FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12522

FusionGeneSummary for FAM126A_TRA2A

check button Fusion gene summary
Fusion gene informationFusion gene name: FAM126A_TRA2A
Fusion gene ID: 12522
HgeneTgene
Gene symbol

FAM126A

TRA2A

Gene ID

84668

29896

Gene namefamily with sequence similarity 126 member Atransformer 2 alpha homolog
SynonymsDRCTNNB1A|HCC|HLD5|HYCC1AWMS1|HSU53209
Cytomap

7p15.3

7p15.3

Type of geneprotein-codingprotein-coding
Descriptionhyccindown regulated by Ctnnb1, adown-regulated by CTNNB1 protein Atransformer-2 protein homolog alphaTRA-2 alphaTRA2-alphaTra2alphahtra-2 alphaputative MAPK activating protein PM24transformer-2 alphatransformer-2 protein homolog A
Modification date2018051920180523
UniProtAcc

Q9BYI3

Q13595

Ensembl transtripts involved in fusion geneENST00000432176, ENST00000409923, 
ENST00000498833, ENST00000409763, 
ENST00000297071, ENST00000392502, 
ENST00000538367, ENST00000474586, 
Fusion gene scores* DoF score3 X 3 X 3=275 X 6 X 5=150
# samples 47
** MAII scorelog2(4/27*10)=0.567040592723894
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/150*10)=-1.09953567355091
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FAM126A [Title/Abstract] AND TRA2A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFAM126A

GO:0046854

phosphatidylinositol phosphorylation

26571211

HgeneFAM126A

GO:0072659

protein localization to plasma membrane

26571211

TgeneTRA2A

GO:0000398

mRNA splicing, via spliceosome

9546399


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-D9-A4Z6-01AFAM126Achr7

23023563

-TRA2Achr7

23547154

-
TCGARVSKCMTCGA-D9-A4Z6-06AFAM126Achr7

23023563

-TRA2Achr7

23547154

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000432176ENST00000297071FAM126Achr7

23023563

-TRA2Achr7

23547154

-
In-frameENST00000432176ENST00000392502FAM126Achr7

23023563

-TRA2Achr7

23547154

-
In-frameENST00000432176ENST00000538367FAM126Achr7

23023563

-TRA2Achr7

23547154

-
5CDS-5UTRENST00000432176ENST00000474586FAM126Achr7

23023563

-TRA2Achr7

23547154

-
In-frameENST00000409923ENST00000297071FAM126Achr7

23023563

-TRA2Achr7

23547154

-
In-frameENST00000409923ENST00000392502FAM126Achr7

23023563

-TRA2Achr7

23547154

-
In-frameENST00000409923ENST00000538367FAM126Achr7

23023563

-TRA2Achr7

23547154

-
5CDS-5UTRENST00000409923ENST00000474586FAM126Achr7

23023563

-TRA2Achr7

23547154

-
intron-3CDSENST00000498833ENST00000297071FAM126Achr7

23023563

-TRA2Achr7

23547154

-
intron-3CDSENST00000498833ENST00000392502FAM126Achr7

23023563

-TRA2Achr7

23547154

-
intron-3CDSENST00000498833ENST00000538367FAM126Achr7

23023563

-TRA2Achr7

23547154

-
intron-5UTRENST00000498833ENST00000474586FAM126Achr7

23023563

-TRA2Achr7

23547154

-
In-frameENST00000409763ENST00000297071FAM126Achr7

23023563

-TRA2Achr7

23547154

-
In-frameENST00000409763ENST00000392502FAM126Achr7

23023563

-TRA2Achr7

23547154

-
In-frameENST00000409763ENST00000538367FAM126Achr7

23023563

-TRA2Achr7

23547154

-
5CDS-5UTRENST00000409763ENST00000474586FAM126Achr7

23023563

-TRA2Achr7

23547154

-

Top

FusionProtFeatures for FAM126A_TRA2A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FAM126A

Q9BYI3

TRA2A

Q13595

Sequence-specific RNA-binding protein which participatesin the control of pre-mRNA splicing. {ECO:0000269|PubMed:9546399}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTRA2Achr7:23023563chr7:23547154ENST00000297071-38226_282175283Compositional biasNote=Arg/Ser-rich (RS2 domain)
TgeneTRA2Achr7:23023563chr7:23547154ENST00000297071-38198_225175283RegionNote=Linker

