainLaminin G-like 4
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+065287_343373123DomainLaminin EGF-like 1
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0652939_3110373123DomainLaminin G-like 5
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+065344_413373123DomainLaminin EGF-like 2
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+06535_286373123DomainLaminin N-terminal
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+065414_468373123DomainLaminin EGF-like 3
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+065469_517373123DomainLaminin EGF-like 4
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+065518_527373123DomainLaminin EGF-like 5%3B first part
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+065531_723373123DomainLaminin IV type A 1
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+065724_756373123DomainLaminin EGF-like 5%3B second part
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+065757_806373123DomainLaminin EGF-like 6
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+065807_864373123DomainLaminin EGF-like 7
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+065865_917373123DomainLaminin EGF-like 8
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+065918_966373123DomainLaminin EGF-like 9
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+065967_1013373123DomainLaminin EGF-like 10
TgeneLAMA2chr6:71162274chr6:129371063ENST00000421865+0651574_2144373123RegionNote=Domain II and I

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for FAM135A_LAMA2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FAM135A_ENST00000418814_chr6_71162274_+_LAMA2_ENST00000421865_chr6_129371063_+_3138aa
MTEVQAMVEFSVELNKFYNVDLFQRGFYQIRASMKIPSRIPHRVEASLLHATGLFPAVLNLASNALITTNATCGEKGPEMYCKLVEHVPG
QPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIEYHTVTITLDLQQVFQIATVIVKAANSPRPGNWILERSLDDVEYKP
WQTHAVTDTECLTLYNITPRTGPPSTAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARTIRLRFQRIRTLNADL
MMFAHKDPREIDPIVTRRTYYSVKDISVGGMCICTGHARACPLDPATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACN
CHGKAEECTTDENVARRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNTPRPCQPCHCDPIGSLNEVCVKDEKHARR
GLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNEDPCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSN
RCQSSYWTTGKIQDMSGWTLTDLPGRIRVAPQQDDLDSPQQISISNAEARQALPHSYYWSAPAPTLGNKLPAVGGQLTFTISTDLEEEEE
DTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESFTIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNL
ESAVSTPTDGSIAAAVEVCQCPPGTTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHTGGPTCDKCLPGFTGE
PTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGTFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGS
CLICKPGTTGRYCELCADGTFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQSARGCVPCNCNSFGSK
SFDCEESGQCWCQPGVTGKKCDRCAHGTFNFQEGGCTACECSHLGNNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTV
GSLDFQCNVNTGQCNCHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNVEGIHCDRCRPGKFGL
DAKNPLGCSSCTCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDEALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFTWKLPEQFEGKK
LMATGGKLKTAITFEAREETGFSTTNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKTTGDDPRVHRTVTREDFLDILTD
IHYILIKATTGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKCDCPLGTSGLSCEACLPGFTRLRSQPGGRTPGPTLGTCVPCQCNGH
SSLCDPETSICQNCQHHTAGDFCERCALGYTGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGTEGQYCERCAPGTTG
SPGNPGGSCQECECDPTGSLPVPCDPVTGFCTCRPGATGRKCDGCKHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAP
TKMLTGLENMTQELKHLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGEFIKELARDAEAVNEK
AIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVDD
AWDLLREATDKIREANRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDTVEDIQTKLPPMSEELNDKID
DLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAFKAYSNIKDTIDEAEKVAKEAKDLAHEATKLATGPRGLLKE
DAKGCLQKSFRILNEAKKLANDVKENEDHLNGLKTRIENADARNGDLLRTLNDTLGKLSAIPNDTAAKLQAVKDKARQANDTAKDVLAQI
TELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNKIIADADATVKNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIK
VSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFTLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSTWYRIVAS
RTGRNGTISVRALDGPKASIVPSTHHSTSPPGYTILDVDANAMLFVGGLTGKLKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDC
KGCTVSPQVEDSEGTIQFDGEGTALVSRPIRWYPNISTVMFKFRTFSSSALLMTLATRDLRDFMSVELTDGHIKVSYDLGSGMASVVSNQ
NHNDGKWKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGLDLKADDKITFGGLPTLRNLSMKARPEVNLKKTSGCLKDIEISRTP
YNILSSPDTVGVTKGCSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQTGQATTAILLNRGRL
EVHLSTGARTMRKIVIRPEPNLFHDGREHSVHVERTRGIFTVQVDENRRYMQNLTVEQPIEVKKLFVGGAPPEFQPSPLRNIPPFEGCIW
NLVINSVPMDFARPVSFKNADIGRCAHQKLREDEDGAAPAEIVIQPEPVPTPAFPTPTPVLTHGPCAAESEPALLIGSKQFGLSRNSHIA
IAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGLPYFSTDLGSGDTHTMIPTKINDGQWHKIKIMRSKQEGILTVDG
ASNRTISPKKADILDVVGMLTVGGLPINYTTRRIGPVTTSIDGCVRNLHMAEAPADLEQPTSSFHVGTCFANAQRGTTFDGTGFAKAVGG
FKVGLDLLVEFEFRTTTTTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAVTDAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQ

>In-frame_FAM135A_ENST00000505769_chr6_71162274_+_LAMA2_ENST00000421865_chr6_129371063_+_3138aa
MTEVQAMVEFSVELNKFYNVDLFQRGFYQIRASMKIPSRIPHRVEASLLHATGLFPAVLNLASNALITTNATCGEKGPEMYCKLVEHVPG
QPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIEYHTVTITLDLQQVFQIATVIVKAANSPRPGNWILERSLDDVEYKP
WQTHAVTDTECLTLYNITPRTGPPSTAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARTIRLRFQRIRTLNADL
MMFAHKDPREIDPIVTRRTYYSVKDISVGGMCICTGHARACPLDPATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACN
CHGKAEECTTDENVARRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNTPRPCQPCHCDPIGSLNEVCVKDEKHARR
GLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNEDPCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSN
RCQSSYWTTGKIQDMSGWTLTDLPGRIRVAPQQDDLDSPQQISISNAEARQALPHSYYWSAPAPTLGNKLPAVGGQLTFTISTDLEEEEE
DTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESFTIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNL
ESAVSTPTDGSIAAAVEVCQCPPGTTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHTGGPTCDKCLPGFTGE
PTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGTFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGS
CLICKPGTTGRYCELCADGTFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQSARGCVPCNCNSFGSK
SFDCEESGQCWCQPGVTGKKCDRCAHGTFNFQEGGCTACECSHLGNNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTV
GSLDFQCNVNTGQCNCHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNVEGIHCDRCRPGKFGL
DAKNPLGCSSCTCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDEALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFTWKLPEQFEGKK
LMATGGKLKTAITFEAREETGFSTTNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKTTGDDPRVHRTVTREDFLDILTD
IHYILIKATTGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKCDCPLGTSGLSCEACLPGFTRLRSQPGGRTPGPTLGTCVPCQCNGH
SSLCDPETSICQNCQHHTAGDFCERCALGYTGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGTEGQYCERCAPGTTG
SPGNPGGSCQECECDPTGSLPVPCDPVTGFCTCRPGATGRKCDGCKHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAP
TKMLTGLENMTQELKHLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGEFIKELARDAEAVNEK
AIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVDD
AWDLLREATDKIREANRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDTVEDIQTKLPPMSEELNDKID
DLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAFKAYSNIKDTIDEAEKVAKEAKDLAHEATKLATGPRGLLKE
DAKGCLQKSFRILNEAKKLANDVKENEDHLNGLKTRIENADARNGDLLRTLNDTLGKLSAIPNDTAAKLQAVKDKARQANDTAKDVLAQI
TELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNKIIADADATVKNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIK
VSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFTLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSTWYRIVAS
RTGRNGTISVRALDGPKASIVPSTHHSTSPPGYTILDVDANAMLFVGGLTGKLKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDC
KGCTVSPQVEDSEGTIQFDGEGTALVSRPIRWYPNISTVMFKFRTFSSSALLMTLATRDLRDFMSVELTDGHIKVSYDLGSGMASVVSNQ
NHNDGKWKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGLDLKADDKITFGGLPTLRNLSMKARPEVNLKKTSGCLKDIEISRTP
YNILSSPDTVGVTKGCSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQTGQATTAILLNRGRL
EVHLSTGARTMRKIVIRPEPNLFHDGREHSVHVERTRGIFTVQVDENRRYMQNLTVEQPIEVKKLFVGGAPPEFQPSPLRNIPPFEGCIW
NLVINSVPMDFARPVSFKNADIGRCAHQKLREDEDGAAPAEIVIQPEPVPTPAFPTPTPVLTHGPCAAESEPALLIGSKQFGLSRNSHIA
IAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGLPYFSTDLGSGDTHTMIPTKINDGQWHKIKIMRSKQEGILTVDG
ASNRTISPKKADILDVVGMLTVGGLPINYTTRRIGPVTTSIDGCVRNLHMAEAPADLEQPTSSFHVGTCFANAQRGTTFDGTGFAKAVGG
FKVGLDLLVEFEFRTTTTTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAVTDAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQ

>In-frame_FAM135A_ENST00000361499_chr6_71162274_+_LAMA2_ENST00000421865_chr6_129371063_+_3138aa
MTEVQAMVEFSVELNKFYNVDLFQRGFYQIRASMKIPSRIPHRVEASLLHATGLFPAVLNLASNALITTNATCGEKGPEMYCKLVEHVPG
QPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIEYHTVTITLDLQQVFQIATVIVKAANSPRPGNWILERSLDDVEYKP
WQTHAVTDTECLTLYNITPRTGPPSTAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARTIRLRFQRIRTLNADL
MMFAHKDPREIDPIVTRRTYYSVKDISVGGMCICTGHARACPLDPATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACN
CHGKAEECTTDENVARRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNTPRPCQPCHCDPIGSLNEVCVKDEKHARR
GLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNEDPCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSN
RCQSSYWTTGKIQDMSGWTLTDLPGRIRVAPQQDDLDSPQQISISNAEARQALPHSYYWSAPAPTLGNKLPAVGGQLTFTISTDLEEEEE
DTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESFTIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNL
ESAVSTPTDGSIAAAVEVCQCPPGTTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHTGGPTCDKCLPGFTGE
PTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGTFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGS
CLICKPGTTGRYCELCADGTFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQSARGCVPCNCNSFGSK
SFDCEESGQCWCQPGVTGKKCDRCAHGTFNFQEGGCTACECSHLGNNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTV
GSLDFQCNVNTGQCNCHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNVEGIHCDRCRPGKFGL
DAKNPLGCSSCTCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDEALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFTWKLPEQFEGKK
LMATGGKLKTAITFEAREETGFSTTNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKTTGDDPRVHRTVTREDFLDILTD
IHYILIKATTGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKCDCPLGTSGLSCEACLPGFTRLRSQPGGRTPGPTLGTCVPCQCNGH
SSLCDPETSICQNCQHHTAGDFCERCALGYTGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGTEGQYCERCAPGTTG
SPGNPGGSCQECECDPTGSLPVPCDPVTGFCTCRPGATGRKCDGCKHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAP
TKMLTGLENMTQELKHLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGEFIKELARDAEAVNEK
AIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVDD
AWDLLREATDKIREANRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDTVEDIQTKLPPMSEELNDKID
DLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAFKAYSNIKDTIDEAEKVAKEAKDLAHEATKLATGPRGLLKE
DAKGCLQKSFRILNEAKKLANDVKENEDHLNGLKTRIENADARNGDLLRTLNDTLGKLSAIPNDTAAKLQAVKDKARQANDTAKDVLAQI
TELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNKIIADADATVKNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIK
VSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFTLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSTWYRIVAS
RTGRNGTISVRALDGPKASIVPSTHHSTSPPGYTILDVDANAMLFVGGLTGKLKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDC
KGCTVSPQVEDSEGTIQFDGEGTALVSRPIRWYPNISTVMFKFRTFSSSALLMTLATRDLRDFMSVELTDGHIKVSYDLGSGMASVVSNQ
NHNDGKWKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGLDLKADDKITFGGLPTLRNLSMKARPEVNLKKTSGCLKDIEISRTP
YNILSSPDTVGVTKGCSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQTGQATTAILLNRGRL
EVHLSTGARTMRKIVIRPEPNLFHDGREHSVHVERTRGIFTVQVDENRRYMQNLTVEQPIEVKKLFVGGAPPEFQPSPLRNIPPFEGCIW
NLVINSVPMDFARPVSFKNADIGRCAHQKLREDEDGAAPAEIVIQPEPVPTPAFPTPTPVLTHGPCAAESEPALLIGSKQFGLSRNSHIA
IAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGLPYFSTDLGSGDTHTMIPTKINDGQWHKIKIMRSKQEGILTVDG
ASNRTISPKKADILDVVGMLTVGGLPINYTTRRIGPVTTSIDGCVRNLHMAEAPADLEQPTSSFHVGTCFANAQRGTTFDGTGFAKAVGG
FKVGLDLLVEFEFRTTTTTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAVTDAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQ

>In-frame_FAM135A_ENST00000505868_chr6_71162274_+_LAMA2_ENST00000421865_chr6_129371063_+_3138aa
MTEVQAMVEFSVELNKFYNVDLFQRGFYQIRASMKIPSRIPHRVEASLLHATGLFPAVLNLASNALITTNATCGEKGPEMYCKLVEHVPG
QPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIEYHTVTITLDLQQVFQIATVIVKAANSPRPGNWILERSLDDVEYKP
WQTHAVTDTECLTLYNITPRTGPPSTAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARTIRLRFQRIRTLNADL
MMFAHKDPREIDPIVTRRTYYSVKDISVGGMCICTGHARACPLDPATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACN
CHGKAEECTTDENVARRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNTPRPCQPCHCDPIGSLNEVCVKDEKHARR
GLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNEDPCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSN
RCQSSYWTTGKIQDMSGWTLTDLPGRIRVAPQQDDLDSPQQISISNAEARQALPHSYYWSAPAPTLGNKLPAVGGQLTFTISTDLEEEEE
DTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESFTIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNL
ESAVSTPTDGSIAAAVEVCQCPPGTTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHTGGPTCDKCLPGFTGE
PTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGTFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGS
CLICKPGTTGRYCELCADGTFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQSARGCVPCNCNSFGSK
SFDCEESGQCWCQPGVTGKKCDRCAHGTFNFQEGGCTACECSHLGNNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTV
GSLDFQCNVNTGQCNCHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNVEGIHCDRCRPGKFGL
DAKNPLGCSSCTCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDEALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFTWKLPEQFEGKK
LMATGGKLKTAITFEAREETGFSTTNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKTTGDDPRVHRTVTREDFLDILTD
IHYILIKATTGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKCDCPLGTSGLSCEACLPGFTRLRSQPGGRTPGPTLGTCVPCQCNGH
SSLCDPETSICQNCQHHTAGDFCERCALGYTGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGTEGQYCERCAPGTTG
SPGNPGGSCQECECDPTGSLPVPCDPVTGFCTCRPGATGRKCDGCKHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAP
TKMLTGLENMTQELKHLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGEFIKELARDAEAVNEK
AIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVDD
AWDLLREATDKIREANRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDTVEDIQTKLPPMSEELNDKID
DLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAFKAYSNIKDTIDEAEKVAKEAKDLAHEATKLATGPRGLLKE
DAKGCLQKSFRILNEAKKLANDVKENEDHLNGLKTRIENADARNGDLLRTLNDTLGKLSAIPNDTAAKLQAVKDKARQANDTAKDVLAQI
TELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNKIIADADATVKNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIK
VSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFTLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSTWYRIVAS
RTGRNGTISVRALDGPKASIVPSTHHSTSPPGYTILDVDANAMLFVGGLTGKLKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDC
KGCTVSPQVEDSEGTIQFDGEGTALVSRPIRWYPNISTVMFKFRTFSSSALLMTLATRDLRDFMSVELTDGHIKVSYDLGSGMASVVSNQ
NHNDGKWKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGLDLKADDKITFGGLPTLRNLSMKARPEVNLKKTSGCLKDIEISRTP
YNILSSPDTVGVTKGCSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQTGQATTAILLNRGRL
EVHLSTGARTMRKIVIRPEPNLFHDGREHSVHVERTRGIFTVQVDENRRYMQNLTVEQPIEVKKLFVGGAPPEFQPSPLRNIPPFEGCIW
NLVINSVPMDFARPVSFKNADIGRCAHQKLREDEDGAAPAEIVIQPEPVPTPAFPTPTPVLTHGPCAAESEPALLIGSKQFGLSRNSHIA
IAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGLPYFSTDLGSGDTHTMIPTKINDGQWHKIKIMRSKQEGILTVDG
ASNRTISPKKADILDVVGMLTVGGLPINYTTRRIGPVTTSIDGCVRNLHMAEAPADLEQPTSSFHVGTCFANAQRGTTFDGTGFAKAVGG
FKVGLDLLVEFEFRTTTTTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAVTDAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FAM135A_ENST00000418814_chr6_71162274_+_LAMA2_ENST00000421865_chr6_129371063_+_9414nt
ATGACTGAAGTTCAAGCAATGGTAGAATTCTCTGTGGAGCTAAACAAGTTCTACAATGTGGATTTGTTTCAGAGAGGTTTTTACCAGATT
CGTGCTTCTATGAAAATTCCATCAAGAATTCCCCACAGAGTAGAAGCTAGTTTGTTGCATGCAACAGGTTTATTCCCTGCTGTCCTGAAT
CTTGCTTCTAATGCTCTTATCACGACCAATGCAACATGTGGAGAAAAAGGACCTGAAATGTACTGCAAATTGGTAGAACATGTCCCTGGG
CAGCCTGTGAGGAACCCGCAGTGTCGAATCTGCAATCAAAACAGCAGCAATCCAAACCAGAGACACCCGATTACAAATGCTATTGATGGA
AAGAACACTTGGTGGCAGAGTCCCAGTATTAAGAATGGAATCGAATACCATTATGTGACAATTACCCTGGATTTACAGCAGGTGTTCCAG
ATCGCGTATGTGATTGTGAAGGCAGCTAACTCCCCCCGGCCTGGAAACTGGATTTTGGAACGCTCTCTTGATGATGTTGAATACAAGCCC
TGGCAGTATCATGCTGTGACAGACACGGAGTGCCTAACGCTTTACAATATTTATCCCCGCACTGGGCCACCGTCATATGCCAAAGATGAT
GAGGTCATCTGCACTTCATTTTACTCCAAGATACACCCCTTAGAAAATGGAGAGATTCACATCTCTTTAATCAATGGGAGACCAAGTGCC
GATGATCCTTCTCCAGAACTGCTAGAATTTACCTCCGCTCGCTATATTCGCCTGAGATTTCAGAGGATCCGCACACTGAATGCTGACTTG
ATGATGTTTGCTCACAAAGACCCAAGAGAAATTGACCCCATTGTCACCAGAAGATATTACTACTCGGTCAAGGATATTTCAGTTGGAGGG
ATGTGCATCTGCTATGGTCATGCCAGGGCTTGTCCACTTGATCCAGCGACAAATAAATCTCGCTGTGAGTGTGAGCATAACACATGTGGC
GATAGCTGTGATCAGTGCTGTCCAGGATTCCATCAGAAACCCTGGAGAGCTGGAACTTTTCTAACTAAAACTGAATGTGAAGCATGCAAT
TGTCATGGAAAAGCTGAAGAATGCTATTATGATGAAAATGTTGCCAGAAGAAATCTGAGTTTGAATATACGTGGAAAGTACATTGGAGGG
GGTGTCTGCATTAATTGTACCCAAAACACTGCTGGTATAAACTGCGAGACATGTACTGATGGCTTCTTCAGACCCAAAGGGGTATCTCCA
AATTATCCAAGGCCATGCCAGCCATGTCATTGCGATCCAATTGGTTCCTTAAATGAAGTCTGTGTCAAGGATGAGAAACATGCTCGACGA
GGTTTGGCACCTGGATCCTGTCATTGCAAAACTGGTTTTGGAGGTGTGAGCTGTGATCGGTGTGCCAGGGGCTACACTGGCTACCCGGAC
TGCAAAGCCTGTAACTGCAGTGGGTTAGGGAGCAAAAATGAGGATCCTTGTTTTGGCCCCTGTATCTGCAAGGAAAATGTTGAAGGAGGA
GACTGTAGTCGTTGCAAATCCGGCTTCTTCAATTTGCAAGAGGATAATTGGAAAGGCTGCGATGAGTGTTTCTGTTCAGGGGTTTCAAAC
AGATGTCAGAGTTCCTACTGGACCTATGGCAAAATACAAGATATGAGTGGCTGGTATCTGACTGACCTTCCTGGCCGCATTCGAGTGGCT
CCCCAGCAGGACGACTTGGACTCACCTCAGCAGATCAGCATCAGTAACGCGGAGGCCCGGCAAGCCCTGCCGCACAGCTACTACTGGAGC
GCGCCGGCTCCCTATCTGGGAAACAAACTCCCAGCAGTAGGAGGACAGTTGACATTTACCATATCATATGACCTTGAAGAAGAGGAAGAA
GATACAGAACGTGTTCTCCAGCTTATGATTATCTTAGAGGGTAATGACTTGAGCATCAGCACAGCCCAAGATGAGGTGTACCTGCACCCA
TCTGAAGAACATACTAATGTATTGTTACTTAAAGAAGAATCATTTACCATACATGGCACACATTTTCCAGTCCGTAGAAAGGAATTTATG
ACAGTGCTTGCGAATTTGAAGAGAGTCCTCCTACAAATCACATACAGCTTTGGGATGGATGCCATCTTCAGGTTGAGCTCTGTTAACCTT
GAATCCGCTGTCTCCTATCCTACTGATGGAAGCATTGCAGCAGCTGTAGAAGTGTGTCAGTGCCCACCAGGGTATACTGGCTCCTCTTGT
GAATCTTGTTGGCCTAGGCACAGGCGAGTTAACGGCACTATTTTTGGTGGCATCTGTGAGCCATGTCAGTGCTTTGGTCATGCGGAGTCC
TGTGATGACGTCACTGGAGAATGCCTGAACTGTAAGGATCACACAGGTGGCCCATATTGTGATAAATGTCTTCCTGGTTTCTATGGCGAG
CCTACTAAAGGAACCTCTGAAGACTGTCAACCCTGTGCCTGTCCACTCAATATCCCATCCAATAACTTTAGCCCAACGTGCCATTTAGAC
CGGAGTCTTGGATTGATCTGTGATGGATGCCCTGTCGGGTACACAGGACCACGCTGTGAGAGGTGTGCAGAAGGCTATTTTGGACAACCC
TCTGTACCTGGAGGATCATGTCAGCCATGCCAATGCAATGACAACCTTGACTTCTCCATCCCTGGCAGCTGTGACAGCTTGTCTGGCTCC
TGTCTGATATGTAAACCAGGTACAACAGGCCGGTACTGTGAGCTCTGTGCTGATGGATATTTTGGAGATGCAGTTGATGCGAAGAACTGT
CAGCCCTGTCGCTGTAATGCCGGTGGCTCTTTCTCTGAGGTTTGCCACAGTCAAACTGGACAGTGTGAGTGCAGAGCCAACGTTCAGGGT
CAGAGATGTGACAAATGCAAGGCTGGGACCTTTGGCCTACAATCAGCAAGGGGCTGTGTTCCCTGCAACTGCAATTCTTTTGGGTCTAAG
TCATTCGACTGTGAAGAGAGTGGACAATGTTGGTGCCAACCTGGAGTCACAGGGAAGAAATGTGACCGCTGTGCCCACGGCTATTTCAAC
TTCCAAGAAGGAGGCTGCACAGCTTGTGAATGTTCTCATCTGGGTAATAATTGTGACCCAAAGACTGGGCGATGCATTTGCCCTCCCAAT
ACCATTGGAGAGAAATGTTCTAAATGTGCACCCAATACCTGGGGCCACAGCATTACCACTGGTTGTAAGGCTTGTAACTGCAGCACAGTG
GGATCCTTGGATTTCCAATGCAATGTAAATACAGGCCAATGCAACTGTCATCCAAAATTCTCTGGTGCAAAATGTACAGAGTGCAGTCGA
GGTCACTGGAACTACCCTCGCTGCAATCTCTGTGACTGCTTCCTCCCTGGGACAGATGCCACAACCTGTGATTCAGAGACTAAAAAATGC
TCCTGTAGTGATCAAACTGGGCAGTGCACTTGTAAGGTGAATGTGGAAGGCATCCACTGTGACAGATGCCGGCCTGGCAAATTCGGACTC
GATGCCAAGAATCCACTTGGCTGCAGCAGCTGCTATTGCTTCGGCACTACTACCCAGTGCTCTGAAGCAAAAGGACTGATCCGGACGTGG
GTGACTCTGAAGGCTGAGCAGACCATTCTACCCCTGGTAGATGAGGCTCTGCAGCACACGACCACCAAGGGCATTGTTTTTCAACATCCA
GAGATTGTTGCCCACATGGACCTGATGAGAGAAGATCTCCATTTGGAACCTTTTTATTGGAAACTTCCAGAACAATTTGAAGGAAAGAAG
TTGATGGCCTATGGGGGCAAACTCAAGTATGCAATCTATTTCGAGGCTCGGGAAGAAACAGGTTTCTCTACATATAATCCTCAAGTGATC
ATTCGAGGTGGGACACCTACTCATGCTAGAATTATCGTCAGGCATATGGCTGCTCCTCTGATTGGCCAATTGACAAGGCATGAAATTGAA
ATGACAGAGAAAGAATGGAAATATTATGGGGATGATCCTCGAGTCCATAGAACTGTGACCCGAGAAGACTTCTTGGATATACTATATGAT
ATTCATTACATTCTTATCAAAGCTACTTATGGAAATTTCATGCGACAAAGCAGGATTTCTGAAATCTCAATGGAGGTAGCTGAACAAGGA
CGTGGAACAACAATGACTCCTCCAGCTGACTTGATTGAAAAATGTGATTGTCCCCTGGGCTATTCTGGCCTGTCCTGTGAGGCATGCTTG
CCGGGATTTTATCGACTGCGTTCTCAACCAGGTGGCCGCACCCCTGGACCAACCCTGGGCACCTGTGTTCCATGTCAATGTAATGGACAC
AGCAGCCTGTGTGACCCTGAAACATCGATATGCCAGAATTGTCAACATCACACTGCTGGTGACTTCTGTGAACGATGTGCTCTTGGATAC
TATGGAATTGTCAAGGGATTGCCAAATGACTGTCAGCAATGTGCCTGCCCTCTGATTTCTTCCAGTAACAATTTCAGCCCCTCTTGTGTC
GCAGAAGGACTTGACGACTACCGCTGCACGGCTTGTCCACGGGGATATGAAGGCCAGTACTGTGAAAGGTGTGCCCCTGGCTATACTGGC
AGTCCAGGCAACCCTGGAGGCTCCTGCCAAGAATGTGAGTGTGATCCCTATGGCTCACTGCCTGTGCCCTGTGACCCTGTCACAGGATTC
TGCACGTGCCGACCTGGAGCCACGGGAAGGAAGTGTGACGGCTGCAAGCACTGGCATGCACGCGAGGGCTGGGAGTGTGTTTTTTGTGGA
GATGAGTGCACTGGCCTTCTTCTCGGTGACTTGGCTCGCCTGGAGCAGATGGTCATGAGCATCAACCTCACTGGTCCGCTGCCTGCGCCA
TATAAAATGCTGTATGGTCTTGAAAATATGACTCAGGAGCTAAAGCACTTGCTGTCACCTCAGCGGGCCCCAGAGAGGCTTATTCAGCTG
GCAGAGGGCAATCTGAATACACTCGTGACCGAAATGAACGAGCTGCTGACCAGGGCTACCAAAGTGACAGCAGATGGCGAGCAGACCGGA
CAGGATGCTGAGAGGACCAACACAAGAGCAAAGTCCCTGGGAGAATTCATTAAGGAGCTTGCCCGGGATGCAGAAGCTGTAAATGAAAAA
GCTATAAAACTAAATGAAACTCTAGGAACTCGAGACGAGGCCTTTGAGAGAAATTTGGAAGGGCTTCAGAAAGAGATTGACCAGATGATT
AAAGAACTGAGGAGGAAAAATCTAGAGACACAAAAGGAAATTGCTGAAGATGAGTTGGTAGCTGCAGAAGCCCTTCTGAAAAAAGTGAAG
AAGCTGTTTGGAGAGTCCCGGGGGGAAAATGAAGAAATGGAGAAGGATCTCCGGGAAAAACTGGCTGACTACAAAAACAAAGTTGATGAT
GCTTGGGACCTTTTGAGAGAAGCCACAGATAAAATCAGAGAAGCTAATCGCCTATTTGCAGTAAATCAGAAAAACATGACTGCATTGGAG
AAAAAGAAGGAGGCTGTTGAAAGCGGCAAACGACAAATTGAGAACACTTTAAAAGAGGGCAATGACATACTCGATGAAGCCAACCGTCTT
GCAGATGAAATCAACTCCATCATAGACTATGTTGAAGACATCCAAACTAAATTGCCACCTATGTCTGAGGAGCTTAATGATAAAATAGAT
GACCTCTCCCAAGAAATAAAGGACAGGAAGCTTGCTGAGAAGGTGTCCCAGGCTGAGAGCCACGCAGCTCAGTTGAATGACTCATCTGCT
GTCCTTGATGGAATCCTTGATGAGGCTAAAAACATCTCCTTCAATGCCACTGCAGCCTTCAAAGCTTACAGCAATATTAAGGACTATATT
GATGAAGCTGAGAAAGTTGCCAAAGAAGCCAAAGATCTTGCACATGAAGCTACAAAACTGGCAACAGGTCCTCGGGGTTTATTAAAGGAA
GATGCCAAAGGCTGTCTTCAGAAAAGCTTCAGGATTCTTAACGAAGCCAAGAAGTTAGCAAATGATGTAAAAGAAAATGAAGACCATCTA
AATGGCTTAAAAACCAGGATAGAAAATGCTGATGCTAGAAATGGGGATCTCTTGAGAACTTTGAATGACACTTTGGGAAAGTTATCAGCT
ATTCCAAATGATACAGCTGCTAAACTGCAAGCTGTTAAGGACAAAGCCAGACAAGCCAACGACACAGCTAAAGATGTACTGGCACAGATT
ACAGAGCTCCACCAGAACCTCGATGGCCTGAAGAAGAATTACAATAAACTAGCAGACAGCGTCGCCAAAACGAATGCTGTGGTTAAAGAT
CCTTCCAAGAACAAAATCATTGCCGATGCAGATGCCACTGTCAAAAATTTAGAACAGGAAGCTGACCGGCTAATAGATAAACTCAAACCC
ATCAAGGAACTTGAGGATAACCTAAAGAAAAACATCTCTGAGATAAAGGAATTGATAAACCAAGCTCGGAAACAAGCCAATTCTATCAAA
GTATCTGTGTCTTCAGGAGGTGACTGCATTCGAACATACAAACCAGAAATCAAGAAAGGAAGTTACAATAATATTGTTGTCAACGTAAAG
ACAGCTGTTGCTGATAACCTCCTCTTTTATCTTGGAAGTGCCAAATTTATTGACTTTCTGGCTATAGAAATGCGTAAAGGCAAAGTCAGC
TTCCTCTGGGATGTTGGATCTGGAGTTGGACGTGTAGAGTACCCAGATTTGACTATTGATGACTCATATTGGTACCGTATCGTAGCATCA
AGAACTGGGAGAAATGGAACTATTTCTGTGAGAGCCCTGGATGGACCCAAAGCCAGCATTGTGCCCAGCACACACCATTCGACGTCTCCT
CCAGGGTACACGATTCTAGATGTGGATGCAAATGCAATGCTGTTTGTTGGTGGCCTGACTGGGAAATTAAAGAAGGCTGATGCTGTACGT
GTGATTACATTCACTGGCTGCATGGGAGAAACATACTTTGACAACAAACCTATAGGTTTGTGGAATTTCCGAGAAAAAGAAGGTGACTGC
AAAGGATGCACTGTCAGTCCTCAGGTGGAAGATAGTGAGGGGACTATTCAATTTGATGGAGAAGGTTATGCATTGGTCAGCCGTCCCATT
CGCTGGTACCCCAACATCTCCACTGTCATGTTCAAGTTCAGAACATTTTCTTCGAGTGCTCTTCTGATGTATCTTGCCACACGAGACCTG
AGAGATTTCATGAGTGTGGAGCTCACTGATGGGCACATAAAAGTCAGTTACGATCTGGGCTCAGGAATGGCTTCCGTTGTCAGCAATCAA
AACCATAATGATGGGAAATGGAAATCATTCACTCTGTCAAGAATTCAAAAACAAGCCAATATATCAATTGTAGATATAGATACTAATCAG
GAGGAGAATATAGCAACTTCGTCTTCTGGAAACAACTTTGGTCTTGACTTGAAAGCAGATGACAAAATATATTTTGGTGGCCTGCCAACG
CTGAGAAACTTGAGTATGAAAGCAAGGCCAGAAGTAAATCTGAAGAAATATTCCGGCTGCCTCAAAGATATTGAAATTTCAAGAACTCCG
TACAATATACTCAGTAGTCCCGATTATGTTGGTGTTACCAAAGGATGTTCCCTGGAGAATGTTTACACAGTTAGCTTTCCTAAGCCTGGT
TTTGTGGAGCTCTCCCCTGTGCCAATTGATGTAGGAACAGAAATCAACCTGTCATTCAGCACCAAGAATGAGTCCGGCATCATTCTTTTG
GGAAGTGGAGGGACACCAGCACCACCTAGGAGAAAACGAAGGCAGACTGGACAGGCCTATTATGCAATACTCCTCAACAGGGGCCGTCTG
GAAGTGCATCTCTCCACAGGGGCACGAACAATGAGGAAAATTGTGATCAGACCAGAGCCGAATCTGTTTCATGATGGAAGAGAACATTCC
GTTCATGTAGAGCGAACTAGAGGCATCTTTACAGTTCAAGTGGATGAAAACAGAAGATACATGCAAAACCTGACAGTTGAACAGCCTATC
GAAGTTAAAAAGCTTTTCGTTGGGGGTGCTCCACCTGAATTTCAACCTTCCCCACTCAGAAATATTCCTCCTTTTGAAGGCTGCATATGG
AATCTTGTTATTAACTCTGTCCCCATGGACTTTGCAAGGCCTGTGTCCTTCAAAAATGCTGACATTGGTCGCTGTGCCCATCAGAAACTC
CGTGAAGATGAAGATGGAGCAGCTCCAGCTGAAATAGTTATCCAGCCTGAGCCAGTTCCCACCCCAGCCTTTCCTACGCCCACCCCAGTT
CTGACACATGGTCCTTGTGCTGCAGAATCAGAACCAGCTCTTTTGATAGGGAGCAAGCAGTTCGGGCTTTCAAGAAACAGTCACATTGCA
ATTGCATTTGATGACACCAAAGTTAAAAACCGTCTCACAATTGAGTTGGAAGTAAGAACCGAAGCTGAATCCGGCTTGCTTTTTTACATG
GCTCGCATCAATCATGCTGATTTTGCAACAGTTCAGCTGAGAAATGGATTGCCCTACTTCAGCTATGACTTGGGGAGTGGGGACACCCAC
ACCATGATCCCCACCAAAATCAATGATGGCCAGTGGCACAAGATTAAGATAATGAGAAGTAAGCAAGAAGGAATTCTTTATGTAGATGGG
GCTTCCAACAGAACCATCAGTCCCAAAAAAGCCGACATCCTGGATGTCGTGGGAATGCTGTATGTTGGTGGGTTACCCATCAACTACACT
ACCCGAAGAATTGGTCCAGTGACCTATAGCATTGATGGCTGCGTCAGGAATCTCCACATGGCAGAGGCCCCTGCCGATCTGGAACAACCC
ACCTCCAGCTTCCATGTTGGGACATGTTTTGCAAATGCTCAGAGGGGAACATATTTTGACGGAACCGGTTTTGCCAAAGCAGTTGGTGGA
TTCAAAGTGGGATTGGACCTTCTTGTAGAATTTGAATTCCGCACAACTACAACGACTGGAGTTCTTCTGGGGATCAGTAGTCAAAAAATG
GATGGAATGGGTATTGAAATGATTGATGAAAAGTTGATGTTTCATGTGGACAATGGTGCGGGCAGATTCACTGCTGTCTATGATGCTGGG
GTTCCAGGGCATTTGTGTGATGGACAATGGCATAAAGTCACTGCCAACAAGATCAAACACCGCATTGAGCTCACAGTCGATGGGAACCAG
GTGGAAGCCCAAAGCCCAAACCCAGCATCTACATCAGCTGACACAAATGACCCTGTGTTTGTTGGAGGCTTCCCAGATGACCTCAAGCAG
TTTGGCCTAACAACCAGTATTCCGTTCCGAGGTTGCATCAGATCCCTGAAGCTCACCAAAGGCACAGGCAAGCCACTGGAGGTTAATTTT

>In-frame_FAM135A_ENST00000505769_chr6_71162274_+_LAMA2_ENST00000421865_chr6_129371063_+_9414nt
ATGACTGAAGTTCAAGCAATGGTAGAATTCTCTGTGGAGCTAAACAAGTTCTACAATGTGGATTTGTTTCAGAGAGGTTTTTACCAGATT
CGTGCTTCTATGAAAATTCCATCAAGAATTCCCCACAGAGTAGAAGCTAGTTTGTTGCATGCAACAGGTTTATTCCCTGCTGTCCTGAAT
CTTGCTTCTAATGCTCTTATCACGACCAATGCAACATGTGGAGAAAAAGGACCTGAAATGTACTGCAAATTGGTAGAACATGTCCCTGGG
CAGCCTGTGAGGAACCCGCAGTGTCGAATCTGCAATCAAAACAGCAGCAATCCAAACCAGAGACACCCGATTACAAATGCTATTGATGGA
AAGAACACTTGGTGGCAGAGTCCCAGTATTAAGAATGGAATCGAATACCATTATGTGACAATTACCCTGGATTTACAGCAGGTGTTCCAG
ATCGCGTATGTGATTGTGAAGGCAGCTAACTCCCCCCGGCCTGGAAACTGGATTTTGGAACGCTCTCTTGATGATGTTGAATACAAGCCC
TGGCAGTATCATGCTGTGACAGACACGGAGTGCCTAACGCTTTACAATATTTATCCCCGCACTGGGCCACCGTCATATGCCAAAGATGAT
GAGGTCATCTGCACTTCATTTTACTCCAAGATACACCCCTTAGAAAATGGAGAGATTCACATCTCTTTAATCAATGGGAGACCAAGTGCC
GATGATCCTTCTCCAGAACTGCTAGAATTTACCTCCGCTCGCTATATTCGCCTGAGATTTCAGAGGATCCGCACACTGAATGCTGACTTG
ATGATGTTTGCTCACAAAGACCCAAGAGAAATTGACCCCATTGTCACCAGAAGATATTACTACTCGGTCAAGGATATTTCAGTTGGAGGG
ATGTGCATCTGCTATGGTCATGCCAGGGCTTGTCCACTTGATCCAGCGACAAATAAATCTCGCTGTGAGTGTGAGCATAACACATGTGGC
GATAGCTGTGATCAGTGCTGTCCAGGATTCCATCAGAAACCCTGGAGAGCTGGAACTTTTCTAACTAAAACTGAATGTGAAGCATGCAAT
TGTCATGGAAAAGCTGAAGAATGCTATTATGATGAAAATGTTGCCAGAAGAAATCTGAGTTTGAATATACGTGGAAAGTACATTGGAGGG
GGTGTCTGCATTAATTGTACCCAAAACACTGCTGGTATAAACTGCGAGACATGTACTGATGGCTTCTTCAGACCCAAAGGGGTATCTCCA
AATTATCCAAGGCCATGCCAGCCATGTCATTGCGATCCAATTGGTTCCTTAAATGAAGTCTGTGTCAAGGATGAGAAACATGCTCGACGA
GGTTTGGCACCTGGATCCTGTCATTGCAAAACTGGTTTTGGAGGTGTGAGCTGTGATCGGTGTGCCAGGGGCTACACTGGCTACCCGGAC
TGCAAAGCCTGTAACTGCAGTGGGTTAGGGAGCAAAAATGAGGATCCTTGTTTTGGCCCCTGTATCTGCAAGGAAAATGTTGAAGGAGGA
GACTGTAGTCGTTGCAAATCCGGCTTCTTCAATTTGCAAGAGGATAATTGGAAAGGCTGCGATGAGTGTTTCTGTTCAGGGGTTTCAAAC
AGATGTCAGAGTTCCTACTGGACCTATGGCAAAATACAAGATATGAGTGGCTGGTATCTGACTGACCTTCCTGGCCGCATTCGAGTGGCT
CCCCAGCAGGACGACTTGGACTCACCTCAGCAGATCAGCATCAGTAACGCGGAGGCCCGGCAAGCCCTGCCGCACAGCTACTACTGGAGC
GCGCCGGCTCCCTATCTGGGAAACAAACTCCCAGCAGTAGGAGGACAGTTGACATTTACCATATCATATGACCTTGAAGAAGAGGAAGAA
GATACAGAACGTGTTCTCCAGCTTATGATTATCTTAGAGGGTAATGACTTGAGCATCAGCACAGCCCAAGATGAGGTGTACCTGCACCCA
TCTGAAGAACATACTAATGTATTGTTACTTAAAGAAGAATCATTTACCATACATGGCACACATTTTCCAGTCCGTAGAAAGGAATTTATG
ACAGTGCTTGCGAATTTGAAGAGAGTCCTCCTACAAATCACATACAGCTTTGGGATGGATGCCATCTTCAGGTTGAGCTCTGTTAACCTT
GAATCCGCTGTCTCCTATCCTACTGATGGAAGCATTGCAGCAGCTGTAGAAGTGTGTCAGTGCCCACCAGGGTATACTGGCTCCTCTTGT
GAATCTTGTTGGCCTAGGCACAGGCGAGTTAACGGCACTATTTTTGGTGGCATCTGTGAGCCATGTCAGTGCTTTGGTCATGCGGAGTCC
TGTGATGACGTCACTGGAGAATGCCTGAACTGTAAGGATCACACAGGTGGCCCATATTGTGATAAATGTCTTCCTGGTTTCTATGGCGAG
CCTACTAAAGGAACCTCTGAAGACTGTCAACCCTGTGCCTGTCCACTCAATATCCCATCCAATAACTTTAGCCCAACGTGCCATTTAGAC
CGGAGTCTTGGATTGATCTGTGATGGATGCCCTGTCGGGTACACAGGACCACGCTGTGAGAGGTGTGCAGAAGGCTATTTTGGACAACCC
TCTGTACCTGGAGGATCATGTCAGCCATGCCAATGCAATGACAACCTTGACTTCTCCATCCCTGGCAGCTGTGACAGCTTGTCTGGCTCC
TGTCTGATATGTAAACCAGGTACAACAGGCCGGTACTGTGAGCTCTGTGCTGATGGATATTTTGGAGATGCAGTTGATGCGAAGAACTGT
CAGCCCTGTCGCTGTAATGCCGGTGGCTCTTTCTCTGAGGTTTGCCACAGTCAAACTGGACAGTGTGAGTGCAGAGCCAACGTTCAGGGT
CAGAGATGTGACAAATGCAAGGCTGGGACCTTTGGCCTACAATCAGCAAGGGGCTGTGTTCCCTGCAACTGCAATTCTTTTGGGTCTAAG
TCATTCGACTGTGAAGAGAGTGGACAATGTTGGTGCCAACCTGGAGTCACAGGGAAGAAATGTGACCGCTGTGCCCACGGCTATTTCAAC
TTCCAAGAAGGAGGCTGCACAGCTTGTGAATGTTCTCATCTGGGTAATAATTGTGACCCAAAGACTGGGCGATGCATTTGCCCTCCCAAT
ACCATTGGAGAGAAATGTTCTAAATGTGCACCCAATACCTGGGGCCACAGCATTACCACTGGTTGTAAGGCTTGTAACTGCAGCACAGTG
GGATCCTTGGATTTCCAATGCAATGTAAATACAGGCCAATGCAACTGTCATCCAAAATTCTCTGGTGCAAAATGTACAGAGTGCAGTCGA
GGTCACTGGAACTACCCTCGCTGCAATCTCTGTGACTGCTTCCTCCCTGGGACAGATGCCACAACCTGTGATTCAGAGACTAAAAAATGC
TCCTGTAGTGATCAAACTGGGCAGTGCACTTGTAAGGTGAATGTGGAAGGCATCCACTGTGACAGATGCCGGCCTGGCAAATTCGGACTC
GATGCCAAGAATCCACTTGGCTGCAGCAGCTGCTATTGCTTCGGCACTACTACCCAGTGCTCTGAAGCAAAAGGACTGATCCGGACGTGG
GTGACTCTGAAGGCTGAGCAGACCATTCTACCCCTGGTAGATGAGGCTCTGCAGCACACGACCACCAAGGGCATTGTTTTTCAACATCCA
GAGATTGTTGCCCACATGGACCTGATGAGAGAAGATCTCCATTTGGAACCTTTTTATTGGAAACTTCCAGAACAATTTGAAGGAAAGAAG
TTGATGGCCTATGGGGGCAAACTCAAGTATGCAATCTATTTCGAGGCTCGGGAAGAAACAGGTTTCTCTACATATAATCCTCAAGTGATC
ATTCGAGGTGGGACACCTACTCATGCTAGAATTATCGTCAGGCATATGGCTGCTCCTCTGATTGGCCAATTGACAAGGCATGAAATTGAA
ATGACAGAGAAAGAATGGAAATATTATGGGGATGATCCTCGAGTCCATAGAACTGTGACCCGAGAAGACTTCTTGGATATACTATATGAT
ATTCATTACATTCTTATCAAAGCTACTTATGGAAATTTCATGCGACAAAGCAGGATTTCTGAAATCTCAATGGAGGTAGCTGAACAAGGA
CGTGGAACAACAATGACTCCTCCAGCTGACTTGATTGAAAAATGTGATTGTCCCCTGGGCTATTCTGGCCTGTCCTGTGAGGCATGCTTG
CCGGGATTTTATCGACTGCGTTCTCAACCAGGTGGCCGCACCCCTGGACCAACCCTGGGCACCTGTGTTCCATGTCAATGTAATGGACAC
AGCAGCCTGTGTGACCCTGAAACATCGATATGCCAGAATTGTCAACATCACACTGCTGGTGACTTCTGTGAACGATGTGCTCTTGGATAC
TATGGAATTGTCAAGGGATTGCCAAATGACTGTCAGCAATGTGCCTGCCCTCTGATTTCTTCCAGTAACAATTTCAGCCCCTCTTGTGTC
GCAGAAGGACTTGACGACTACCGCTGCACGGCTTGTCCACGGGGATATGAAGGCCAGTACTGTGAAAGGTGTGCCCCTGGCTATACTGGC
AGTCCAGGCAACCCTGGAGGCTCCTGCCAAGAATGTGAGTGTGATCCCTATGGCTCACTGCCTGTGCCCTGTGACCCTGTCACAGGATTC
TGCACGTGCCGACCTGGAGCCACGGGAAGGAAGTGTGACGGCTGCAAGCACTGGCATGCACGCGAGGGCTGGGAGTGTGTTTTTTGTGGA
GATGAGTGCACTGGCCTTCTTCTCGGTGACTTGGCTCGCCTGGAGCAGATGGTCATGAGCATCAACCTCACTGGTCCGCTGCCTGCGCCA
TATAAAATGCTGTATGGTCTTGAAAATATGACTCAGGAGCTAAAGCACTTGCTGTCACCTCAGCGGGCCCCAGAGAGGCTTATTCAGCTG
GCAGAGGGCAATCTGAATACACTCGTGACCGAAATGAACGAGCTGCTGACCAGGGCTACCAAAGTGACAGCAGATGGCGAGCAGACCGGA
CAGGATGCTGAGAGGACCAACACAAGAGCAAAGTCCCTGGGAGAATTCATTAAGGAGCTTGCCCGGGATGCAGAAGCTGTAAATGAAAAA
GCTATAAAACTAAATGAAACTCTAGGAACTCGAGACGAGGCCTTTGAGAGAAATTTGGAAGGGCTTCAGAAAGAGATTGACCAGATGATT
AAAGAACTGAGGAGGAAAAATCTAGAGACACAAAAGGAAATTGCTGAAGATGAGTTGGTAGCTGCAGAAGCCCTTCTGAAAAAAGTGAAG
AAGCTGTTTGGAGAGTCCCGGGGGGAAAATGAAGAAATGGAGAAGGATCTCCGGGAAAAACTGGCTGACTACAAAAACAAAGTTGATGAT
GCTTGGGACCTTTTGAGAGAAGCCACAGATAAAATCAGAGAAGCTAATCGCCTATTTGCAGTAAATCAGAAAAACATGACTGCATTGGAG
AAAAAGAAGGAGGCTGTTGAAAGCGGCAAACGACAAATTGAGAACACTTTAAAAGAGGGCAATGACATACTCGATGAAGCCAACCGTCTT
GCAGATGAAATCAACTCCATCATAGACTATGTTGAAGACATCCAAACTAAATTGCCACCTATGTCTGAGGAGCTTAATGATAAAATAGAT
GACCTCTCCCAAGAAATAAAGGACAGGAAGCTTGCTGAGAAGGTGTCCCAGGCTGAGAGCCACGCAGCTCAGTTGAATGACTCATCTGCT
GTCCTTGATGGAATCCTTGATGAGGCTAAAAACATCTCCTTCAATGCCACTGCAGCCTTCAAAGCTTACAGCAATATTAAGGACTATATT
GATGAAGCTGAGAAAGTTGCCAAAGAAGCCAAAGATCTTGCACATGAAGCTACAAAACTGGCAACAGGTCCTCGGGGTTTATTAAAGGAA
GATGCCAAAGGCTGTCTTCAGAAAAGCTTCAGGATTCTTAACGAAGCCAAGAAGTTAGCAAATGATGTAAAAGAAAATGAAGACCATCTA
AATGGCTTAAAAACCAGGATAGAAAATGCTGATGCTAGAAATGGGGATCTCTTGAGAACTTTGAATGACACTTTGGGAAAGTTATCAGCT
ATTCCAAATGATACAGCTGCTAAACTGCAAGCTGTTAAGGACAAAGCCAGACAAGCCAACGACACAGCTAAAGATGTACTGGCACAGATT
ACAGAGCTCCACCAGAACCTCGATGGCCTGAAGAAGAATTACAATAAACTAGCAGACAGCGTCGCCAAAACGAATGCTGTGGTTAAAGAT
CCTTCCAAGAACAAAATCATTGCCGATGCAGATGCCACTGTCAAAAATTTAGAACAGGAAGCTGACCGGCTAATAGATAAACTCAAACCC
ATCAAGGAACTTGAGGATAACCTAAAGAAAAACATCTCTGAGATAAAGGAATTGATAAACCAAGCTCGGAAACAAGCCAATTCTATCAAA
GTATCTGTGTCTTCAGGAGGTGACTGCATTCGAACATACAAACCAGAAATCAAGAAAGGAAGTTACAATAATATTGTTGTCAACGTAAAG
ACAGCTGTTGCTGATAACCTCCTCTTTTATCTTGGAAGTGCCAAATTTATTGACTTTCTGGCTATAGAAATGCGTAAAGGCAAAGTCAGC
TTCCTCTGGGATGTTGGATCTGGAGTTGGACGTGTAGAGTACCCAGATTTGACTATTGATGACTCATATTGGTACCGTATCGTAGCATCA
AGAACTGGGAGAAATGGAACTATTTCTGTGAGAGCCCTGGATGGACCCAAAGCCAGCATTGTGCCCAGCACACACCATTCGACGTCTCCT
CCAGGGTACACGATTCTAGATGTGGATGCAAATGCAATGCTGTTTGTTGGTGGCCTGACTGGGAAATTAAAGAAGGCTGATGCTGTACGT
GTGATTACATTCACTGGCTGCATGGGAGAAACATACTTTGACAACAAACCTATAGGTTTGTGGAATTTCCGAGAAAAAGAAGGTGACTGC
AAAGGATGCACTGTCAGTCCTCAGGTGGAAGATAGTGAGGGGACTATTCAATTTGATGGAGAAGGTTATGCATTGGTCAGCCGTCCCATT
CGCTGGTACCCCAACATCTCCACTGTCATGTTCAAGTTCAGAACATTTTCTTCGAGTGCTCTTCTGATGTATCTTGCCACACGAGACCTG
AGAGATTTCATGAGTGTGGAGCTCACTGATGGGCACATAAAAGTCAGTTACGATCTGGGCTCAGGAATGGCTTCCGTTGTCAGCAATCAA
AACCATAATGATGGGAAATGGAAATCATTCACTCTGTCAAGAATTCAAAAACAAGCCAATATATCAATTGTAGATATAGATACTAATCAG
GAGGAGAATATAGCAACTTCGTCTTCTGGAAACAACTTTGGTCTTGACTTGAAAGCAGATGACAAAATATATTTTGGTGGCCTGCCAACG
CTGAGAAACTTGAGTATGAAAGCAAGGCCAGAAGTAAATCTGAAGAAATATTCCGGCTGCCTCAAAGATATTGAAATTTCAAGAACTCCG
TACAATATACTCAGTAGTCCCGATTATGTTGGTGTTACCAAAGGATGTTCCCTGGAGAATGTTTACACAGTTAGCTTTCCTAAGCCTGGT
TTTGTGGAGCTCTCCCCTGTGCCAATTGATGTAGGAACAGAAATCAACCTGTCATTCAGCACCAAGAATGAGTCCGGCATCATTCTTTTG
GGAAGTGGAGGGACACCAGCACCACCTAGGAGAAAACGAAGGCAGACTGGACAGGCCTATTATGCAATACTCCTCAACAGGGGCCGTCTG
GAAGTGCATCTCTCCACAGGGGCACGAACAATGAGGAAAATTGTGATCAGACCAGAGCCGAATCTGTTTCATGATGGAAGAGAACATTCC
GTTCATGTAGAGCGAACTAGAGGCATCTTTACAGTTCAAGTGGATGAAAACAGAAGATACATGCAAAACCTGACAGTTGAACAGCCTATC
GAAGTTAAAAAGCTTTTCGTTGGGGGTGCTCCACCTGAATTTCAACCTTCCCCACTCAGAAATATTCCTCCTTTTGAAGGCTGCATATGG
AATCTTGTTATTAACTCTGTCCCCATGGACTTTGCAAGGCCTGTGTCCTTCAAAAATGCTGACATTGGTCGCTGTGCCCATCAGAAACTC
CGTGAAGATGAAGATGGAGCAGCTCCAGCTGAAATAGTTATCCAGCCTGAGCCAGTTCCCACCCCAGCCTTTCCTACGCCCACCCCAGTT
CTGACACATGGTCCTTGTGCTGCAGAATCAGAACCAGCTCTTTTGATAGGGAGCAAGCAGTTCGGGCTTTCAAGAAACAGTCACATTGCA
ATTGCATTTGATGACACCAAAGTTAAAAACCGTCTCACAATTGAGTTGGAAGTAAGAACCGAAGCTGAATCCGGCTTGCTTTTTTACATG
GCTCGCATCAATCATGCTGATTTTGCAACAGTTCAGCTGAGAAATGGATTGCCCTACTTCAGCTATGACTTGGGGAGTGGGGACACCCAC
ACCATGATCCCCACCAAAATCAATGATGGCCAGTGGCACAAGATTAAGATAATGAGAAGTAAGCAAGAAGGAATTCTTTATGTAGATGGG
GCTTCCAACAGAACCATCAGTCCCAAAAAAGCCGACATCCTGGATGTCGTGGGAATGCTGTATGTTGGTGGGTTACCCATCAACTACACT
ACCCGAAGAATTGGTCCAGTGACCTATAGCATTGATGGCTGCGTCAGGAATCTCCACATGGCAGAGGCCCCTGCCGATCTGGAACAACCC
ACCTCCAGCTTCCATGTTGGGACATGTTTTGCAAATGCTCAGAGGGGAACATATTTTGACGGAACCGGTTTTGCCAAAGCAGTTGGTGGA
TTCAAAGTGGGATTGGACCTTCTTGTAGAATTTGAATTCCGCACAACTACAACGACTGGAGTTCTTCTGGGGATCAGTAGTCAAAAAATG
GATGGAATGGGTATTGAAATGATTGATGAAAAGTTGATGTTTCATGTGGACAATGGTGCGGGCAGATTCACTGCTGTCTATGATGCTGGG
GTTCCAGGGCATTTGTGTGATGGACAATGGCATAAAGTCACTGCCAACAAGATCAAACACCGCATTGAGCTCACAGTCGATGGGAACCAG
GTGGAAGCCCAAAGCCCAAACCCAGCATCTACATCAGCTGACACAAATGACCCTGTGTTTGTTGGAGGCTTCCCAGATGACCTCAAGCAG
TTTGGCCTAACAACCAGTATTCCGTTCCGAGGTTGCATCAGATCCCTGAAGCTCACCAAAGGCACAGGCAAGCCACTGGAGGTTAATTTT

>In-frame_FAM135A_ENST00000361499_chr6_71162274_+_LAMA2_ENST00000421865_chr6_129371063_+_9414nt
ATGACTGAAGTTCAAGCAATGGTAGAATTCTCTGTGGAGCTAAACAAGTTCTACAATGTGGATTTGTTTCAGAGAGGTTTTTACCAGATT
CGTGCTTCTATGAAAATTCCATCAAGAATTCCCCACAGAGTAGAAGCTAGTTTGTTGCATGCAACAGGTTTATTCCCTGCTGTCCTGAAT
CTTGCTTCTAATGCTCTTATCACGACCAATGCAACATGTGGAGAAAAAGGACCTGAAATGTACTGCAAATTGGTAGAACATGTCCCTGGG
CAGCCTGTGAGGAACCCGCAGTGTCGAATCTGCAATCAAAACAGCAGCAATCCAAACCAGAGACACCCGATTACAAATGCTATTGATGGA
AAGAACACTTGGTGGCAGAGTCCCAGTATTAAGAATGGAATCGAATACCATTATGTGACAATTACCCTGGATTTACAGCAGGTGTTCCAG
ATCGCGTATGTGATTGTGAAGGCAGCTAACTCCCCCCGGCCTGGAAACTGGATTTTGGAACGCTCTCTTGATGATGTTGAATACAAGCCC
TGGCAGTATCATGCTGTGACAGACACGGAGTGCCTAACGCTTTACAATATTTATCCCCGCACTGGGCCACCGTCATATGCCAAAGATGAT
GAGGTCATCTGCACTTCATTTTACTCCAAGATACACCCCTTAGAAAATGGAGAGATTCACATCTCTTTAATCAATGGGAGACCAAGTGCC
GATGATCCTTCTCCAGAACTGCTAGAATTTACCTCCGCTCGCTATATTCGCCTGAGATTTCAGAGGATCCGCACACTGAATGCTGACTTG
ATGATGTTTGCTCACAAAGACCCAAGAGAAATTGACCCCATTGTCACCAGAAGATATTACTACTCGGTCAAGGATATTTCAGTTGGAGGG
ATGTGCATCTGCTATGGTCATGCCAGGGCTTGTCCACTTGATCCAGCGACAAATAAATCTCGCTGTGAGTGTGAGCATAACACATGTGGC
GATAGCTGTGATCAGTGCTGTCCAGGATTCCATCAGAAACCCTGGAGAGCTGGAACTTTTCTAACTAAAACTGAATGTGAAGCATGCAAT
TGTCATGGAAAAGCTGAAGAATGCTATTATGATGAAAATGTTGCCAGAAGAAATCTGAGTTTGAATATACGTGGAAAGTACATTGGAGGG
GGTGTCTGCATTAATTGTACCCAAAACACTGCTGGTATAAACTGCGAGACATGTACTGATGGCTTCTTCAGACCCAAAGGGGTATCTCCA
AATTATCCAAGGCCATGCCAGCCATGTCATTGCGATCCAATTGGTTCCTTAAATGAAGTCTGTGTCAAGGATGAGAAACATGCTCGACGA
GGTTTGGCACCTGGATCCTGTCATTGCAAAACTGGTTTTGGAGGTGTGAGCTGTGATCGGTGTGCCAGGGGCTACACTGGCTACCCGGAC
TGCAAAGCCTGTAACTGCAGTGGGTTAGGGAGCAAAAATGAGGATCCTTGTTTTGGCCCCTGTATCTGCAAGGAAAATGTTGAAGGAGGA
GACTGTAGTCGTTGCAAATCCGGCTTCTTCAATTTGCAAGAGGATAATTGGAAAGGCTGCGATGAGTGTTTCTGTTCAGGGGTTTCAAAC
AGATGTCAGAGTTCCTACTGGACCTATGGCAAAATACAAGATATGAGTGGCTGGTATCTGACTGACCTTCCTGGCCGCATTCGAGTGGCT
CCCCAGCAGGACGACTTGGACTCACCTCAGCAGATCAGCATCAGTAACGCGGAGGCCCGGCAAGCCCTGCCGCACAGCTACTACTGGAGC
GCGCCGGCTCCCTATCTGGGAAACAAACTCCCAGCAGTAGGAGGACAGTTGACATTTACCATATCATATGACCTTGAAGAAGAGGAAGAA
GATACAGAACGTGTTCTCCAGCTTATGATTATCTTAGAGGGTAATGACTTGAGCATCAGCACAGCCCAAGATGAGGTGTACCTGCACCCA
TCTGAAGAACATACTAATGTATTGTTACTTAAAGAAGAATCATTTACCATACATGGCACACATTTTCCAGTCCGTAGAAAGGAATTTATG
ACAGTGCTTGCGAATTTGAAGAGAGTCCTCCTACAAATCACATACAGCTTTGGGATGGATGCCATCTTCAGGTTGAGCTCTGTTAACCTT
GAATCCGCTGTCTCCTATCCTACTGATGGAAGCATTGCAGCAGCTGTAGAAGTGTGTCAGTGCCCACCAGGGTATACTGGCTCCTCTTGT
GAATCTTGTTGGCCTAGGCACAGGCGAGTTAACGGCACTATTTTTGGTGGCATCTGTGAGCCATGTCAGTGCTTTGGTCATGCGGAGTCC
TGTGATGACGTCACTGGAGAATGCCTGAACTGTAAGGATCACACAGGTGGCCCATATTGTGATAAATGTCTTCCTGGTTTCTATGGCGAG
CCTACTAAAGGAACCTCTGAAGACTGTCAACCCTGTGCCTGTCCACTCAATATCCCATCCAATAACTTTAGCCCAACGTGCCATTTAGAC
CGGAGTCTTGGATTGATCTGTGATGGATGCCCTGTCGGGTACACAGGACCACGCTGTGAGAGGTGTGCAGAAGGCTATTTTGGACAACCC
TCTGTACCTGGAGGATCATGTCAGCCATGCCAATGCAATGACAACCTTGACTTCTCCATCCCTGGCAGCTGTGACAGCTTGTCTGGCTCC
TGTCTGATATGTAAACCAGGTACAACAGGCCGGTACTGTGAGCTCTGTGCTGATGGATATTTTGGAGATGCAGTTGATGCGAAGAACTGT
CAGCCCTGTCGCTGTAATGCCGGTGGCTCTTTCTCTGAGGTTTGCCACAGTCAAACTGGACAGTGTGAGTGCAGAGCCAACGTTCAGGGT
CAGAGATGTGACAAATGCAAGGCTGGGACCTTTGGCCTACAATCAGCAAGGGGCTGTGTTCCCTGCAACTGCAATTCTTTTGGGTCTAAG
TCATTCGACTGTGAAGAGAGTGGACAATGTTGGTGCCAACCTGGAGTCACAGGGAAGAAATGTGACCGCTGTGCCCACGGCTATTTCAAC
TTCCAAGAAGGAGGCTGCACAGCTTGTGAATGTTCTCATCTGGGTAATAATTGTGACCCAAAGACTGGGCGATGCATTTGCCCTCCCAAT
ACCATTGGAGAGAAATGTTCTAAATGTGCACCCAATACCTGGGGCCACAGCATTACCACTGGTTGTAAGGCTTGTAACTGCAGCACAGTG
GGATCCTTGGATTTCCAATGCAATGTAAATACAGGCCAATGCAACTGTCATCCAAAATTCTCTGGTGCAAAATGTACAGAGTGCAGTCGA
GGTCACTGGAACTACCCTCGCTGCAATCTCTGTGACTGCTTCCTCCCTGGGACAGATGCCACAACCTGTGATTCAGAGACTAAAAAATGC
TCCTGTAGTGATCAAACTGGGCAGTGCACTTGTAAGGTGAATGTGGAAGGCATCCACTGTGACAGATGCCGGCCTGGCAAATTCGGACTC
GATGCCAAGAATCCACTTGGCTGCAGCAGCTGCTATTGCTTCGGCACTACTACCCAGTGCTCTGAAGCAAAAGGACTGATCCGGACGTGG
GTGACTCTGAAGGCTGAGCAGACCATTCTACCCCTGGTAGATGAGGCTCTGCAGCACACGACCACCAAGGGCATTGTTTTTCAACATCCA
GAGATTGTTGCCCACATGGACCTGATGAGAGAAGATCTCCATTTGGAACCTTTTTATTGGAAACTTCCAGAACAATTTGAAGGAAAGAAG
TTGATGGCCTATGGGGGCAAACTCAAGTATGCAATCTATTTCGAGGCTCGGGAAGAAACAGGTTTCTCTACATATAATCCTCAAGTGATC
ATTCGAGGTGGGACACCTACTCATGCTAGAATTATCGTCAGGCATATGGCTGCTCCTCTGATTGGCCAATTGACAAGGCATGAAATTGAA
ATGACAGAGAAAGAATGGAAATATTATGGGGATGATCCTCGAGTCCATAGAACTGTGACCCGAGAAGACTTCTTGGATATACTATATGAT
ATTCATTACATTCTTATCAAAGCTACTTATGGAAATTTCATGCGACAAAGCAGGATTTCTGAAATCTCAATGGAGGTAGCTGAACAAGGA
CGTGGAACAACAATGACTCCTCCAGCTGACTTGATTGAAAAATGTGATTGTCCCCTGGGCTATTCTGGCCTGTCCTGTGAGGCATGCTTG
CCGGGATTTTATCGACTGCGTTCTCAACCAGGTGGCCGCACCCCTGGACCAACCCTGGGCACCTGTGTTCCATGTCAATGTAATGGACAC
AGCAGCCTGTGTGACCCTGAAACATCGATATGCCAGAATTGTCAACATCACACTGCTGGTGACTTCTGTGAACGATGTGCTCTTGGATAC
TATGGAATTGTCAAGGGATTGCCAAATGACTGTCAGCAATGTGCCTGCCCTCTGATTTCTTCCAGTAACAATTTCAGCCCCTCTTGTGTC
GCAGAAGGACTTGACGACTACCGCTGCACGGCTTGTCCACGGGGATATGAAGGCCAGTACTGTGAAAGGTGTGCCCCTGGCTATACTGGC
AGTCCAGGCAACCCTGGAGGCTCCTGCCAAGAATGTGAGTGTGATCCCTATGGCTCACTGCCTGTGCCCTGTGACCCTGTCACAGGATTC
TGCACGTGCCGACCTGGAGCCACGGGAAGGAAGTGTGACGGCTGCAAGCACTGGCATGCACGCGAGGGCTGGGAGTGTGTTTTTTGTGGA
GATGAGTGCACTGGCCTTCTTCTCGGTGACTTGGCTCGCCTGGAGCAGATGGTCATGAGCATCAACCTCACTGGTCCGCTGCCTGCGCCA
TATAAAATGCTGTATGGTCTTGAAAATATGACTCAGGAGCTAAAGCACTTGCTGTCACCTCAGCGGGCCCCAGAGAGGCTTATTCAGCTG
GCAGAGGGCAATCTGAATACACTCGTGACCGAAATGAACGAGCTGCTGACCAGGGCTACCAAAGTGACAGCAGATGGCGAGCAGACCGGA
CAGGATGCTGAGAGGACCAACACAAGAGCAAAGTCCCTGGGAGAATTCATTAAGGAGCTTGCCCGGGATGCAGAAGCTGTAAATGAAAAA
GCTATAAAACTAAATGAAACTCTAGGAACTCGAGACGAGGCCTTTGAGAGAAATTTGGAAGGGCTTCAGAAAGAGATTGACCAGATGATT
AAAGAACTGAGGAGGAAAAATCTAGAGACACAAAAGGAAATTGCTGAAGATGAGTTGGTAGCTGCAGAAGCCCTTCTGAAAAAAGTGAAG
AAGCTGTTTGGAGAGTCCCGGGGGGAAAATGAAGAAATGGAGAAGGATCTCCGGGAAAAACTGGCTGACTACAAAAACAAAGTTGATGAT
GCTTGGGACCTTTTGAGAGAAGCCACAGATAAAATCAGAGAAGCTAATCGCCTATTTGCAGTAAATCAGAAAAACATGACTGCATTGGAG
AAAAAGAAGGAGGCTGTTGAAAGCGGCAAACGACAAATTGAGAACACTTTAAAAGAGGGCAATGACATACTCGATGAAGCCAACCGTCTT
GCAGATGAAATCAACTCCATCATAGACTATGTTGAAGACATCCAAACTAAATTGCCACCTATGTCTGAGGAGCTTAATGATAAAATAGAT
GACCTCTCCCAAGAAATAAAGGACAGGAAGCTTGCTGAGAAGGTGTCCCAGGCTGAGAGCCACGCAGCTCAGTTGAATGACTCATCTGCT
GTCCTTGATGGAATCCTTGATGAGGCTAAAAACATCTCCTTCAATGCCACTGCAGCCTTCAAAGCTTACAGCAATATTAAGGACTATATT
GATGAAGCTGAGAAAGTTGCCAAAGAAGCCAAAGATCTTGCACATGAAGCTACAAAACTGGCAACAGGTCCTCGGGGTTTATTAAAGGAA
GATGCCAAAGGCTGTCTTCAGAAAAGCTTCAGGATTCTTAACGAAGCCAAGAAGTTAGCAAATGATGTAAAAGAAAATGAAGACCATCTA
AATGGCTTAAAAACCAGGATAGAAAATGCTGATGCTAGAAATGGGGATCTCTTGAGAACTTTGAATGACACTTTGGGAAAGTTATCAGCT
ATTCCAAATGATACAGCTGCTAAACTGCAAGCTGTTAAGGACAAAGCCAGACAAGCCAACGACACAGCTAAAGATGTACTGGCACAGATT
ACAGAGCTCCACCAGAACCTCGATGGCCTGAAGAAGAATTACAATAAACTAGCAGACAGCGTCGCCAAAACGAATGCTGTGGTTAAAGAT
CCTTCCAAGAACAAAATCATTGCCGATGCAGATGCCACTGTCAAAAATTTAGAACAGGAAGCTGACCGGCTAATAGATAAACTCAAACCC
ATCAAGGAACTTGAGGATAACCTAAAGAAAAACATCTCTGAGATAAAGGAATTGATAAACCAAGCTCGGAAACAAGCCAATTCTATCAAA
GTATCTGTGTCTTCAGGAGGTGACTGCATTCGAACATACAAACCAGAAATCAAGAAAGGAAGTTACAATAATATTGTTGTCAACGTAAAG
ACAGCTGTTGCTGATAACCTCCTCTTTTATCTTGGAAGTGCCAAATTTATTGACTTTCTGGCTATAGAAATGCGTAAAGGCAAAGTCAGC
TTCCTCTGGGATGTTGGATCTGGAGTTGGACGTGTAGAGTACCCAGATTTGACTATTGATGACTCATATTGGTACCGTATCGTAGCATCA
AGAACTGGGAGAAATGGAACTATTTCTGTGAGAGCCCTGGATGGACCCAAAGCCAGCATTGTGCCCAGCACACACCATTCGACGTCTCCT
CCAGGGTACACGATTCTAGATGTGGATGCAAATGCAATGCTGTTTGTTGGTGGCCTGACTGGGAAATTAAAGAAGGCTGATGCTGTACGT
GTGATTACATTCACTGGCTGCATGGGAGAAACATACTTTGACAACAAACCTATAGGTTTGTGGAATTTCCGAGAAAAAGAAGGTGACTGC
AAAGGATGCACTGTCAGTCCTCAGGTGGAAGATAGTGAGGGGACTATTCAATTTGATGGAGAAGGTTATGCATTGGTCAGCCGTCCCATT
CGCTGGTACCCCAACATCTCCACTGTCATGTTCAAGTTCAGAACATTTTCTTCGAGTGCTCTTCTGATGTATCTTGCCACACGAGACCTG
AGAGATTTCATGAGTGTGGAGCTCACTGATGGGCACATAAAAGTCAGTTACGATCTGGGCTCAGGAATGGCTTCCGTTGTCAGCAATCAA
AACCATAATGATGGGAAATGGAAATCATTCACTCTGTCAAGAATTCAAAAACAAGCCAATATATCAATTGTAGATATAGATACTAATCAG
GAGGAGAATATAGCAACTTCGTCTTCTGGAAACAACTTTGGTCTTGACTTGAAAGCAGATGACAAAATATATTTTGGTGGCCTGCCAACG
CTGAGAAACTTGAGTATGAAAGCAAGGCCAGAAGTAAATCTGAAGAAATATTCCGGCTGCCTCAAAGATATTGAAATTTCAAGAACTCCG
TACAATATACTCAGTAGTCCCGATTATGTTGGTGTTACCAAAGGATGTTCCCTGGAGAATGTTTACACAGTTAGCTTTCCTAAGCCTGGT
TTTGTGGAGCTCTCCCCTGTGCCAATTGATGTAGGAACAGAAATCAACCTGTCATTCAGCACCAAGAATGAGTCCGGCATCATTCTTTTG
GGAAGTGGAGGGACACCAGCACCACCTAGGAGAAAACGAAGGCAGACTGGACAGGCCTATTATGCAATACTCCTCAACAGGGGCCGTCTG
GAAGTGCATCTCTCCACAGGGGCACGAACAATGAGGAAAATTGTGATCAGACCAGAGCCGAATCTGTTTCATGATGGAAGAGAACATTCC
GTTCATGTAGAGCGAACTAGAGGCATCTTTACAGTTCAAGTGGATGAAAACAGAAGATACATGCAAAACCTGACAGTTGAACAGCCTATC
GAAGTTAAAAAGCTTTTCGTTGGGGGTGCTCCACCTGAATTTCAACCTTCCCCACTCAGAAATATTCCTCCTTTTGAAGGCTGCATATGG
AATCTTGTTATTAACTCTGTCCCCATGGACTTTGCAAGGCCTGTGTCCTTCAAAAATGCTGACATTGGTCGCTGTGCCCATCAGAAACTC
CGTGAAGATGAAGATGGAGCAGCTCCAGCTGAAATAGTTATCCAGCCTGAGCCAGTTCCCACCCCAGCCTTTCCTACGCCCACCCCAGTT
CTGACACATGGTCCTTGTGCTGCAGAATCAGAACCAGCTCTTTTGATAGGGAGCAAGCAGTTCGGGCTTTCAAGAAACAGTCACATTGCA
ATTGCATTTGATGACACCAAAGTTAAAAACCGTCTCACAATTGAGTTGGAAGTAAGAACCGAAGCTGAATCCGGCTTGCTTTTTTACATG
GCTCGCATCAATCATGCTGATTTTGCAACAGTTCAGCTGAGAAATGGATTGCCCTACTTCAGCTATGACTTGGGGAGTGGGGACACCCAC
ACCATGATCCCCACCAAAATCAATGATGGCCAGTGGCACAAGATTAAGATAATGAGAAGTAAGCAAGAAGGAATTCTTTATGTAGATGGG
GCTTCCAACAGAACCATCAGTCCCAAAAAAGCCGACATCCTGGATGTCGTGGGAATGCTGTATGTTGGTGGGTTACCCATCAACTACACT
ACCCGAAGAATTGGTCCAGTGACCTATAGCATTGATGGCTGCGTCAGGAATCTCCACATGGCAGAGGCCCCTGCCGATCTGGAACAACCC
ACCTCCAGCTTCCATGTTGGGACATGTTTTGCAAATGCTCAGAGGGGAACATATTTTGACGGAACCGGTTTTGCCAAAGCAGTTGGTGGA
TTCAAAGTGGGATTGGACCTTCTTGTAGAATTTGAATTCCGCACAACTACAACGACTGGAGTTCTTCTGGGGATCAGTAGTCAAAAAATG
GATGGAATGGGTATTGAAATGATTGATGAAAAGTTGATGTTTCATGTGGACAATGGTGCGGGCAGATTCACTGCTGTCTATGATGCTGGG
GTTCCAGGGCATTTGTGTGATGGACAATGGCATAAAGTCACTGCCAACAAGATCAAACACCGCATTGAGCTCACAGTCGATGGGAACCAG
GTGGAAGCCCAAAGCCCAAACCCAGCATCTACATCAGCTGACACAAATGACCCTGTGTTTGTTGGAGGCTTCCCAGATGACCTCAAGCAG
TTTGGCCTAACAACCAGTATTCCGTTCCGAGGTTGCATCAGATCCCTGAAGCTCACCAAAGGCACAGGCAAGCCACTGGAGGTTAATTTT

>In-frame_FAM135A_ENST00000505868_chr6_71162274_+_LAMA2_ENST00000421865_chr6_129371063_+_9414nt
ATGACTGAAGTTCAAGCAATGGTAGAATTCTCTGTGGAGCTAAACAAGTTCTACAATGTGGATTTGTTTCAGAGAGGTTTTTACCAGATT
CGTGCTTCTATGAAAATTCCATCAAGAATTCCCCACAGAGTAGAAGCTAGTTTGTTGCATGCAACAGGTTTATTCCCTGCTGTCCTGAAT
CTTGCTTCTAATGCTCTTATCACGACCAATGCAACATGTGGAGAAAAAGGACCTGAAATGTACTGCAAATTGGTAGAACATGTCCCTGGG
CAGCCTGTGAGGAACCCGCAGTGTCGAATCTGCAATCAAAACAGCAGCAATCCAAACCAGAGACACCCGATTACAAATGCTATTGATGGA
AAGAACACTTGGTGGCAGAGTCCCAGTATTAAGAATGGAATCGAATACCATTATGTGACAATTACCCTGGATTTACAGCAGGTGTTCCAG
ATCGCGTATGTGATTGTGAAGGCAGCTAACTCCCCCCGGCCTGGAAACTGGATTTTGGAACGCTCTCTTGATGATGTTGAATACAAGCCC
TGGCAGTATCATGCTGTGACAGACACGGAGTGCCTAACGCTTTACAATATTTATCCCCGCACTGGGCCACCGTCATATGCCAAAGATGAT
GAGGTCATCTGCACTTCATTTTACTCCAAGATACACCCCTTAGAAAATGGAGAGATTCACATCTCTTTAATCAATGGGAGACCAAGTGCC
GATGATCCTTCTCCAGAACTGCTAGAATTTACCTCCGCTCGCTATATTCGCCTGAGATTTCAGAGGATCCGCACACTGAATGCTGACTTG
ATGATGTTTGCTCACAAAGACCCAAGAGAAATTGACCCCATTGTCACCAGAAGATATTACTACTCGGTCAAGGATATTTCAGTTGGAGGG
ATGTGCATCTGCTATGGTCATGCCAGGGCTTGTCCACTTGATCCAGCGACAAATAAATCTCGCTGTGAGTGTGAGCATAACACATGTGGC
GATAGCTGTGATCAGTGCTGTCCAGGATTCCATCAGAAACCCTGGAGAGCTGGAACTTTTCTAACTAAAACTGAATGTGAAGCATGCAAT
TGTCATGGAAAAGCTGAAGAATGCTATTATGATGAAAATGTTGCCAGAAGAAATCTGAGTTTGAATATACGTGGAAAGTACATTGGAGGG
GGTGTCTGCATTAATTGTACCCAAAACACTGCTGGTATAAACTGCGAGACATGTACTGATGGCTTCTTCAGACCCAAAGGGGTATCTCCA
AATTATCCAAGGCCATGCCAGCCATGTCATTGCGATCCAATTGGTTCCTTAAATGAAGTCTGTGTCAAGGATGAGAAACATGCTCGACGA
GGTTTGGCACCTGGATCCTGTCATTGCAAAACTGGTTTTGGAGGTGTGAGCTGTGATCGGTGTGCCAGGGGCTACACTGGCTACCCGGAC
TGCAAAGCCTGTAACTGCAGTGGGTTAGGGAGCAAAAATGAGGATCCTTGTTTTGGCCCCTGTATCTGCAAGGAAAATGTTGAAGGAGGA
GACTGTAGTCGTTGCAAATCCGGCTTCTTCAATTTGCAAGAGGATAATTGGAAAGGCTGCGATGAGTGTTTCTGTTCAGGGGTTTCAAAC
AGATGTCAGAGTTCCTACTGGACCTATGGCAAAATACAAGATATGAGTGGCTGGTATCTGACTGACCTTCCTGGCCGCATTCGAGTGGCT
CCCCAGCAGGACGACTTGGACTCACCTCAGCAGATCAGCATCAGTAACGCGGAGGCCCGGCAAGCCCTGCCGCACAGCTACTACTGGAGC
GCGCCGGCTCCCTATCTGGGAAACAAACTCCCAGCAGTAGGAGGACAGTTGACATTTACCATATCATATGACCTTGAAGAAGAGGAAGAA
GATACAGAACGTGTTCTCCAGCTTATGATTATCTTAGAGGGTAATGACTTGAGCATCAGCACAGCCCAAGATGAGGTGTACCTGCACCCA
TCTGAAGAACATACTAATGTATTGTTACTTAAAGAAGAATCATTTACCATACATGGCACACATTTTCCAGTCCGTAGAAAGGAATTTATG
ACAGTGCTTGCGAATTTGAAGAGAGTCCTCCTACAAATCACATACAGCTTTGGGATGGATGCCATCTTCAGGTTGAGCTCTGTTAACCTT
GAATCCGCTGTCTCCTATCCTACTGATGGAAGCATTGCAGCAGCTGTAGAAGTGTGTCAGTGCCCACCAGGGTATACTGGCTCCTCTTGT
GAATCTTGTTGGCCTAGGCACAGGCGAGTTAACGGCACTATTTTTGGTGGCATCTGTGAGCCATGTCAGTGCTTTGGTCATGCGGAGTCC
TGTGATGACGTCACTGGAGAATGCCTGAACTGTAAGGATCACACAGGTGGCCCATATTGTGATAAATGTCTTCCTGGTTTCTATGGCGAG
CCTACTAAAGGAACCTCTGAAGACTGTCAACCCTGTGCCTGTCCACTCAATATCCCATCCAATAACTTTAGCCCAACGTGCCATTTAGAC
CGGAGTCTTGGATTGATCTGTGATGGATGCCCTGTCGGGTACACAGGACCACGCTGTGAGAGGTGTGCAGAAGGCTATTTTGGACAACCC
TCTGTACCTGGAGGATCATGTCAGCCATGCCAATGCAATGACAACCTTGACTTCTCCATCCCTGGCAGCTGTGACAGCTTGTCTGGCTCC
TGTCTGATATGTAAACCAGGTACAACAGGCCGGTACTGTGAGCTCTGTGCTGATGGATATTTTGGAGATGCAGTTGATGCGAAGAACTGT
CAGCCCTGTCGCTGTAATGCCGGTGGCTCTTTCTCTGAGGTTTGCCACAGTCAAACTGGACAGTGTGAGTGCAGAGCCAACGTTCAGGGT
CAGAGATGTGACAAATGCAAGGCTGGGACCTTTGGCCTACAATCAGCAAGGGGCTGTGTTCCCTGCAACTGCAATTCTTTTGGGTCTAAG
TCATTCGACTGTGAAGAGAGTGGACAATGTTGGTGCCAACCTGGAGTCACAGGGAAGAAATGTGACCGCTGTGCCCACGGCTATTTCAAC
TTCCAAGAAGGAGGCTGCACAGCTTGTGAATGTTCTCATCTGGGTAATAATTGTGACCCAAAGACTGGGCGATGCATTTGCCCTCCCAAT
ACCATTGGAGAGAAATGTTCTAAATGTGCACCCAATACCTGGGGCCACAGCATTACCACTGGTTGTAAGGCTTGTAACTGCAGCACAGTG
GGATCCTTGGATTTCCAATGCAATGTAAATACAGGCCAATGCAACTGTCATCCAAAATTCTCTGGTGCAAAATGTACAGAGTGCAGTCGA
GGTCACTGGAACTACCCTCGCTGCAATCTCTGTGACTGCTTCCTCCCTGGGACAGATGCCACAACCTGTGATTCAGAGACTAAAAAATGC
TCCTGTAGTGATCAAACTGGGCAGTGCACTTGTAAGGTGAATGTGGAAGGCATCCACTGTGACAGATGCCGGCCTGGCAAATTCGGACTC
GATGCCAAGAATCCACTTGGCTGCAGCAGCTGCTATTGCTTCGGCACTACTACCCAGTGCTCTGAAGCAAAAGGACTGATCCGGACGTGG
GTGACTCTGAAGGCTGAGCAGACCATTCTACCCCTGGTAGATGAGGCTCTGCAGCACACGACCACCAAGGGCATTGTTTTTCAACATCCA
GAGATTGTTGCCCACATGGACCTGATGAGAGAAGATCTCCATTTGGAACCTTTTTATTGGAAACTTCCAGAACAATTTGAAGGAAAGAAG
TTGATGGCCTATGGGGGCAAACTCAAGTATGCAATCTATTTCGAGGCTCGGGAAGAAACAGGTTTCTCTACATATAATCCTCAAGTGATC
ATTCGAGGTGGGACACCTACTCATGCTAGAATTATCGTCAGGCATATGGCTGCTCCTCTGATTGGCCAATTGACAAGGCATGAAATTGAA
ATGACAGAGAAAGAATGGAAATATTATGGGGATGATCCTCGAGTCCATAGAACTGTGACCCGAGAAGACTTCTTGGATATACTATATGAT
ATTCATTACATTCTTATCAAAGCTACTTATGGAAATTTCATGCGACAAAGCAGGATTTCTGAAATCTCAATGGAGGTAGCTGAACAAGGA
CGTGGAACAACAATGACTCCTCCAGCTGACTTGATTGAAAAATGTGATTGTCCCCTGGGCTATTCTGGCCTGTCCTGTGAGGCATGCTTG
CCGGGATTTTATCGACTGCGTTCTCAACCAGGTGGCCGCACCCCTGGACCAACCCTGGGCACCTGTGTTCCATGTCAATGTAATGGACAC
AGCAGCCTGTGTGACCCTGAAACATCGATATGCCAGAATTGTCAACATCACACTGCTGGTGACTTCTGTGAACGATGTGCTCTTGGATAC
TATGGAATTGTCAAGGGATTGCCAAATGACTGTCAGCAATGTGCCTGCCCTCTGATTTCTTCCAGTAACAATTTCAGCCCCTCTTGTGTC
GCAGAAGGACTTGACGACTACCGCTGCACGGCTTGTCCACGGGGATATGAAGGCCAGTACTGTGAAAGGTGTGCCCCTGGCTATACTGGC
AGTCCAGGCAACCCTGGAGGCTCCTGCCAAGAATGTGAGTGTGATCCCTATGGCTCACTGCCTGTGCCCTGTGACCCTGTCACAGGATTC
TGCACGTGCCGACCTGGAGCCACGGGAAGGAAGTGTGACGGCTGCAAGCACTGGCATGCACGCGAGGGCTGGGAGTGTGTTTTTTGTGGA
GATGAGTGCACTGGCCTTCTTCTCGGTGACTTGGCTCGCCTGGAGCAGATGGTCATGAGCATCAACCTCACTGGTCCGCTGCCTGCGCCA
TATAAAATGCTGTATGGTCTTGAAAATATGACTCAGGAGCTAAAGCACTTGCTGTCACCTCAGCGGGCCCCAGAGAGGCTTATTCAGCTG
GCAGAGGGCAATCTGAATACACTCGTGACCGAAATGAACGAGCTGCTGACCAGGGCTACCAAAGTGACAGCAGATGGCGAGCAGACCGGA
CAGGATGCTGAGAGGACCAACACAAGAGCAAAGTCCCTGGGAGAATTCATTAAGGAGCTTGCCCGGGATGCAGAAGCTGTAAATGAAAAA
GCTATAAAACTAAATGAAACTCTAGGAACTCGAGACGAGGCCTTTGAGAGAAATTTGGAAGGGCTTCAGAAAGAGATTGACCAGATGATT
AAAGAACTGAGGAGGAAAAATCTAGAGACACAAAAGGAAATTGCTGAAGATGAGTTGGTAGCTGCAGAAGCCCTTCTGAAAAAAGTGAAG
AAGCTGTTTGGAGAGTCCCGGGGGGAAAATGAAGAAATGGAGAAGGATCTCCGGGAAAAACTGGCTGACTACAAAAACAAAGTTGATGAT
GCTTGGGACCTTTTGAGAGAAGCCACAGATAAAATCAGAGAAGCTAATCGCCTATTTGCAGTAAATCAGAAAAACATGACTGCATTGGAG
AAAAAGAAGGAGGCTGTTGAAAGCGGCAAACGACAAATTGAGAACACTTTAAAAGAGGGCAATGACATACTCGATGAAGCCAACCGTCTT
GCAGATGAAATCAACTCCATCATAGACTATGTTGAAGACATCCAAACTAAATTGCCACCTATGTCTGAGGAGCTTAATGATAAAATAGAT
GACCTCTCCCAAGAAATAAAGGACAGGAAGCTTGCTGAGAAGGTGTCCCAGGCTGAGAGCCACGCAGCTCAGTTGAATGACTCATCTGCT
GTCCTTGATGGAATCCTTGATGAGGCTAAAAACATCTCCTTCAATGCCACTGCAGCCTTCAAAGCTTACAGCAATATTAAGGACTATATT
GATGAAGCTGAGAAAGTTGCCAAAGAAGCCAAAGATCTTGCACATGAAGCTACAAAACTGGCAACAGGTCCTCGGGGTTTATTAAAGGAA
GATGCCAAAGGCTGTCTTCAGAAAAGCTTCAGGATTCTTAACGAAGCCAAGAAGTTAGCAAATGATGTAAAAGAAAATGAAGACCATCTA
AATGGCTTAAAAACCAGGATAGAAAATGCTGATGCTAGAAATGGGGATCTCTTGAGAACTTTGAATGACACTTTGGGAAAGTTATCAGCT
ATTCCAAATGATACAGCTGCTAAACTGCAAGCTGTTAAGGACAAAGCCAGACAAGCCAACGACACAGCTAAAGATGTACTGGCACAGATT
ACAGAGCTCCACCAGAACCTCGATGGCCTGAAGAAGAATTACAATAAACTAGCAGACAGCGTCGCCAAAACGAATGCTGTGGTTAAAGAT
CCTTCCAAGAACAAAATCATTGCCGATGCAGATGCCACTGTCAAAAATTTAGAACAGGAAGCTGACCGGCTAATAGATAAACTCAAACCC
ATCAAGGAACTTGAGGATAACCTAAAGAAAAACATCTCTGAGATAAAGGAATTGATAAACCAAGCTCGGAAACAAGCCAATTCTATCAAA
GTATCTGTGTCTTCAGGAGGTGACTGCATTCGAACATACAAACCAGAAATCAAGAAAGGAAGTTACAATAATATTGTTGTCAACGTAAAG
ACAGCTGTTGCTGATAACCTCCTCTTTTATCTTGGAAGTGCCAAATTTATTGACTTTCTGGCTATAGAAATGCGTAAAGGCAAAGTCAGC
TTCCTCTGGGATGTTGGATCTGGAGTTGGACGTGTAGAGTACCCAGATTTGACTATTGATGACTCATATTGGTACCGTATCGTAGCATCA
AGAACTGGGAGAAATGGAACTATTTCTGTGAGAGCCCTGGATGGACCCAAAGCCAGCATTGTGCCCAGCACACACCATTCGACGTCTCCT
CCAGGGTACACGATTCTAGATGTGGATGCAAATGCAATGCTGTTTGTTGGTGGCCTGACTGGGAAATTAAAGAAGGCTGATGCTGTACGT
GTGATTACATTCACTGGCTGCATGGGAGAAACATACTTTGACAACAAACCTATAGGTTTGTGGAATTTCCGAGAAAAAGAAGGTGACTGC
AAAGGATGCACTGTCAGTCCTCAGGTGGAAGATAGTGAGGGGACTATTCAATTTGATGGAGAAGGTTATGCATTGGTCAGCCGTCCCATT
CGCTGGTACCCCAACATCTCCACTGTCATGTTCAAGTTCAGAACATTTTCTTCGAGTGCTCTTCTGATGTATCTTGCCACACGAGACCTG
AGAGATTTCATGAGTGTGGAGCTCACTGATGGGCACATAAAAGTCAGTTACGATCTGGGCTCAGGAATGGCTTCCGTTGTCAGCAATCAA
AACCATAATGATGGGAAATGGAAATCATTCACTCTGTCAAGAATTCAAAAACAAGCCAATATATCAATTGTAGATATAGATACTAATCAG
GAGGAGAATATAGCAACTTCGTCTTCTGGAAACAACTTTGGTCTTGACTTGAAAGCAGATGACAAAATATATTTTGGTGGCCTGCCAACG
CTGAGAAACTTGAGTATGAAAGCAAGGCCAGAAGTAAATCTGAAGAAATATTCCGGCTGCCTCAAAGATATTGAAATTTCAAGAACTCCG
TACAATATACTCAGTAGTCCCGATTATGTTGGTGTTACCAAAGGATGTTCCCTGGAGAATGTTTACACAGTTAGCTTTCCTAAGCCTGGT
TTTGTGGAGCTCTCCCCTGTGCCAATTGATGTAGGAACAGAAATCAACCTGTCATTCAGCACCAAGAATGAGTCCGGCATCATTCTTTTG
GGAAGTGGAGGGACACCAGCACCACCTAGGAGAAAACGAAGGCAGACTGGACAGGCCTATTATGCAATACTCCTCAACAGGGGCCGTCTG
GAAGTGCATCTCTCCACAGGGGCACGAACAATGAGGAAAATTGTGATCAGACCAGAGCCGAATCTGTTTCATGATGGAAGAGAACATTCC
GTTCATGTAGAGCGAACTAGAGGCATCTTTACAGTTCAAGTGGATGAAAACAGAAGATACATGCAAAACCTGACAGTTGAACAGCCTATC
GAAGTTAAAAAGCTTTTCGTTGGGGGTGCTCCACCTGAATTTCAACCTTCCCCACTCAGAAATATTCCTCCTTTTGAAGGCTGCATATGG
AATCTTGTTATTAACTCTGTCCCCATGGACTTTGCAAGGCCTGTGTCCTTCAAAAATGCTGACATTGGTCGCTGTGCCCATCAGAAACTC
CGTGAAGATGAAGATGGAGCAGCTCCAGCTGAAATAGTTATCCAGCCTGAGCCAGTTCCCACCCCAGCCTTTCCTACGCCCACCCCAGTT
CTGACACATGGTCCTTGTGCTGCAGAATCAGAACCAGCTCTTTTGATAGGGAGCAAGCAGTTCGGGCTTTCAAGAAACAGTCACATTGCA
ATTGCATTTGATGACACCAAAGTTAAAAACCGTCTCACAATTGAGTTGGAAGTAAGAACCGAAGCTGAATCCGGCTTGCTTTTTTACATG
GCTCGCATCAATCATGCTGATTTTGCAACAGTTCAGCTGAGAAATGGATTGCCCTACTTCAGCTATGACTTGGGGAGTGGGGACACCCAC
ACCATGATCCCCACCAAAATCAATGATGGCCAGTGGCACAAGATTAAGATAATGAGAAGTAAGCAAGAAGGAATTCTTTATGTAGATGGG
GCTTCCAACAGAACCATCAGTCCCAAAAAAGCCGACATCCTGGATGTCGTGGGAATGCTGTATGTTGGTGGGTTACCCATCAACTACACT
ACCCGAAGAATTGGTCCAGTGACCTATAGCATTGATGGCTGCGTCAGGAATCTCCACATGGCAGAGGCCCCTGCCGATCTGGAACAACCC
ACCTCCAGCTTCCATGTTGGGACATGTTTTGCAAATGCTCAGAGGGGAACATATTTTGACGGAACCGGTTTTGCCAAAGCAGTTGGTGGA
TTCAAAGTGGGATTGGACCTTCTTGTAGAATTTGAATTCCGCACAACTACAACGACTGGAGTTCTTCTGGGGATCAGTAGTCAAAAAATG
GATGGAATGGGTATTGAAATGATTGATGAAAAGTTGATGTTTCATGTGGACAATGGTGCGGGCAGATTCACTGCTGTCTATGATGCTGGG
GTTCCAGGGCATTTGTGTGATGGACAATGGCATAAAGTCACTGCCAACAAGATCAAACACCGCATTGAGCTCACAGTCGATGGGAACCAG
GTGGAAGCCCAAAGCCCAAACCCAGCATCTACATCAGCTGACACAAATGACCCTGTGTTTGTTGGAGGCTTCCCAGATGACCTCAAGCAG
TTTGGCCTAACAACCAGTATTCCGTTCCGAGGTTGCATCAGATCCCTGAAGCTCACCAAAGGCACAGGCAAGCCACTGGAGGTTAATTTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_FAM135A_ENST00000418814_chr6_71162274_+_LAMA2_ENST00000421865_chr6_129371063_+_10250nt
GCTGGAGGGGCAGTTGAAGCTCCTGAAGGGCGGGGCACGGAGCTTGAAGGGGCGGGGCCTAGCCTCAGAGAGGGGAGGGAAGAGGCGGGA
GGAGGAGGTGAGAGAGGCCGGGGGCGGGGCCGTGCGGCCGGGGACCTGTTGATCGCAGGTATAGCCGGCTGGCCCGGGCTCCCTCGGGAC
TGGGGCGACTGCGCATGCTCGCTGGCCGCGCTGGGCCAGTAGCCGAGCCGCGGTGACGAACCGGCTCCGCGGTTGCGGTGTTTGCGGTTG
CTGTGATGGCGATGTGAGGGGGCCCGGGGCGGGATGGTGCTGACCCGGGTCGGGCCGTCTTCTTGCAGCTGGACAACGAGCTCCTCCGTT
CGACAGGCGGGGGAAGAGGCCGAGCCGGGCGAGAGGGTTGAAGATCAACTGGATTATGTATTTGGTTCTGGAATCTCAAAGCAGTCCACA
AACAAATTCTTCCTTATGTTGTCTGTGTCAGGGGGAACGGTGTATTTTTAACAACGGGAATCAGTAACTGGAAGTACAAGATTGGTTATT
TAATAATGTTAAAAATGAGGCTTTGAAAAGCAGAGGTGCTGTTATCAGAATAGTCTTCTGGGTATAAATTAAAAATGACTGAAGTTCAAG
CAATGGTAGAATTCTCTGTGGAGCTAAACAAGTTCTACAATGTGGATTTGTTTCAGAGAGGTTTTTACCAGATTCGTGCTTCTATGAAAA
TTCCATCAAGAATTCCCCACAGAGTAGAAGCTAGTTTGTTGCATGCAACAGGTTTATTCCCTGCTGTCCTGAATCTTGCTTCTAATGCTC
TTATCACGACCAATGCAACATGTGGAGAAAAAGGACCTGAAATGTACTGCAAATTGGTAGAACATGTCCCTGGGCAGCCTGTGAGGAACC
CGCAGTGTCGAATCTGCAATCAAAACAGCAGCAATCCAAACCAGAGACACCCGATTACAAATGCTATTGATGGAAAGAACACTTGGTGGC
AGAGTCCCAGTATTAAGAATGGAATCGAATACCATTATGTGACAATTACCCTGGATTTACAGCAGGTGTTCCAGATCGCGTATGTGATTG
TGAAGGCAGCTAACTCCCCCCGGCCTGGAAACTGGATTTTGGAACGCTCTCTTGATGATGTTGAATACAAGCCCTGGCAGTATCATGCTG
TGACAGACACGGAGTGCCTAACGCTTTACAATATTTATCCCCGCACTGGGCCACCGTCATATGCCAAAGATGATGAGGTCATCTGCACTT
CATTTTACTCCAAGATACACCCCTTAGAAAATGGAGAGATTCACATCTCTTTAATCAATGGGAGACCAAGTGCCGATGATCCTTCTCCAG
AACTGCTAGAATTTACCTCCGCTCGCTATATTCGCCTGAGATTTCAGAGGATCCGCACACTGAATGCTGACTTGATGATGTTTGCTCACA
AAGACCCAAGAGAAATTGACCCCATTGTCACCAGAAGATATTACTACTCGGTCAAGGATATTTCAGTTGGAGGGATGTGCATCTGCTATG
GTCATGCCAGGGCTTGTCCACTTGATCCAGCGACAAATAAATCTCGCTGTGAGTGTGAGCATAACACATGTGGCGATAGCTGTGATCAGT
GCTGTCCAGGATTCCATCAGAAACCCTGGAGAGCTGGAACTTTTCTAACTAAAACTGAATGTGAAGCATGCAATTGTCATGGAAAAGCTG
AAGAATGCTATTATGATGAAAATGTTGCCAGAAGAAATCTGAGTTTGAATATACGTGGAAAGTACATTGGAGGGGGTGTCTGCATTAATT
GTACCCAAAACACTGCTGGTATAAACTGCGAGACATGTACTGATGGCTTCTTCAGACCCAAAGGGGTATCTCCAAATTATCCAAGGCCAT
GCCAGCCATGTCATTGCGATCCAATTGGTTCCTTAAATGAAGTCTGTGTCAAGGATGAGAAACATGCTCGACGAGGTTTGGCACCTGGAT
CCTGTCATTGCAAAACTGGTTTTGGAGGTGTGAGCTGTGATCGGTGTGCCAGGGGCTACACTGGCTACCCGGACTGCAAAGCCTGTAACT
GCAGTGGGTTAGGGAGCAAAAATGAGGATCCTTGTTTTGGCCCCTGTATCTGCAAGGAAAATGTTGAAGGAGGAGACTGTAGTCGTTGCA
AATCCGGCTTCTTCAATTTGCAAGAGGATAATTGGAAAGGCTGCGATGAGTGTTTCTGTTCAGGGGTTTCAAACAGATGTCAGAGTTCCT
ACTGGACCTATGGCAAAATACAAGATATGAGTGGCTGGTATCTGACTGACCTTCCTGGCCGCATTCGAGTGGCTCCCCAGCAGGACGACT
TGGACTCACCTCAGCAGATCAGCATCAGTAACGCGGAGGCCCGGCAAGCCCTGCCGCACAGCTACTACTGGAGCGCGCCGGCTCCCTATC
TGGGAAACAAACTCCCAGCAGTAGGAGGACAGTTGACATTTACCATATCATATGACCTTGAAGAAGAGGAAGAAGATACAGAACGTGTTC
TCCAGCTTATGATTATCTTAGAGGGTAATGACTTGAGCATCAGCACAGCCCAAGATGAGGTGTACCTGCACCCATCTGAAGAACATACTA
ATGTATTGTTACTTAAAGAAGAATCATTTACCATACATGGCACACATTTTCCAGTCCGTAGAAAGGAATTTATGACAGTGCTTGCGAATT
TGAAGAGAGTCCTCCTACAAATCACATACAGCTTTGGGATGGATGCCATCTTCAGGTTGAGCTCTGTTAACCTTGAATCCGCTGTCTCCT
ATCCTACTGATGGAAGCATTGCAGCAGCTGTAGAAGTGTGTCAGTGCCCACCAGGGTATACTGGCTCCTCTTGTGAATCTTGTTGGCCTA
GGCACAGGCGAGTTAACGGCACTATTTTTGGTGGCATCTGTGAGCCATGTCAGTGCTTTGGTCATGCGGAGTCCTGTGATGACGTCACTG
GAGAATGCCTGAACTGTAAGGATCACACAGGTGGCCCATATTGTGATAAATGTCTTCCTGGTTTCTATGGCGAGCCTACTAAAGGAACCT
CTGAAGACTGTCAACCCTGTGCCTGTCCACTCAATATCCCATCCAATAACTTTAGCCCAACGTGCCATTTAGACCGGAGTCTTGGATTGA
TCTGTGATGGATGCCCTGTCGGGTACACAGGACCACGCTGTGAGAGGTGTGCAGAAGGCTATTTTGGACAACCCTCTGTACCTGGAGGAT
CATGTCAGCCATGCCAATGCAATGACAACCTTGACTTCTCCATCCCTGGCAGCTGTGACAGCTTGTCTGGCTCCTGTCTGATATGTAAAC
CAGGTACAACAGGCCGGTACTGTGAGCTCTGTGCTGATGGATATTTTGGAGATGCAGTTGATGCGAAGAACTGTCAGCCCTGTCGCTGTA
ATGCCGGTGGCTCTTTCTCTGAGGTTTGCCACAGTCAAACTGGACAGTGTGAGTGCAGAGCCAACGTTCAGGGTCAGAGATGTGACAAAT
GCAAGGCTGGGACCTTTGGCCTACAATCAGCAAGGGGCTGTGTTCCCTGCAACTGCAATTCTTTTGGGTCTAAGTCATTCGACTGTGAAG
AGAGTGGACAATGTTGGTGCCAACCTGGAGTCACAGGGAAGAAATGTGACCGCTGTGCCCACGGCTATTTCAACTTCCAAGAAGGAGGCT
GCACAGCTTGTGAATGTTCTCATCTGGGTAATAATTGTGACCCAAAGACTGGGCGATGCATTTGCCCTCCCAATACCATTGGAGAGAAAT
GTTCTAAATGTGCACCCAATACCTGGGGCCACAGCATTACCACTGGTTGTAAGGCTTGTAACTGCAGCACAGTGGGATCCTTGGATTTCC
AATGCAATGTAAATACAGGCCAATGCAACTGTCATCCAAAATTCTCTGGTGCAAAATGTACAGAGTGCAGTCGAGGTCACTGGAACTACC
CTCGCTGCAATCTCTGTGACTGCTTCCTCCCTGGGACAGATGCCACAACCTGTGATTCAGAGACTAAAAAATGCTCCTGTAGTGATCAAA
CTGGGCAGTGCACTTGTAAGGTGAATGTGGAAGGCATCCACTGTGACAGATGCCGGCCTGGCAAATTCGGACTCGATGCCAAGAATCCAC
TTGGCTGCAGCAGCTGCTATTGCTTCGGCACTACTACCCAGTGCTCTGAAGCAAAAGGACTGATCCGGACGTGGGTGACTCTGAAGGCTG
AGCAGACCATTCTACCCCTGGTAGATGAGGCTCTGCAGCACACGACCACCAAGGGCATTGTTTTTCAACATCCAGAGATTGTTGCCCACA
TGGACCTGATGAGAGAAGATCTCCATTTGGAACCTTTTTATTGGAAACTTCCAGAACAATTTGAAGGAAAGAAGTTGATGGCCTATGGGG
GCAAACTCAAGTATGCAATCTATTTCGAGGCTCGGGAAGAAACAGGTTTCTCTACATATAATCCTCAAGTGATCATTCGAGGTGGGACAC
CTACTCATGCTAGAATTATCGTCAGGCATATGGCTGCTCCTCTGATTGGCCAATTGACAAGGCATGAAATTGAAATGACAGAGAAAGAAT
GGAAATATTATGGGGATGATCCTCGAGTCCATAGAACTGTGACCCGAGAAGACTTCTTGGATATACTATATGATATTCATTACATTCTTA
TCAAAGCTACTTATGGAAATTTCATGCGACAAAGCAGGATTTCTGAAATCTCAATGGAGGTAGCTGAACAAGGACGTGGAACAACAATGA
CTCCTCCAGCTGACTTGATTGAAAAATGTGATTGTCCCCTGGGCTATTCTGGCCTGTCCTGTGAGGCATGCTTGCCGGGATTTTATCGAC
TGCGTTCTCAACCAGGTGGCCGCACCCCTGGACCAACCCTGGGCACCTGTGTTCCATGTCAATGTAATGGACACAGCAGCCTGTGTGACC
CTGAAACATCGATATGCCAGAATTGTCAACATCACACTGCTGGTGACTTCTGTGAACGATGTGCTCTTGGATACTATGGAATTGTCAAGG
GATTGCCAAATGACTGTCAGCAATGTGCCTGCCCTCTGATTTCTTCCAGTAACAATTTCAGCCCCTCTTGTGTCGCAGAAGGACTTGACG
ACTACCGCTGCACGGCTTGTCCACGGGGATATGAAGGCCAGTACTGTGAAAGGTGTGCCCCTGGCTATACTGGCAGTCCAGGCAACCCTG
GAGGCTCCTGCCAAGAATGTGAGTGTGATCCCTATGGCTCACTGCCTGTGCCCTGTGACCCTGTCACAGGATTCTGCACGTGCCGACCTG
GAGCCACGGGAAGGAAGTGTGACGGCTGCAAGCACTGGCATGCACGCGAGGGCTGGGAGTGTGTTTTTTGTGGAGATGAGTGCACTGGCC
TTCTTCTCGGTGACTTGGCTCGCCTGGAGCAGATGGTCATGAGCATCAACCTCACTGGTCCGCTGCCTGCGCCATATAAAATGCTGTATG
GTCTTGAAAATATGACTCAGGAGCTAAAGCACTTGCTGTCACCTCAGCGGGCCCCAGAGAGGCTTATTCAGCTGGCAGAGGGCAATCTGA
ATACACTCGTGACCGAAATGAACGAGCTGCTGACCAGGGCTACCAAAGTGACAGCAGATGGCGAGCAGACCGGACAGGATGCTGAGAGGA
CCAACACAAGAGCAAAGTCCCTGGGAGAATTCATTAAGGAGCTTGCCCGGGATGCAGAAGCTGTAAATGAAAAAGCTATAAAACTAAATG
AAACTCTAGGAACTCGAGACGAGGCCTTTGAGAGAAATTTGGAAGGGCTTCAGAAAGAGATTGACCAGATGATTAAAGAACTGAGGAGGA
AAAATCTAGAGACACAAAAGGAAATTGCTGAAGATGAGTTGGTAGCTGCAGAAGCCCTTCTGAAAAAAGTGAAGAAGCTGTTTGGAGAGT
CCCGGGGGGAAAATGAAGAAATGGAGAAGGATCTCCGGGAAAAACTGGCTGACTACAAAAACAAAGTTGATGATGCTTGGGACCTTTTGA
GAGAAGCCACAGATAAAATCAGAGAAGCTAATCGCCTATTTGCAGTAAATCAGAAAAACATGACTGCATTGGAGAAAAAGAAGGAGGCTG
TTGAAAGCGGCAAACGACAAATTGAGAACACTTTAAAAGAGGGCAATGACATACTCGATGAAGCCAACCGTCTTGCAGATGAAATCAACT
CCATCATAGACTATGTTGAAGACATCCAAACTAAATTGCCACCTATGTCTGAGGAGCTTAATGATAAAATAGATGACCTCTCCCAAGAAA
TAAAGGACAGGAAGCTTGCTGAGAAGGTGTCCCAGGCTGAGAGCCACGCAGCTCAGTTGAATGACTCATCTGCTGTCCTTGATGGAATCC
TTGATGAGGCTAAAAACATCTCCTTCAATGCCACTGCAGCCTTCAAAGCTTACAGCAATATTAAGGACTATATTGATGAAGCTGAGAAAG
TTGCCAAAGAAGCCAAAGATCTTGCACATGAAGCTACAAAACTGGCAACAGGTCCTCGGGGTTTATTAAAGGAAGATGCCAAAGGCTGTC
TTCAGAAAAGCTTCAGGATTCTTAACGAAGCCAAGAAGTTAGCAAATGATGTAAAAGAAAATGAAGACCATCTAAATGGCTTAAAAACCA
GGATAGAAAATGCTGATGCTAGAAATGGGGATCTCTTGAGAACTTTGAATGACACTTTGGGAAAGTTATCAGCTATTCCAAATGATACAG
CTGCTAAACTGCAAGCTGTTAAGGACAAAGCCAGACAAGCCAACGACACAGCTAAAGATGTACTGGCACAGATTACAGAGCTCCACCAGA
ACCTCGATGGCCTGAAGAAGAATTACAATAAACTAGCAGACAGCGTCGCCAAAACGAATGCTGTGGTTAAAGATCCTTCCAAGAACAAAA
TCATTGCCGATGCAGATGCCACTGTCAAAAATTTAGAACAGGAAGCTGACCGGCTAATAGATAAACTCAAACCCATCAAGGAACTTGAGG
ATAACCTAAAGAAAAACATCTCTGAGATAAAGGAATTGATAAACCAAGCTCGGAAACAAGCCAATTCTATCAAAGTATCTGTGTCTTCAG
GAGGTGACTGCATTCGAACATACAAACCAGAAATCAAGAAAGGAAGTTACAATAATATTGTTGTCAACGTAAAGACAGCTGTTGCTGATA
ACCTCCTCTTTTATCTTGGAAGTGCCAAATTTATTGACTTTCTGGCTATAGAAATGCGTAAAGGCAAAGTCAGCTTCCTCTGGGATGTTG
GATCTGGAGTTGGACGTGTAGAGTACCCAGATTTGACTATTGATGACTCATATTGGTACCGTATCGTAGCATCAAGAACTGGGAGAAATG
GAACTATTTCTGTGAGAGCCCTGGATGGACCCAAAGCCAGCATTGTGCCCAGCACACACCATTCGACGTCTCCTCCAGGGTACACGATTC
TAGATGTGGATGCAAATGCAATGCTGTTTGTTGGTGGCCTGACTGGGAAATTAAAGAAGGCTGATGCTGTACGTGTGATTACATTCACTG
GCTGCATGGGAGAAACATACTTTGACAACAAACCTATAGGTTTGTGGAATTTCCGAGAAAAAGAAGGTGACTGCAAAGGATGCACTGTCA
GTCCTCAGGTGGAAGATAGTGAGGGGACTATTCAATTTGATGGAGAAGGTTATGCATTGGTCAGCCGTCCCATTCGCTGGTACCCCAACA
TCTCCACTGTCATGTTCAAGTTCAGAACATTTTCTTCGAGTGCTCTTCTGATGTATCTTGCCACACGAGACCTGAGAGATTTCATGAGTG
TGGAGCTCACTGATGGGCACATAAAAGTCAGTTACGATCTGGGCTCAGGAATGGCTTCCGTTGTCAGCAATCAAAACCATAATGATGGGA
AATGGAAATCATTCACTCTGTCAAGAATTCAAAAACAAGCCAATATATCAATTGTAGATATAGATACTAATCAGGAGGAGAATATAGCAA
CTTCGTCTTCTGGAAACAACTTTGGTCTTGACTTGAAAGCAGATGACAAAATATATTTTGGTGGCCTGCCAACGCTGAGAAACTTGAGTA
TGAAAGCAAGGCCAGAAGTAAATCTGAAGAAATATTCCGGCTGCCTCAAAGATATTGAAATTTCAAGAACTCCGTACAATATACTCAGTA
GTCCCGATTATGTTGGTGTTACCAAAGGATGTTCCCTGGAGAATGTTTACACAGTTAGCTTTCCTAAGCCTGGTTTTGTGGAGCTCTCCC
CTGTGCCAATTGATGTAGGAACAGAAATCAACCTGTCATTCAGCACCAAGAATGAGTCCGGCATCATTCTTTTGGGAAGTGGAGGGACAC
CAGCACCACCTAGGAGAAAACGAAGGCAGACTGGACAGGCCTATTATGCAATACTCCTCAACAGGGGCCGTCTGGAAGTGCATCTCTCCA
CAGGGGCACGAACAATGAGGAAAATTGTGATCAGACCAGAGCCGAATCTGTTTCATGATGGAAGAGAACATTCCGTTCATGTAGAGCGAA
CTAGAGGCATCTTTACAGTTCAAGTGGATGAAAACAGAAGATACATGCAAAACCTGACAGTTGAACAGCCTATCGAAGTTAAAAAGCTTT
TCGTTGGGGGTGCTCCACCTGAATTTCAACCTTCCCCACTCAGAAATATTCCTCCTTTTGAAGGCTGCATATGGAATCTTGTTATTAACT
CTGTCCCCATGGACTTTGCAAGGCCTGTGTCCTTCAAAAATGCTGACATTGGTCGCTGTGCCCATCAGAAACTCCGTGAAGATGAAGATG
GAGCAGCTCCAGCTGAAATAGTTATCCAGCCTGAGCCAGTTCCCACCCCAGCCTTTCCTACGCCCACCCCAGTTCTGACACATGGTCCTT
GTGCTGCAGAATCAGAACCAGCTCTTTTGATAGGGAGCAAGCAGTTCGGGCTTTCAAGAAACAGTCACATTGCAATTGCATTTGATGACA
CCAAAGTTAAAAACCGTCTCACAATTGAGTTGGAAGTAAGAACCGAAGCTGAATCCGGCTTGCTTTTTTACATGGCTCGCATCAATCATG
CTGATTTTGCAACAGTTCAGCTGAGAAATGGATTGCCCTACTTCAGCTATGACTTGGGGAGTGGGGACACCCACACCATGATCCCCACCA
AAATCAATGATGGCCAGTGGCACAAGATTAAGATAATGAGAAGTAAGCAAGAAGGAATTCTTTATGTAGATGGGGCTTCCAACAGAACCA
TCAGTCCCAAAAAAGCCGACATCCTGGATGTCGTGGGAATGCTGTATGTTGGTGGGTTACCCATCAACTACACTACCCGAAGAATTGGTC
CAGTGACCTATAGCATTGATGGCTGCGTCAGGAATCTCCACATGGCAGAGGCCCCTGCCGATCTGGAACAACCCACCTCCAGCTTCCATG
TTGGGACATGTTTTGCAAATGCTCAGAGGGGAACATATTTTGACGGAACCGGTTTTGCCAAAGCAGTTGGTGGATTCAAAGTGGGATTGG
ACCTTCTTGTAGAATTTGAATTCCGCACAACTACAACGACTGGAGTTCTTCTGGGGATCAGTAGTCAAAAAATGGATGGAATGGGTATTG
AAATGATTGATGAAAAGTTGATGTTTCATGTGGACAATGGTGCGGGCAGATTCACTGCTGTCTATGATGCTGGGGTTCCAGGGCATTTGT
GTGATGGACAATGGCATAAAGTCACTGCCAACAAGATCAAACACCGCATTGAGCTCACAGTCGATGGGAACCAGGTGGAAGCCCAAAGCC
CAAACCCAGCATCTACATCAGCTGACACAAATGACCCTGTGTTTGTTGGAGGCTTCCCAGATGACCTCAAGCAGTTTGGCCTAACAACCA
GTATTCCGTTCCGAGGTTGCATCAGATCCCTGAAGCTCACCAAAGGCACAGGCAAGCCACTGGAGGTTAATTTTGCCAAGGCCCTGGAAC
TGAGGGGCGTTCAACCTGTATCATGCCCAGCCAACTAATAAAAATAAGTGTAACCCCAGGAAGAGTCTGTCAAAACAAGTATATCAAGTA
AAACAAACAAATATATTTTACCTATATATGTTAATTAAACTAATTTGTGCATGTACATAGAATTCTTTCTGTATTCAGATGGTGCTAATT

>In-frame_FAM135A_ENST00000505769_chr6_71162274_+_LAMA2_ENST00000421865_chr6_129371063_+_10043nt
GCGGGGCCGTGCGGCCGGGGACCTGTTGATCGCAGGTATAGCCGGCTGGCCCGGGCTCCCTCGGGACTGGGGCGACTGCGCATGCTCGCT
GGCCGCGCTGGGCCAGTAGCCGAGCCGCGGTGACGAACCGGCTCCGCGGTTGCGGTGTTTGCGGTTGCTGTGATGGCGATGTGAGGGGGC
CCGGGGCGGGATGGTGCTGACCCGGGTCGGGCCGTCTTCTTGCAGCTGGACAACGAGCTCCTCCGTTCGACAGGCGGGGGAAGAGGCCGA
GCCGGGCGAGAGGGTTGAAGATCAACTGGATTATGTATTTGGTTCTGGAATCTCAAAGCAGTCCACAAACAAATTCTTCCTTATGTTGTC
TGTGTCAGGTGCTGTTATCAGAATAGTCTTCTGGGTATAAATTAAAAATGACTGAAGTTCAAGCAATGGTAGAATTCTCTGTGGAGCTAA
ACAAGTTCTACAATGTGGATTTGTTTCAGAGAGGTTTTTACCAGATTCGTGCTTCTATGAAAATTCCATCAAGAATTCCCCACAGAGTAG
AAGCTAGTTTGTTGCATGCAACAGGTTTATTCCCTGCTGTCCTGAATCTTGCTTCTAATGCTCTTATCACGACCAATGCAACATGTGGAG
AAAAAGGACCTGAAATGTACTGCAAATTGGTAGAACATGTCCCTGGGCAGCCTGTGAGGAACCCGCAGTGTCGAATCTGCAATCAAAACA
GCAGCAATCCAAACCAGAGACACCCGATTACAAATGCTATTGATGGAAAGAACACTTGGTGGCAGAGTCCCAGTATTAAGAATGGAATCG
AATACCATTATGTGACAATTACCCTGGATTTACAGCAGGTGTTCCAGATCGCGTATGTGATTGTGAAGGCAGCTAACTCCCCCCGGCCTG
GAAACTGGATTTTGGAACGCTCTCTTGATGATGTTGAATACAAGCCCTGGCAGTATCATGCTGTGACAGACACGGAGTGCCTAACGCTTT
ACAATATTTATCCCCGCACTGGGCCACCGTCATATGCCAAAGATGATGAGGTCATCTGCACTTCATTTTACTCCAAGATACACCCCTTAG
AAAATGGAGAGATTCACATCTCTTTAATCAATGGGAGACCAAGTGCCGATGATCCTTCTCCAGAACTGCTAGAATTTACCTCCGCTCGCT
ATATTCGCCTGAGATTTCAGAGGATCCGCACACTGAATGCTGACTTGATGATGTTTGCTCACAAAGACCCAAGAGAAATTGACCCCATTG
TCACCAGAAGATATTACTACTCGGTCAAGGATATTTCAGTTGGAGGGATGTGCATCTGCTATGGTCATGCCAGGGCTTGTCCACTTGATC
CAGCGACAAATAAATCTCGCTGTGAGTGTGAGCATAACACATGTGGCGATAGCTGTGATCAGTGCTGTCCAGGATTCCATCAGAAACCCT
GGAGAGCTGGAACTTTTCTAACTAAAACTGAATGTGAAGCATGCAATTGTCATGGAAAAGCTGAAGAATGCTATTATGATGAAAATGTTG
CCAGAAGAAATCTGAGTTTGAATATACGTGGAAAGTACATTGGAGGGGGTGTCTGCATTAATTGTACCCAAAACACTGCTGGTATAAACT
GCGAGACATGTACTGATGGCTTCTTCAGACCCAAAGGGGTATCTCCAAATTATCCAAGGCCATGCCAGCCATGTCATTGCGATCCAATTG
GTTCCTTAAATGAAGTCTGTGTCAAGGATGAGAAACATGCTCGACGAGGTTTGGCACCTGGATCCTGTCATTGCAAAACTGGTTTTGGAG
GTGTGAGCTGTGATCGGTGTGCCAGGGGCTACACTGGCTACCCGGACTGCAAAGCCTGTAACTGCAGTGGGTTAGGGAGCAAAAATGAGG
ATCCTTGTTTTGGCCCCTGTATCTGCAAGGAAAATGTTGAAGGAGGAGACTGTAGTCGTTGCAAATCCGGCTTCTTCAATTTGCAAGAGG
ATAATTGGAAAGGCTGCGATGAGTGTTTCTGTTCAGGGGTTTCAAACAGATGTCAGAGTTCCTACTGGACCTATGGCAAAATACAAGATA
TGAGTGGCTGGTATCTGACTGACCTTCCTGGCCGCATTCGAGTGGCTCCCCAGCAGGACGACTTGGACTCACCTCAGCAGATCAGCATCA
GTAACGCGGAGGCCCGGCAAGCCCTGCCGCACAGCTACTACTGGAGCGCGCCGGCTCCCTATCTGGGAAACAAACTCCCAGCAGTAGGAG
GACAGTTGACATTTACCATATCATATGACCTTGAAGAAGAGGAAGAAGATACAGAACGTGTTCTCCAGCTTATGATTATCTTAGAGGGTA
ATGACTTGAGCATCAGCACAGCCCAAGATGAGGTGTACCTGCACCCATCTGAAGAACATACTAATGTATTGTTACTTAAAGAAGAATCAT
TTACCATACATGGCACACATTTTCCAGTCCGTAGAAAGGAATTTATGACAGTGCTTGCGAATTTGAAGAGAGTCCTCCTACAAATCACAT
ACAGCTTTGGGATGGATGCCATCTTCAGGTTGAGCTCTGTTAACCTTGAATCCGCTGTCTCCTATCCTACTGATGGAAGCATTGCAGCAG
CTGTAGAAGTGTGTCAGTGCCCACCAGGGTATACTGGCTCCTCTTGTGAATCTTGTTGGCCTAGGCACAGGCGAGTTAACGGCACTATTT
TTGGTGGCATCTGTGAGCCATGTCAGTGCTTTGGTCATGCGGAGTCCTGTGATGACGTCACTGGAGAATGCCTGAACTGTAAGGATCACA
CAGGTGGCCCATATTGTGATAAATGTCTTCCTGGTTTCTATGGCGAGCCTACTAAAGGAACCTCTGAAGACTGTCAACCCTGTGCCTGTC
CACTCAATATCCCATCCAATAACTTTAGCCCAACGTGCCATTTAGACCGGAGTCTTGGATTGATCTGTGATGGATGCCCTGTCGGGTACA
CAGGACCACGCTGTGAGAGGTGTGCAGAAGGCTATTTTGGACAACCCTCTGTACCTGGAGGATCATGTCAGCCATGCCAATGCAATGACA
ACCTTGACTTCTCCATCCCTGGCAGCTGTGACAGCTTGTCTGGCTCCTGTCTGATATGTAAACCAGGTACAACAGGCCGGTACTGTGAGC
TCTGTGCTGATGGATATTTTGGAGATGCAGTTGATGCGAAGAACTGTCAGCCCTGTCGCTGTAATGCCGGTGGCTCTTTCTCTGAGGTTT
GCCACAGTCAAACTGGACAGTGTGAGTGCAGAGCCAACGTTCAGGGTCAGAGATGTGACAAATGCAAGGCTGGGACCTTTGGCCTACAAT
CAGCAAGGGGCTGTGTTCCCTGCAACTGCAATTCTTTTGGGTCTAAGTCATTCGACTGTGAAGAGAGTGGACAATGTTGGTGCCAACCTG
GAGTCACAGGGAAGAAATGTGACCGCTGTGCCCACGGCTATTTCAACTTCCAAGAAGGAGGCTGCACAGCTTGTGAATGTTCTCATCTGG
GTAATAATTGTGACCCAAAGACTGGGCGATGCATTTGCCCTCCCAATACCATTGGAGAGAAATGTTCTAAATGTGCACCCAATACCTGGG
GCCACAGCATTACCACTGGTTGTAAGGCTTGTAACTGCAGCACAGTGGGATCCTTGGATTTCCAATGCAATGTAAATACAGGCCAATGCA
ACTGTCATCCAAAATTCTCTGGTGCAAAATGTACAGAGTGCAGTCGAGGTCACTGGAACTACCCTCGCTGCAATCTCTGTGACTGCTTCC
TCCCTGGGACAGATGCCACAACCTGTGATTCAGAGACTAAAAAATGCTCCTGTAGTGATCAAACTGGGCAGTGCACTTGTAAGGTGAATG
TGGAAGGCATCCACTGTGACAGATGCCGGCCTGGCAAATTCGGACTCGATGCCAAGAATCCACTTGGCTGCAGCAGCTGCTATTGCTTCG
GCACTACTACCCAGTGCTCTGAAGCAAAAGGACTGATCCGGACGTGGGTGACTCTGAAGGCTGAGCAGACCATTCTACCCCTGGTAGATG
AGGCTCTGCAGCACACGACCACCAAGGGCATTGTTTTTCAACATCCAGAGATTGTTGCCCACATGGACCTGATGAGAGAAGATCTCCATT
TGGAACCTTTTTATTGGAAACTTCCAGAACAATTTGAAGGAAAGAAGTTGATGGCCTATGGGGGCAAACTCAAGTATGCAATCTATTTCG
AGGCTCGGGAAGAAACAGGTTTCTCTACATATAATCCTCAAGTGATCATTCGAGGTGGGACACCTACTCATGCTAGAATTATCGTCAGGC
ATATGGCTGCTCCTCTGATTGGCCAATTGACAAGGCATGAAATTGAAATGACAGAGAAAGAATGGAAATATTATGGGGATGATCCTCGAG
TCCATAGAACTGTGACCCGAGAAGACTTCTTGGATATACTATATGATATTCATTACATTCTTATCAAAGCTACTTATGGAAATTTCATGC
GACAAAGCAGGATTTCTGAAATCTCAATGGAGGTAGCTGAACAAGGACGTGGAACAACAATGACTCCTCCAGCTGACTTGATTGAAAAAT
GTGATTGTCCCCTGGGCTATTCTGGCCTGTCCTGTGAGGCATGCTTGCCGGGATTTTATCGACTGCGTTCTCAACCAGGTGGCCGCACCC
CTGGACCAACCCTGGGCACCTGTGTTCCATGTCAATGTAATGGACACAGCAGCCTGTGTGACCCTGAAACATCGATATGCCAGAATTGTC
AACATCACACTGCTGGTGACTTCTGTGAACGATGTGCTCTTGGATACTATGGAATTGTCAAGGGATTGCCAAATGACTGTCAGCAATGTG
CCTGCCCTCTGATTTCTTCCAGTAACAATTTCAGCCCCTCTTGTGTCGCAGAAGGACTTGACGACTACCGCTGCACGGCTTGTCCACGGG
GATATGAAGGCCAGTACTGTGAAAGGTGTGCCCCTGGCTATACTGGCAGTCCAGGCAACCCTGGAGGCTCCTGCCAAGAATGTGAGTGTG
ATCCCTATGGCTCACTGCCTGTGCCCTGTGACCCTGTCACAGGATTCTGCACGTGCCGACCTGGAGCCACGGGAAGGAAGTGTGACGGCT
GCAAGCACTGGCATGCACGCGAGGGCTGGGAGTGTGTTTTTTGTGGAGATGAGTGCACTGGCCTTCTTCTCGGTGACTTGGCTCGCCTGG
AGCAGATGGTCATGAGCATCAACCTCACTGGTCCGCTGCCTGCGCCATATAAAATGCTGTATGGTCTTGAAAATATGACTCAGGAGCTAA
AGCACTTGCTGTCACCTCAGCGGGCCCCAGAGAGGCTTATTCAGCTGGCAGAGGGCAATCTGAATACACTCGTGACCGAAATGAACGAGC
TGCTGACCAGGGCTACCAAAGTGACAGCAGATGGCGAGCAGACCGGACAGGATGCTGAGAGGACCAACACAAGAGCAAAGTCCCTGGGAG
AATTCATTAAGGAGCTTGCCCGGGATGCAGAAGCTGTAAATGAAAAAGCTATAAAACTAAATGAAACTCTAGGAACTCGAGACGAGGCCT
TTGAGAGAAATTTGGAAGGGCTTCAGAAAGAGATTGACCAGATGATTAAAGAACTGAGGAGGAAAAATCTAGAGACACAAAAGGAAATTG
CTGAAGATGAGTTGGTAGCTGCAGAAGCCCTTCTGAAAAAAGTGAAGAAGCTGTTTGGAGAGTCCCGGGGGGAAAATGAAGAAATGGAGA
AGGATCTCCGGGAAAAACTGGCTGACTACAAAAACAAAGTTGATGATGCTTGGGACCTTTTGAGAGAAGCCACAGATAAAATCAGAGAAG
CTAATCGCCTATTTGCAGTAAATCAGAAAAACATGACTGCATTGGAGAAAAAGAAGGAGGCTGTTGAAAGCGGCAAACGACAAATTGAGA
ACACTTTAAAAGAGGGCAATGACATACTCGATGAAGCCAACCGTCTTGCAGATGAAATCAACTCCATCATAGACTATGTTGAAGACATCC
AAACTAAATTGCCACCTATGTCTGAGGAGCTTAATGATAAAATAGATGACCTCTCCCAAGAAATAAAGGACAGGAAGCTTGCTGAGAAGG
TGTCCCAGGCTGAGAGCCACGCAGCTCAGTTGAATGACTCATCTGCTGTCCTTGATGGAATCCTTGATGAGGCTAAAAACATCTCCTTCA
ATGCCACTGCAGCCTTCAAAGCTTACAGCAATATTAAGGACTATATTGATGAAGCTGAGAAAGTTGCCAAAGAAGCCAAAGATCTTGCAC
ATGAAGCTACAAAACTGGCAACAGGTCCTCGGGGTTTATTAAAGGAAGATGCCAAAGGCTGTCTTCAGAAAAGCTTCAGGATTCTTAACG
AAGCCAAGAAGTTAGCAAATGATGTAAAAGAAAATGAAGACCATCTAAATGGCTTAAAAACCAGGATAGAAAATGCTGATGCTAGAAATG
GGGATCTCTTGAGAACTTTGAATGACACTTTGGGAAAGTTATCAGCTATTCCAAATGATACAGCTGCTAAACTGCAAGCTGTTAAGGACA
AAGCCAGACAAGCCAACGACACAGCTAAAGATGTACTGGCACAGATTACAGAGCTCCACCAGAACCTCGATGGCCTGAAGAAGAATTACA
ATAAACTAGCAGACAGCGTCGCCAAAACGAATGCTGTGGTTAAAGATCCTTCCAAGAACAAAATCATTGCCGATGCAGATGCCACTGTCA
AAAATTTAGAACAGGAAGCTGACCGGCTAATAGATAAACTCAAACCCATCAAGGAACTTGAGGATAACCTAAAGAAAAACATCTCTGAGA
TAAAGGAATTGATAAACCAAGCTCGGAAACAAGCCAATTCTATCAAAGTATCTGTGTCTTCAGGAGGTGACTGCATTCGAACATACAAAC
CAGAAATCAAGAAAGGAAGTTACAATAATATTGTTGTCAACGTAAAGACAGCTGTTGCTGATAACCTCCTCTTTTATCTTGGAAGTGCCA
AATTTATTGACTTTCTGGCTATAGAAATGCGTAAAGGCAAAGTCAGCTTCCTCTGGGATGTTGGATCTGGAGTTGGACGTGTAGAGTACC
CAGATTTGACTATTGATGACTCATATTGGTACCGTATCGTAGCATCAAGAACTGGGAGAAATGGAACTATTTCTGTGAGAGCCCTGGATG
GACCCAAAGCCAGCATTGTGCCCAGCACACACCATTCGACGTCTCCTCCAGGGTACACGATTCTAGATGTGGATGCAAATGCAATGCTGT
TTGTTGGTGGCCTGACTGGGAAATTAAAGAAGGCTGATGCTGTACGTGTGATTACATTCACTGGCTGCATGGGAGAAACATACTTTGACA
ACAAACCTATAGGTTTGTGGAATTTCCGAGAAAAAGAAGGTGACTGCAAAGGATGCACTGTCAGTCCTCAGGTGGAAGATAGTGAGGGGA
CTATTCAATTTGATGGAGAAGGTTATGCATTGGTCAGCCGTCCCATTCGCTGGTACCCCAACATCTCCACTGTCATGTTCAAGTTCAGAA
CATTTTCTTCGAGTGCTCTTCTGATGTATCTTGCCACACGAGACCTGAGAGATTTCATGAGTGTGGAGCTCACTGATGGGCACATAAAAG
TCAGTTACGATCTGGGCTCAGGAATGGCTTCCGTTGTCAGCAATCAAAACCATAATGATGGGAAATGGAAATCATTCACTCTGTCAAGAA
TTCAAAAACAAGCCAATATATCAATTGTAGATATAGATACTAATCAGGAGGAGAATATAGCAACTTCGTCTTCTGGAAACAACTTTGGTC
TTGACTTGAAAGCAGATGACAAAATATATTTTGGTGGCCTGCCAACGCTGAGAAACTTGAGTATGAAAGCAAGGCCAGAAGTAAATCTGA
AGAAATATTCCGGCTGCCTCAAAGATATTGAAATTTCAAGAACTCCGTACAATATACTCAGTAGTCCCGATTATGTTGGTGTTACCAAAG
GATGTTCCCTGGAGAATGTTTACACAGTTAGCTTTCCTAAGCCTGGTTTTGTGGAGCTCTCCCCTGTGCCAATTGATGTAGGAACAGAAA
TCAACCTGTCATTCAGCACCAAGAATGAGTCCGGCATCATTCTTTTGGGAAGTGGAGGGACACCAGCACCACCTAGGAGAAAACGAAGGC
AGACTGGACAGGCCTATTATGCAATACTCCTCAACAGGGGCCGTCTGGAAGTGCATCTCTCCACAGGGGCACGAACAATGAGGAAAATTG
TGATCAGACCAGAGCCGAATCTGTTTCATGATGGAAGAGAACATTCCGTTCATGTAGAGCGAACTAGAGGCATCTTTACAGTTCAAGTGG
ATGAAAACAGAAGATACATGCAAAACCTGACAGTTGAACAGCCTATCGAAGTTAAAAAGCTTTTCGTTGGGGGTGCTCCACCTGAATTTC
AACCTTCCCCACTCAGAAATATTCCTCCTTTTGAAGGCTGCATATGGAATCTTGTTATTAACTCTGTCCCCATGGACTTTGCAAGGCCTG
TGTCCTTCAAAAATGCTGACATTGGTCGCTGTGCCCATCAGAAACTCCGTGAAGATGAAGATGGAGCAGCTCCAGCTGAAATAGTTATCC
AGCCTGAGCCAGTTCCCACCCCAGCCTTTCCTACGCCCACCCCAGTTCTGACACATGGTCCTTGTGCTGCAGAATCAGAACCAGCTCTTT
TGATAGGGAGCAAGCAGTTCGGGCTTTCAAGAAACAGTCACATTGCAATTGCATTTGATGACACCAAAGTTAAAAACCGTCTCACAATTG
AGTTGGAAGTAAGAACCGAAGCTGAATCCGGCTTGCTTTTTTACATGGCTCGCATCAATCATGCTGATTTTGCAACAGTTCAGCTGAGAA
ATGGATTGCCCTACTTCAGCTATGACTTGGGGAGTGGGGACACCCACACCATGATCCCCACCAAAATCAATGATGGCCAGTGGCACAAGA
TTAAGATAATGAGAAGTAAGCAAGAAGGAATTCTTTATGTAGATGGGGCTTCCAACAGAACCATCAGTCCCAAAAAAGCCGACATCCTGG
ATGTCGTGGGAATGCTGTATGTTGGTGGGTTACCCATCAACTACACTACCCGAAGAATTGGTCCAGTGACCTATAGCATTGATGGCTGCG
TCAGGAATCTCCACATGGCAGAGGCCCCTGCCGATCTGGAACAACCCACCTCCAGCTTCCATGTTGGGACATGTTTTGCAAATGCTCAGA
GGGGAACATATTTTGACGGAACCGGTTTTGCCAAAGCAGTTGGTGGATTCAAAGTGGGATTGGACCTTCTTGTAGAATTTGAATTCCGCA
CAACTACAACGACTGGAGTTCTTCTGGGGATCAGTAGTCAAAAAATGGATGGAATGGGTATTGAAATGATTGATGAAAAGTTGATGTTTC
ATGTGGACAATGGTGCGGGCAGATTCACTGCTGTCTATGATGCTGGGGTTCCAGGGCATTTGTGTGATGGACAATGGCATAAAGTCACTG
CCAACAAGATCAAACACCGCATTGAGCTCACAGTCGATGGGAACCAGGTGGAAGCCCAAAGCCCAAACCCAGCATCTACATCAGCTGACA
CAAATGACCCTGTGTTTGTTGGAGGCTTCCCAGATGACCTCAAGCAGTTTGGCCTAACAACCAGTATTCCGTTCCGAGGTTGCATCAGAT
CCCTGAAGCTCACCAAAGGCACAGGCAAGCCACTGGAGGTTAATTTTGCCAAGGCCCTGGAACTGAGGGGCGTTCAACCTGTATCATGCC
CAGCCAACTAATAAAAATAAGTGTAACCCCAGGAAGAGTCTGTCAAAACAAGTATATCAAGTAAAACAAACAAATATATTTTACCTATAT
ATGTTAATTAAACTAATTTGTGCATGTACATAGAATTCTTTCTGTATTCAGATGGTGCTAATTCAGACTCCAGACTGAATTTTAATTCAA

>In-frame_FAM135A_ENST00000361499_chr6_71162274_+_LAMA2_ENST00000421865_chr6_129371063_+_9980nt
CTGTGATGGCGATGTGAGGGGGCCCGGGGCGGGATGGTGCTGACCCGGGTCGGGCCGTCTTCTTGCAGCTGGACAACGAGCTCCTCCGTT
CGACAGGCGGGGGAAGAGGCCGAGCCGGGCGAGAGGGTTGAAGATCAACTGGATTATGTATTTGGTTCTGGAATCTCAAAGCAGTCCACA
AACAAATTCTTCCTTATGTTGTCTGTGTCAGGGGGAACGGTGTATTTTTAACAACGGGAATCAGTAACTGGAAGTACAAGATTGGTTATT
TAATAATGTTAAAAATGAGGCTTTGAAAAGCAGAGGTGCTGTTATCAGAATAGTCTTCTGGGTATAAATTAAAAATGACTGAAGTTCAAG
CAATGGTAGAATTCTCTGTGGAGCTAAACAAGTTCTACAATGTGGATTTGTTTCAGAGAGGTTTTTACCAGATTCGTGCTTCTATGAAAA
TTCCATCAAGAATTCCCCACAGAGTAGAAGCTAGTTTGTTGCATGCAACAGGTTTATTCCCTGCTGTCCTGAATCTTGCTTCTAATGCTC
TTATCACGACCAATGCAACATGTGGAGAAAAAGGACCTGAAATGTACTGCAAATTGGTAGAACATGTCCCTGGGCAGCCTGTGAGGAACC
CGCAGTGTCGAATCTGCAATCAAAACAGCAGCAATCCAAACCAGAGACACCCGATTACAAATGCTATTGATGGAAAGAACACTTGGTGGC
AGAGTCCCAGTATTAAGAATGGAATCGAATACCATTATGTGACAATTACCCTGGATTTACAGCAGGTGTTCCAGATCGCGTATGTGATTG
TGAAGGCAGCTAACTCCCCCCGGCCTGGAAACTGGATTTTGGAACGCTCTCTTGATGATGTTGAATACAAGCCCTGGCAGTATCATGCTG
TGACAGACACGGAGTGCCTAACGCTTTACAATATTTATCCCCGCACTGGGCCACCGTCATATGCCAAAGATGATGAGGTCATCTGCACTT
CATTTTACTCCAAGATACACCCCTTAGAAAATGGAGAGATTCACATCTCTTTAATCAATGGGAGACCAAGTGCCGATGATCCTTCTCCAG
AACTGCTAGAATTTACCTCCGCTCGCTATATTCGCCTGAGATTTCAGAGGATCCGCACACTGAATGCTGACTTGATGATGTTTGCTCACA
AAGACCCAAGAGAAATTGACCCCATTGTCACCAGAAGATATTACTACTCGGTCAAGGATATTTCAGTTGGAGGGATGTGCATCTGCTATG
GTCATGCCAGGGCTTGTCCACTTGATCCAGCGACAAATAAATCTCGCTGTGAGTGTGAGCATAACACATGTGGCGATAGCTGTGATCAGT
GCTGTCCAGGATTCCATCAGAAACCCTGGAGAGCTGGAACTTTTCTAACTAAAACTGAATGTGAAGCATGCAATTGTCATGGAAAAGCTG
AAGAATGCTATTATGATGAAAATGTTGCCAGAAGAAATCTGAGTTTGAATATACGTGGAAAGTACATTGGAGGGGGTGTCTGCATTAATT
GTACCCAAAACACTGCTGGTATAAACTGCGAGACATGTACTGATGGCTTCTTCAGACCCAAAGGGGTATCTCCAAATTATCCAAGGCCAT
GCCAGCCATGTCATTGCGATCCAATTGGTTCCTTAAATGAAGTCTGTGTCAAGGATGAGAAACATGCTCGACGAGGTTTGGCACCTGGAT
CCTGTCATTGCAAAACTGGTTTTGGAGGTGTGAGCTGTGATCGGTGTGCCAGGGGCTACACTGGCTACCCGGACTGCAAAGCCTGTAACT
GCAGTGGGTTAGGGAGCAAAAATGAGGATCCTTGTTTTGGCCCCTGTATCTGCAAGGAAAATGTTGAAGGAGGAGACTGTAGTCGTTGCA
AATCCGGCTTCTTCAATTTGCAAGAGGATAATTGGAAAGGCTGCGATGAGTGTTTCTGTTCAGGGGTTTCAAACAGATGTCAGAGTTCCT
ACTGGACCTATGGCAAAATACAAGATATGAGTGGCTGGTATCTGACTGACCTTCCTGGCCGCATTCGAGTGGCTCCCCAGCAGGACGACT
TGGACTCACCTCAGCAGATCAGCATCAGTAACGCGGAGGCCCGGCAAGCCCTGCCGCACAGCTACTACTGGAGCGCGCCGGCTCCCTATC
TGGGAAACAAACTCCCAGCAGTAGGAGGACAGTTGACATTTACCATATCATATGACCTTGAAGAAGAGGAAGAAGATACAGAACGTGTTC
TCCAGCTTATGATTATCTTAGAGGGTAATGACTTGAGCATCAGCACAGCCCAAGATGAGGTGTACCTGCACCCATCTGAAGAACATACTA
ATGTATTGTTACTTAAAGAAGAATCATTTACCATACATGGCACACATTTTCCAGTCCGTAGAAAGGAATTTATGACAGTGCTTGCGAATT
TGAAGAGAGTCCTCCTACAAATCACATACAGCTTTGGGATGGATGCCATCTTCAGGTTGAGCTCTGTTAACCTTGAATCCGCTGTCTCCT
ATCCTACTGATGGAAGCATTGCAGCAGCTGTAGAAGTGTGTCAGTGCCCACCAGGGTATACTGGCTCCTCTTGTGAATCTTGTTGGCCTA
GGCACAGGCGAGTTAACGGCACTATTTTTGGTGGCATCTGTGAGCCATGTCAGTGCTTTGGTCATGCGGAGTCCTGTGATGACGTCACTG
GAGAATGCCTGAACTGTAAGGATCACACAGGTGGCCCATATTGTGATAAATGTCTTCCTGGTTTCTATGGCGAGCCTACTAAAGGAACCT
CTGAAGACTGTCAACCCTGTGCCTGTCCACTCAATATCCCATCCAATAACTTTAGCCCAACGTGCCATTTAGACCGGAGTCTTGGATTGA
TCTGTGATGGATGCCCTGTCGGGTACACAGGACCACGCTGTGAGAGGTGTGCAGAAGGCTATTTTGGACAACCCTCTGTACCTGGAGGAT
CATGTCAGCCATGCCAATGCAATGACAACCTTGACTTCTCCATCCCTGGCAGCTGTGACAGCTTGTCTGGCTCCTGTCTGATATGTAAAC
CAGGTACAACAGGCCGGTACTGTGAGCTCTGTGCTGATGGATATTTTGGAGATGCAGTTGATGCGAAGAACTGTCAGCCCTGTCGCTGTA
ATGCCGGTGGCTCTTTCTCTGAGGTTTGCCACAGTCAAACTGGACAGTGTGAGTGCAGAGCCAACGTTCAGGGTCAGAGATGTGACAAAT
GCAAGGCTGGGACCTTTGGCCTACAATCAGCAAGGGGCTGTGTTCCCTGCAACTGCAATTCTTTTGGGTCTAAGTCATTCGACTGTGAAG
AGAGTGGACAATGTTGGTGCCAACCTGGAGTCACAGGGAAGAAATGTGACCGCTGTGCCCACGGCTATTTCAACTTCCAAGAAGGAGGCT
GCACAGCTTGTGAATGTTCTCATCTGGGTAATAATTGTGACCCAAAGACTGGGCGATGCATTTGCCCTCCCAATACCATTGGAGAGAAAT
GTTCTAAATGTGCACCCAATACCTGGGGCCACAGCATTACCACTGGTTGTAAGGCTTGTAACTGCAGCACAGTGGGATCCTTGGATTTCC
AATGCAATGTAAATACAGGCCAATGCAACTGTCATCCAAAATTCTCTGGTGCAAAATGTACAGAGTGCAGTCGAGGTCACTGGAACTACC
CTCGCTGCAATCTCTGTGACTGCTTCCTCCCTGGGACAGATGCCACAACCTGTGATTCAGAGACTAAAAAATGCTCCTGTAGTGATCAAA
CTGGGCAGTGCACTTGTAAGGTGAATGTGGAAGGCATCCACTGTGACAGATGCCGGCCTGGCAAATTCGGACTCGATGCCAAGAATCCAC
TTGGCTGCAGCAGCTGCTATTGCTTCGGCACTACTACCCAGTGCTCTGAAGCAAAAGGACTGATCCGGACGTGGGTGACTCTGAAGGCTG
AGCAGACCATTCTACCCCTGGTAGATGAGGCTCTGCAGCACACGACCACCAAGGGCATTGTTTTTCAACATCCAGAGATTGTTGCCCACA
TGGACCTGATGAGAGAAGATCTCCATTTGGAACCTTTTTATTGGAAACTTCCAGAACAATTTGAAGGAAAGAAGTTGATGGCCTATGGGG
GCAAACTCAAGTATGCAATCTATTTCGAGGCTCGGGAAGAAACAGGTTTCTCTACATATAATCCTCAAGTGATCATTCGAGGTGGGACAC
CTACTCATGCTAGAATTATCGTCAGGCATATGGCTGCTCCTCTGATTGGCCAATTGACAAGGCATGAAATTGAAATGACAGAGAAAGAAT
GGAAATATTATGGGGATGATCCTCGAGTCCATAGAACTGTGACCCGAGAAGACTTCTTGGATATACTATATGATATTCATTACATTCTTA
TCAAAGCTACTTATGGAAATTTCATGCGACAAAGCAGGATTTCTGAAATCTCAATGGAGGTAGCTGAACAAGGACGTGGAACAACAATGA
CTCCTCCAGCTGACTTGATTGAAAAATGTGATTGTCCCCTGGGCTATTCTGGCCTGTCCTGTGAGGCATGCTTGCCGGGATTTTATCGAC
TGCGTTCTCAACCAGGTGGCCGCACCCCTGGACCAACCCTGGGCACCTGTGTTCCATGTCAATGTAATGGACACAGCAGCCTGTGTGACC
CTGAAACATCGATATGCCAGAATTGTCAACATCACACTGCTGGTGACTTCTGTGAACGATGTGCTCTTGGATACTATGGAATTGTCAAGG
GATTGCCAAATGACTGTCAGCAATGTGCCTGCCCTCTGATTTCTTCCAGTAACAATTTCAGCCCCTCTTGTGTCGCAGAAGGACTTGACG
ACTACCGCTGCACGGCTTGTCCACGGGGATATGAAGGCCAGTACTGTGAAAGGTGTGCCCCTGGCTATACTGGCAGTCCAGGCAACCCTG
GAGGCTCCTGCCAAGAATGTGAGTGTGATCCCTATGGCTCACTGCCTGTGCCCTGTGACCCTGTCACAGGATTCTGCACGTGCCGACCTG
GAGCCACGGGAAGGAAGTGTGACGGCTGCAAGCACTGGCATGCACGCGAGGGCTGGGAGTGTGTTTTTTGTGGAGATGAGTGCACTGGCC
TTCTTCTCGGTGACTTGGCTCGCCTGGAGCAGATGGTCATGAGCATCAACCTCACTGGTCCGCTGCCTGCGCCATATAAAATGCTGTATG
GTCTTGAAAATATGACTCAGGAGCTAAAGCACTTGCTGTCACCTCAGCGGGCCCCAGAGAGGCTTATTCAGCTGGCAGAGGGCAATCTGA
ATACACTCGTGACCGAAATGAACGAGCTGCTGACCAGGGCTACCAAAGTGACAGCAGATGGCGAGCAGACCGGACAGGATGCTGAGAGGA
CCAACACAAGAGCAAAGTCCCTGGGAGAATTCATTAAGGAGCTTGCCCGGGATGCAGAAGCTGTAAATGAAAAAGCTATAAAACTAAATG
AAACTCTAGGAACTCGAGACGAGGCCTTTGAGAGAAATTTGGAAGGGCTTCAGAAAGAGATTGACCAGATGATTAAAGAACTGAGGAGGA
AAAATCTAGAGACACAAAAGGAAATTGCTGAAGATGAGTTGGTAGCTGCAGAAGCCCTTCTGAAAAAAGTGAAGAAGCTGTTTGGAGAGT
CCCGGGGGGAAAATGAAGAAATGGAGAAGGATCTCCGGGAAAAACTGGCTGACTACAAAAACAAAGTTGATGATGCTTGGGACCTTTTGA
GAGAAGCCACAGATAAAATCAGAGAAGCTAATCGCCTATTTGCAGTAAATCAGAAAAACATGACTGCATTGGAGAAAAAGAAGGAGGCTG
TTGAAAGCGGCAAACGACAAATTGAGAACACTTTAAAAGAGGGCAATGACATACTCGATGAAGCCAACCGTCTTGCAGATGAAATCAACT
CCATCATAGACTATGTTGAAGACATCCAAACTAAATTGCCACCTATGTCTGAGGAGCTTAATGATAAAATAGATGACCTCTCCCAAGAAA
TAAAGGACAGGAAGCTTGCTGAGAAGGTGTCCCAGGCTGAGAGCCACGCAGCTCAGTTGAATGACTCATCTGCTGTCCTTGATGGAATCC
TTGATGAGGCTAAAAACATCTCCTTCAATGCCACTGCAGCCTTCAAAGCTTACAGCAATATTAAGGACTATATTGATGAAGCTGAGAAAG
TTGCCAAAGAAGCCAAAGATCTTGCACATGAAGCTACAAAACTGGCAACAGGTCCTCGGGGTTTATTAAAGGAAGATGCCAAAGGCTGTC
TTCAGAAAAGCTTCAGGATTCTTAACGAAGCCAAGAAGTTAGCAAATGATGTAAAAGAAAATGAAGACCATCTAAATGGCTTAAAAACCA
GGATAGAAAATGCTGATGCTAGAAATGGGGATCTCTTGAGAACTTTGAATGACACTTTGGGAAAGTTATCAGCTATTCCAAATGATACAG
CTGCTAAACTGCAAGCTGTTAAGGACAAAGCCAGACAAGCCAACGACACAGCTAAAGATGTACTGGCACAGATTACAGAGCTCCACCAGA
ACCTCGATGGCCTGAAGAAGAATTACAATAAACTAGCAGACAGCGTCGCCAAAACGAATGCTGTGGTTAAAGATCCTTCCAAGAACAAAA
TCATTGCCGATGCAGATGCCACTGTCAAAAATTTAGAACAGGAAGCTGACCGGCTAATAGATAAACTCAAACCCATCAAGGAACTTGAGG
ATAACCTAAAGAAAAACATCTCTGAGATAAAGGAATTGATAAACCAAGCTCGGAAACAAGCCAATTCTATCAAAGTATCTGTGTCTTCAG
GAGGTGACTGCATTCGAACATACAAACCAGAAATCAAGAAAGGAAGTTACAATAATATTGTTGTCAACGTAAAGACAGCTGTTGCTGATA
ACCTCCTCTTTTATCTTGGAAGTGCCAAATTTATTGACTTTCTGGCTATAGAAATGCGTAAAGGCAAAGTCAGCTTCCTCTGGGATGTTG
GATCTGGAGTTGGACGTGTAGAGTACCCAGATTTGACTATTGATGACTCATATTGGTACCGTATCGTAGCATCAAGAACTGGGAGAAATG
GAACTATTTCTGTGAGAGCCCTGGATGGACCCAAAGCCAGCATTGTGCCCAGCACACACCATTCGACGTCTCCTCCAGGGTACACGATTC
TAGATGTGGATGCAAATGCAATGCTGTTTGTTGGTGGCCTGACTGGGAAATTAAAGAAGGCTGATGCTGTACGTGTGATTACATTCACTG
GCTGCATGGGAGAAACATACTTTGACAACAAACCTATAGGTTTGTGGAATTTCCGAGAAAAAGAAGGTGACTGCAAAGGATGCACTGTCA
GTCCTCAGGTGGAAGATAGTGAGGGGACTATTCAATTTGATGGAGAAGGTTATGCATTGGTCAGCCGTCCCATTCGCTGGTACCCCAACA
TCTCCACTGTCATGTTCAAGTTCAGAACATTTTCTTCGAGTGCTCTTCTGATGTATCTTGCCACACGAGACCTGAGAGATTTCATGAGTG
TGGAGCTCACTGATGGGCACATAAAAGTCAGTTACGATCTGGGCTCAGGAATGGCTTCCGTTGTCAGCAATCAAAACCATAATGATGGGA
AATGGAAATCATTCACTCTGTCAAGAATTCAAAAACAAGCCAATATATCAATTGTAGATATAGATACTAATCAGGAGGAGAATATAGCAA
CTTCGTCTTCTGGAAACAACTTTGGTCTTGACTTGAAAGCAGATGACAAAATATATTTTGGTGGCCTGCCAACGCTGAGAAACTTGAGTA
TGAAAGCAAGGCCAGAAGTAAATCTGAAGAAATATTCCGGCTGCCTCAAAGATATTGAAATTTCAAGAACTCCGTACAATATACTCAGTA
GTCCCGATTATGTTGGTGTTACCAAAGGATGTTCCCTGGAGAATGTTTACACAGTTAGCTTTCCTAAGCCTGGTTTTGTGGAGCTCTCCC
CTGTGCCAATTGATGTAGGAACAGAAATCAACCTGTCATTCAGCACCAAGAATGAGTCCGGCATCATTCTTTTGGGAAGTGGAGGGACAC
CAGCACCACCTAGGAGAAAACGAAGGCAGACTGGACAGGCCTATTATGCAATACTCCTCAACAGGGGCCGTCTGGAAGTGCATCTCTCCA
CAGGGGCACGAACAATGAGGAAAATTGTGATCAGACCAGAGCCGAATCTGTTTCATGATGGAAGAGAACATTCCGTTCATGTAGAGCGAA
CTAGAGGCATCTTTACAGTTCAAGTGGATGAAAACAGAAGATACATGCAAAACCTGACAGTTGAACAGCCTATCGAAGTTAAAAAGCTTT
TCGTTGGGGGTGCTCCACCTGAATTTCAACCTTCCCCACTCAGAAATATTCCTCCTTTTGAAGGCTGCATATGGAATCTTGTTATTAACT
CTGTCCCCATGGACTTTGCAAGGCCTGTGTCCTTCAAAAATGCTGACATTGGTCGCTGTGCCCATCAGAAACTCCGTGAAGATGAAGATG
GAGCAGCTCCAGCTGAAATAGTTATCCAGCCTGAGCCAGTTCCCACCCCAGCCTTTCCTACGCCCACCCCAGTTCTGACACATGGTCCTT
GTGCTGCAGAATCAGAACCAGCTCTTTTGATAGGGAGCAAGCAGTTCGGGCTTTCAAGAAACAGTCACATTGCAATTGCATTTGATGACA
CCAAAGTTAAAAACCGTCTCACAATTGAGTTGGAAGTAAGAACCGAAGCTGAATCCGGCTTGCTTTTTTACATGGCTCGCATCAATCATG
CTGATTTTGCAACAGTTCAGCTGAGAAATGGATTGCCCTACTTCAGCTATGACTTGGGGAGTGGGGACACCCACACCATGATCCCCACCA
AAATCAATGATGGCCAGTGGCACAAGATTAAGATAATGAGAAGTAAGCAAGAAGGAATTCTTTATGTAGATGGGGCTTCCAACAGAACCA
TCAGTCCCAAAAAAGCCGACATCCTGGATGTCGTGGGAATGCTGTATGTTGGTGGGTTACCCATCAACTACACTACCCGAAGAATTGGTC
CAGTGACCTATAGCATTGATGGCTGCGTCAGGAATCTCCACATGGCAGAGGCCCCTGCCGATCTGGAACAACCCACCTCCAGCTTCCATG
TTGGGACATGTTTTGCAAATGCTCAGAGGGGAACATATTTTGACGGAACCGGTTTTGCCAAAGCAGTTGGTGGATTCAAAGTGGGATTGG
ACCTTCTTGTAGAATTTGAATTCCGCACAACTACAACGACTGGAGTTCTTCTGGGGATCAGTAGTCAAAAAATGGATGGAATGGGTATTG
AAATGATTGATGAAAAGTTGATGTTTCATGTGGACAATGGTGCGGGCAGATTCACTGCTGTCTATGATGCTGGGGTTCCAGGGCATTTGT
GTGATGGACAATGGCATAAAGTCACTGCCAACAAGATCAAACACCGCATTGAGCTCACAGTCGATGGGAACCAGGTGGAAGCCCAAAGCC
CAAACCCAGCATCTACATCAGCTGACACAAATGACCCTGTGTTTGTTGGAGGCTTCCCAGATGACCTCAAGCAGTTTGGCCTAACAACCA
GTATTCCGTTCCGAGGTTGCATCAGATCCCTGAAGCTCACCAAAGGCACAGGCAAGCCACTGGAGGTTAATTTTGCCAAGGCCCTGGAAC
TGAGGGGCGTTCAACCTGTATCATGCCCAGCCAACTAATAAAAATAAGTGTAACCCCAGGAAGAGTCTGTCAAAACAAGTATATCAAGTA
AAACAAACAAATATATTTTACCTATATATGTTAATTAAACTAATTTGTGCATGTACATAGAATTCTTTCTGTATTCAGATGGTGCTAATT

>In-frame_FAM135A_ENST00000505868_chr6_71162274_+_LAMA2_ENST00000421865_chr6_129371063_+_9636nt
ATGACTGAAGTTCAAGCAATGGTAGAATTCTCTGTGGAGCTAAACAAGTTCTACAATGTGGATTTGTTTCAGAGAGGTTTTTACCAGATT
CGTGCTTCTATGAAAATTCCATCAAGAATTCCCCACAGAGTAGAAGCTAGTTTGTTGCATGCAACAGGTTTATTCCCTGCTGTCCTGAAT
CTTGCTTCTAATGCTCTTATCACGACCAATGCAACATGTGGAGAAAAAGGACCTGAAATGTACTGCAAATTGGTAGAACATGTCCCTGGG
CAGCCTGTGAGGAACCCGCAGTGTCGAATCTGCAATCAAAACAGCAGCAATCCAAACCAGAGACACCCGATTACAAATGCTATTGATGGA
AAGAACACTTGGTGGCAGAGTCCCAGTATTAAGAATGGAATCGAATACCATTATGTGACAATTACCCTGGATTTACAGCAGGTGTTCCAG
ATCGCGTATGTGATTGTGAAGGCAGCTAACTCCCCCCGGCCTGGAAACTGGATTTTGGAACGCTCTCTTGATGATGTTGAATACAAGCCC
TGGCAGTATCATGCTGTGACAGACACGGAGTGCCTAACGCTTTACAATATTTATCCCCGCACTGGGCCACCGTCATATGCCAAAGATGAT
GAGGTCATCTGCACTTCATTTTACTCCAAGATACACCCCTTAGAAAATGGAGAGATTCACATCTCTTTAATCAATGGGAGACCAAGTGCC
GATGATCCTTCTCCAGAACTGCTAGAATTTACCTCCGCTCGCTATATTCGCCTGAGATTTCAGAGGATCCGCACACTGAATGCTGACTTG
ATGATGTTTGCTCACAAAGACCCAAGAGAAATTGACCCCATTGTCACCAGAAGATATTACTACTCGGTCAAGGATATTTCAGTTGGAGGG
ATGTGCATCTGCTATGGTCATGCCAGGGCTTGTCCACTTGATCCAGCGACAAATAAATCTCGCTGTGAGTGTGAGCATAACACATGTGGC
GATAGCTGTGATCAGTGCTGTCCAGGATTCCATCAGAAACCCTGGAGAGCTGGAACTTTTCTAACTAAAACTGAATGTGAAGCATGCAAT
TGTCATGGAAAAGCTGAAGAATGCTATTATGATGAAAATGTTGCCAGAAGAAATCTGAGTTTGAATATACGTGGAAAGTACATTGGAGGG
GGTGTCTGCATTAATTGTACCCAAAACACTGCTGGTATAAACTGCGAGACATGTACTGATGGCTTCTTCAGACCCAAAGGGGTATCTCCA
AATTATCCAAGGCCATGCCAGCCATGTCATTGCGATCCAATTGGTTCCTTAAATGAAGTCTGTGTCAAGGATGAGAAACATGCTCGACGA
GGTTTGGCACCTGGATCCTGTCATTGCAAAACTGGTTTTGGAGGTGTGAGCTGTGATCGGTGTGCCAGGGGCTACACTGGCTACCCGGAC
TGCAAAGCCTGTAACTGCAGTGGGTTAGGGAGCAAAAATGAGGATCCTTGTTTTGGCCCCTGTATCTGCAAGGAAAATGTTGAAGGAGGA
GACTGTAGTCGTTGCAAATCCGGCTTCTTCAATTTGCAAGAGGATAATTGGAAAGGCTGCGATGAGTGTTTCTGTTCAGGGGTTTCAAAC
AGATGTCAGAGTTCCTACTGGACCTATGGCAAAATACAAGATATGAGTGGCTGGTATCTGACTGACCTTCCTGGCCGCATTCGAGTGGCT
CCCCAGCAGGACGACTTGGACTCACCTCAGCAGATCAGCATCAGTAACGCGGAGGCCCGGCAAGCCCTGCCGCACAGCTACTACTGGAGC
GCGCCGGCTCCCTATCTGGGAAACAAACTCCCAGCAGTAGGAGGACAGTTGACATTTACCATATCATATGACCTTGAAGAAGAGGAAGAA
GATACAGAACGTGTTCTCCAGCTTATGATTATCTTAGAGGGTAATGACTTGAGCATCAGCACAGCCCAAGATGAGGTGTACCTGCACCCA
TCTGAAGAACATACTAATGTATTGTTACTTAAAGAAGAATCATTTACCATACATGGCACACATTTTCCAGTCCGTAGAAAGGAATTTATG
ACAGTGCTTGCGAATTTGAAGAGAGTCCTCCTACAAATCACATACAGCTTTGGGATGGATGCCATCTTCAGGTTGAGCTCTGTTAACCTT
GAATCCGCTGTCTCCTATCCTACTGATGGAAGCATTGCAGCAGCTGTAGAAGTGTGTCAGTGCCCACCAGGGTATACTGGCTCCTCTTGT
GAATCTTGTTGGCCTAGGCACAGGCGAGTTAACGGCACTATTTTTGGTGGCATCTGTGAGCCATGTCAGTGCTTTGGTCATGCGGAGTCC
TGTGATGACGTCACTGGAGAATGCCTGAACTGTAAGGATCACACAGGTGGCCCATATTGTGATAAATGTCTTCCTGGTTTCTATGGCGAG
CCTACTAAAGGAACCTCTGAAGACTGTCAACCCTGTGCCTGTCCACTCAATATCCCATCCAATAACTTTAGCCCAACGTGCCATTTAGAC
CGGAGTCTTGGATTGATCTGTGATGGATGCCCTGTCGGGTACACAGGACCACGCTGTGAGAGGTGTGCAGAAGGCTATTTTGGACAACCC
TCTGTACCTGGAGGATCATGTCAGCCATGCCAATGCAATGACAACCTTGACTTCTCCATCCCTGGCAGCTGTGACAGCTTGTCTGGCTCC
TGTCTGATATGTAAACCAGGTACAACAGGCCGGTACTGTGAGCTCTGTGCTGATGGATATTTTGGAGATGCAGTTGATGCGAAGAACTGT
CAGCCCTGTCGCTGTAATGCCGGTGGCTCTTTCTCTGAGGTTTGCCACAGTCAAACTGGACAGTGTGAGTGCAGAGCCAACGTTCAGGGT
CAGAGATGTGACAAATGCAAGGCTGGGACCTTTGGCCTACAATCAGCAAGGGGCTGTGTTCCCTGCAACTGCAATTCTTTTGGGTCTAAG
TCATTCGACTGTGAAGAGAGTGGACAATGTTGGTGCCAACCTGGAGTCACAGGGAAGAAATGTGACCGCTGTGCCCACGGCTATTTCAAC
TTCCAAGAAGGAGGCTGCACAGCTTGTGAATGTTCTCATCTGGGTAATAATTGTGACCCAAAGACTGGGCGATGCATTTGCCCTCCCAAT
ACCATTGGAGAGAAATGTTCTAAATGTGCACCCAATACCTGGGGCCACAGCATTACCACTGGTTGTAAGGCTTGTAACTGCAGCACAGTG
GGATCCTTGGATTTCCAATGCAATGTAAATACAGGCCAATGCAACTGTCATCCAAAATTCTCTGGTGCAAAATGTACAGAGTGCAGTCGA
GGTCACTGGAACTACCCTCGCTGCAATCTCTGTGACTGCTTCCTCCCTGGGACAGATGCCACAACCTGTGATTCAGAGACTAAAAAATGC
TCCTGTAGTGATCAAACTGGGCAGTGCACTTGTAAGGTGAATGTGGAAGGCATCCACTGTGACAGATGCCGGCCTGGCAAATTCGGACTC
GATGCCAAGAATCCACTTGGCTGCAGCAGCTGCTATTGCTTCGGCACTACTACCCAGTGCTCTGAAGCAAAAGGACTGATCCGGACGTGG
GTGACTCTGAAGGCTGAGCAGACCATTCTACCCCTGGTAGATGAGGCTCTGCAGCACACGACCACCAAGGGCATTGTTTTTCAACATCCA
GAGATTGTTGCCCACATGGACCTGATGAGAGAAGATCTCCATTTGGAACCTTTTTATTGGAAACTTCCAGAACAATTTGAAGGAAAGAAG
TTGATGGCCTATGGGGGCAAACTCAAGTATGCAATCTATTTCGAGGCTCGGGAAGAAACAGGTTTCTCTACATATAATCCTCAAGTGATC
ATTCGAGGTGGGACACCTACTCATGCTAGAATTATCGTCAGGCATATGGCTGCTCCTCTGATTGGCCAATTGACAAGGCATGAAATTGAA
ATGACAGAGAAAGAATGGAAATATTATGGGGATGATCCTCGAGTCCATAGAACTGTGACCCGAGAAGACTTCTTGGATATACTATATGAT
ATTCATTACATTCTTATCAAAGCTACTTATGGAAATTTCATGCGACAAAGCAGGATTTCTGAAATCTCAATGGAGGTAGCTGAACAAGGA
CGTGGAACAACAATGACTCCTCCAGCTGACTTGATTGAAAAATGTGATTGTCCCCTGGGCTATTCTGGCCTGTCCTGTGAGGCATGCTTG
CCGGGATTTTATCGACTGCGTTCTCAACCAGGTGGCCGCACCCCTGGACCAACCCTGGGCACCTGTGTTCCATGTCAATGTAATGGACAC
AGCAGCCTGTGTGACCCTGAAACATCGATATGCCAGAATTGTCAACATCACACTGCTGGTGACTTCTGTGAACGATGTGCTCTTGGATAC
TATGGAATTGTCAAGGGATTGCCAAATGACTGTCAGCAATGTGCCTGCCCTCTGATTTCTTCCAGTAACAATTTCAGCCCCTCTTGTGTC
GCAGAAGGACTTGACGACTACCGCTGCACGGCTTGTCCACGGGGATATGAAGGCCAGTACTGTGAAAGGTGTGCCCCTGGCTATACTGGC
AGTCCAGGCAACCCTGGAGGCTCCTGCCAAGAATGTGAGTGTGATCCCTATGGCTCACTGCCTGTGCCCTGTGACCCTGTCACAGGATTC
TGCACGTGCCGACCTGGAGCCACGGGAAGGAAGTGTGACGGCTGCAAGCACTGGCATGCACGCGAGGGCTGGGAGTGTGTTTTTTGTGGA
GATGAGTGCACTGGCCTTCTTCTCGGTGACTTGGCTCGCCTGGAGCAGATGGTCATGAGCATCAACCTCACTGGTCCGCTGCCTGCGCCA
TATAAAATGCTGTATGGTCTTGAAAATATGACTCAGGAGCTAAAGCACTTGCTGTCACCTCAGCGGGCCCCAGAGAGGCTTATTCAGCTG
GCAGAGGGCAATCTGAATACACTCGTGACCGAAATGAACGAGCTGCTGACCAGGGCTACCAAAGTGACAGCAGATGGCGAGCAGACCGGA
CAGGATGCTGAGAGGACCAACACAAGAGCAAAGTCCCTGGGAGAATTCATTAAGGAGCTTGCCCGGGATGCAGAAGCTGTAAATGAAAAA
GCTATAAAACTAAATGAAACTCTAGGAACTCGAGACGAGGCCTTTGAGAGAAATTTGGAAGGGCTTCAGAAAGAGATTGACCAGATGATT
AAAGAACTGAGGAGGAAAAATCTAGAGACACAAAAGGAAATTGCTGAAGATGAGTTGGTAGCTGCAGAAGCCCTTCTGAAAAAAGTGAAG
AAGCTGTTTGGAGAGTCCCGGGGGGAAAATGAAGAAATGGAGAAGGATCTCCGGGAAAAACTGGCTGACTACAAAAACAAAGTTGATGAT
GCTTGGGACCTTTTGAGAGAAGCCACAGATAAAATCAGAGAAGCTAATCGCCTATTTGCAGTAAATCAGAAAAACATGACTGCATTGGAG
AAAAAGAAGGAGGCTGTTGAAAGCGGCAAACGACAAATTGAGAACACTTTAAAAGAGGGCAATGACATACTCGATGAAGCCAACCGTCTT
GCAGATGAAATCAACTCCATCATAGACTATGTTGAAGACATCCAAACTAAATTGCCACCTATGTCTGAGGAGCTTAATGATAAAATAGAT
GACCTCTCCCAAGAAATAAAGGACAGGAAGCTTGCTGAGAAGGTGTCCCAGGCTGAGAGCCACGCAGCTCAGTTGAATGACTCATCTGCT
GTCCTTGATGGAATCCTTGATGAGGCTAAAAACATCTCCTTCAATGCCACTGCAGCCTTCAAAGCTTACAGCAATATTAAGGACTATATT
GATGAAGCTGAGAAAGTTGCCAAAGAAGCCAAAGATCTTGCACATGAAGCTACAAAACTGGCAACAGGTCCTCGGGGTTTATTAAAGGAA
GATGCCAAAGGCTGTCTTCAGAAAAGCTTCAGGATTCTTAACGAAGCCAAGAAGTTAGCAAATGATGTAAAAGAAAATGAAGACCATCTA
AATGGCTTAAAAACCAGGATAGAAAATGCTGATGCTAGAAATGGGGATCTCTTGAGAACTTTGAATGACACTTTGGGAAAGTTATCAGCT
ATTCCAAATGATACAGCTGCTAAACTGCAAGCTGTTAAGGACAAAGCCAGACAAGCCAACGACACAGCTAAAGATGTACTGGCACAGATT
ACAGAGCTCCACCAGAACCTCGATGGCCTGAAGAAGAATTACAATAAACTAGCAGACAGCGTCGCCAAAACGAATGCTGTGGTTAAAGAT
CCTTCCAAGAACAAAATCATTGCCGATGCAGATGCCACTGTCAAAAATTTAGAACAGGAAGCTGACCGGCTAATAGATAAACTCAAACCC
ATCAAGGAACTTGAGGATAACCTAAAGAAAAACATCTCTGAGATAAAGGAATTGATAAACCAAGCTCGGAAACAAGCCAATTCTATCAAA
GTATCTGTGTCTTCAGGAGGTGACTGCATTCGAACATACAAACCAGAAATCAAGAAAGGAAGTTACAATAATATTGTTGTCAACGTAAAG
ACAGCTGTTGCTGATAACCTCCTCTTTTATCTTGGAAGTGCCAAATTTATTGACTTTCTGGCTATAGAAATGCGTAAAGGCAAAGTCAGC
TTCCTCTGGGATGTTGGATCTGGAGTTGGACGTGTAGAGTACCCAGATTTGACTATTGATGACTCATATTGGTACCGTATCGTAGCATCA
AGAACTGGGAGAAATGGAACTATTTCTGTGAGAGCCCTGGATGGACCCAAAGCCAGCATTGTGCCCAGCACACACCATTCGACGTCTCCT
CCAGGGTACACGATTCTAGATGTGGATGCAAATGCAATGCTGTTTGTTGGTGGCCTGACTGGGAAATTAAAGAAGGCTGATGCTGTACGT
GTGATTACATTCACTGGCTGCATGGGAGAAACATACTTTGACAACAAACCTATAGGTTTGTGGAATTTCCGAGAAAAAGAAGGTGACTGC
AAAGGATGCACTGTCAGTCCTCAGGTGGAAGATAGTGAGGGGACTATTCAATTTGATGGAGAAGGTTATGCATTGGTCAGCCGTCCCATT
CGCTGGTACCCCAACATCTCCACTGTCATGTTCAAGTTCAGAACATTTTCTTCGAGTGCTCTTCTGATGTATCTTGCCACACGAGACCTG
AGAGATTTCATGAGTGTGGAGCTCACTGATGGGCACATAAAAGTCAGTTACGATCTGGGCTCAGGAATGGCTTCCGTTGTCAGCAATCAA
AACCATAATGATGGGAAATGGAAATCATTCACTCTGTCAAGAATTCAAAAACAAGCCAATATATCAATTGTAGATATAGATACTAATCAG
GAGGAGAATATAGCAACTTCGTCTTCTGGAAACAACTTTGGTCTTGACTTGAAAGCAGATGACAAAATATATTTTGGTGGCCTGCCAACG
CTGAGAAACTTGAGTATGAAAGCAAGGCCAGAAGTAAATCTGAAGAAATATTCCGGCTGCCTCAAAGATATTGAAATTTCAAGAACTCCG
TACAATATACTCAGTAGTCCCGATTATGTTGGTGTTACCAAAGGATGTTCCCTGGAGAATGTTTACACAGTTAGCTTTCCTAAGCCTGGT
TTTGTGGAGCTCTCCCCTGTGCCAATTGATGTAGGAACAGAAATCAACCTGTCATTCAGCACCAAGAATGAGTCCGGCATCATTCTTTTG
GGAAGTGGAGGGACACCAGCACCACCTAGGAGAAAACGAAGGCAGACTGGACAGGCCTATTATGCAATACTCCTCAACAGGGGCCGTCTG
GAAGTGCATCTCTCCACAGGGGCACGAACAATGAGGAAAATTGTGATCAGACCAGAGCCGAATCTGTTTCATGATGGAAGAGAACATTCC
GTTCATGTAGAGCGAACTAGAGGCATCTTTACAGTTCAAGTGGATGAAAACAGAAGATACATGCAAAACCTGACAGTTGAACAGCCTATC
GAAGTTAAAAAGCTTTTCGTTGGGGGTGCTCCACCTGAATTTCAACCTTCCCCACTCAGAAATATTCCTCCTTTTGAAGGCTGCATATGG
AATCTTGTTATTAACTCTGTCCCCATGGACTTTGCAAGGCCTGTGTCCTTCAAAAATGCTGACATTGGTCGCTGTGCCCATCAGAAACTC
CGTGAAGATGAAGATGGAGCAGCTCCAGCTGAAATAGTTATCCAGCCTGAGCCAGTTCCCACCCCAGCCTTTCCTACGCCCACCCCAGTT
CTGACACATGGTCCTTGTGCTGCAGAATCAGAACCAGCTCTTTTGATAGGGAGCAAGCAGTTCGGGCTTTCAAGAAACAGTCACATTGCA
ATTGCATTTGATGACACCAAAGTTAAAAACCGTCTCACAATTGAGTTGGAAGTAAGAACCGAAGCTGAATCCGGCTTGCTTTTTTACATG
GCTCGCATCAATCATGCTGATTTTGCAACAGTTCAGCTGAGAAATGGATTGCCCTACTTCAGCTATGACTTGGGGAGTGGGGACACCCAC
ACCATGATCCCCACCAAAATCAATGATGGCCAGTGGCACAAGATTAAGATAATGAGAAGTAAGCAAGAAGGAATTCTTTATGTAGATGGG
GCTTCCAACAGAACCATCAGTCCCAAAAAAGCCGACATCCTGGATGTCGTGGGAATGCTGTATGTTGGTGGGTTACCCATCAACTACACT
ACCCGAAGAATTGGTCCAGTGACCTATAGCATTGATGGCTGCGTCAGGAATCTCCACATGGCAGAGGCCCCTGCCGATCTGGAACAACCC
ACCTCCAGCTTCCATGTTGGGACATGTTTTGCAAATGCTCAGAGGGGAACATATTTTGACGGAACCGGTTTTGCCAAAGCAGTTGGTGGA
TTCAAAGTGGGATTGGACCTTCTTGTAGAATTTGAATTCCGCACAACTACAACGACTGGAGTTCTTCTGGGGATCAGTAGTCAAAAAATG
GATGGAATGGGTATTGAAATGATTGATGAAAAGTTGATGTTTCATGTGGACAATGGTGCGGGCAGATTCACTGCTGTCTATGATGCTGGG
GTTCCAGGGCATTTGTGTGATGGACAATGGCATAAAGTCACTGCCAACAAGATCAAACACCGCATTGAGCTCACAGTCGATGGGAACCAG
GTGGAAGCCCAAAGCCCAAACCCAGCATCTACATCAGCTGACACAAATGACCCTGTGTTTGTTGGAGGCTTCCCAGATGACCTCAAGCAG
TTTGGCCTAACAACCAGTATTCCGTTCCGAGGTTGCATCAGATCCCTGAAGCTCACCAAAGGCACAGGCAAGCCACTGGAGGTTAATTTT
GCCAAGGCCCTGGAACTGAGGGGCGTTCAACCTGTATCATGCCCAGCCAACTAATAAAAATAAGTGTAACCCCAGGAAGAGTCTGTCAAA
ACAAGTATATCAAGTAAAACAAACAAATATATTTTACCTATATATGTTAATTAAACTAATTTGTGCATGTACATAGAATTCTTTCTGTAT
TCAGATGGTGCTAATTCAGACTCCAGACTGAATTTTAATTCAAGTTCTTTCTCAAGTCTATAAATAATATTAAACTGATTATTTCATTCT


Top

FusionGenePPI for FAM135A_LAMA2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FAM135ALAMA2DAG1, SMC6, ENTHD2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FAM135A_LAMA2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FAM135A_LAMA2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneLAMA2C1263858Muscular dystrophy congenital, merosin negative3CTD_human;ORPHANET;UNIPROT
TgeneLAMA2C0026850Muscular Dystrophy2CTD_human;HPO
TgeneLAMA2C0036341Schizophrenia2CTD_human
TgeneLAMA2C0005695Bladder Neoplasm1CTD_human
TgeneLAMA2C0027092Myopia1CTD_human