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTRA2Achr7:23023563chr7:23547154ENST00000297071-3830_112175283Compositional biasNote=Arg/Ser-rich (RS1 domain)
TgeneTRA2Achr7:23023563chr7:23547154ENST00000297071-38119_197175283DomainRRM


Top

FusionGeneSequence for FAM126A_TRA2A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FAM126A_ENST00000432176_chr7_23023563_-_TRA2A_ENST00000297071_chr7_23547154_-_159aa
MFTSEKGVVEEWLSEFKTLPETSLPNTATNLKDKSSLVSSLTKVIQEPQSEAMERANGMELDGRRIRVDTSITKRAHTPTPGIYMGRPTH

>In-frame_FAM126A_ENST00000432176_chr7_23023563_-_TRA2A_ENST00000392502_chr7_23547154_-_158aa
MFTSEKGVVEEWLSEFKTLPETSLPNTATNLKDKSSLVSSLTKVIQEPQSEAMERANGMELDGRRIRVDTSITKRAHTPTPGIYMGRPTH

>In-frame_FAM126A_ENST00000432176_chr7_23023563_-_TRA2A_ENST00000538367_chr7_23547154_-_159aa
MFTSEKGVVEEWLSEFKTLPETSLPNTATNLKDKSSLVSSLTKVIQEPQSEAMERANGMELDGRRIRVDTSITKRAHTPTPGIYMGRPTH

>In-frame_FAM126A_ENST00000409923_chr7_23023563_-_TRA2A_ENST00000297071_chr7_23547154_-_159aa
MFTSEKGVVEEWLSEFKTLPETSLPNTATNLKDKSSLVSSLTKVIQEPQSEAMERANGMELDGRRIRVDTSITKRAHTPTPGIYMGRPTH

>In-frame_FAM126A_ENST00000409923_chr7_23023563_-_TRA2A_ENST00000392502_chr7_23547154_-_158aa
MFTSEKGVVEEWLSEFKTLPETSLPNTATNLKDKSSLVSSLTKVIQEPQSEAMERANGMELDGRRIRVDTSITKRAHTPTPGIYMGRPTH

>In-frame_FAM126A_ENST00000409923_chr7_23023563_-_TRA2A_ENST00000538367_chr7_23547154_-_159aa
MFTSEKGVVEEWLSEFKTLPETSLPNTATNLKDKSSLVSSLTKVIQEPQSEAMERANGMELDGRRIRVDTSITKRAHTPTPGIYMGRPTH

>In-frame_FAM126A_ENST00000409763_chr7_23023563_-_TRA2A_ENST00000297071_chr7_23547154_-_108aa
AMERANGMELDGRRIRVDTSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYTDRGTDRGTDRTEDTDYRYRRRSPSPTT

>In-frame_FAM126A_ENST00000409763_chr7_23023563_-_TRA2A_ENST00000392502_chr7_23547154_-_107aa
AMERANGMELDGRRIRVDTSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYTDRGTDRGTDRTEDTDYRYRRSPSPTTS

>In-frame_FAM126A_ENST00000409763_chr7_23023563_-_TRA2A_ENST00000538367_chr7_23547154_-_108aa
AMERANGMELDGRRIRVDTSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYTDRGTDRGTDRTEDTDYRYRRRSPSPTT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FAM126A_ENST00000432176_chr7_23023563_-_TRA2A_ENST00000297071_chr7_23547154_-_477nt
ATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAAT
TTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATGGAATGGAG
CTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGACCAACTCAT
AGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGATATGATCGT
GGGTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAAGATCT

>In-frame_FAM126A_ENST00000432176_chr7_23023563_-_TRA2A_ENST00000392502_chr7_23547154_-_474nt
ATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAAT
TTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATGGAATGGAG
CTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGACCAACTCAT
AGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGATATGATCGT
GGGTATGACAGATATGAAGACTATGATTACCGATACAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAAGATCTCGT

>In-frame_FAM126A_ENST00000432176_chr7_23023563_-_TRA2A_ENST00000538367_chr7_23547154_-_477nt
ATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAAT
TTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATGGAATGGAG
CTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGACCAACTCAT
AGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGATATGATCGT
GGGTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAAGATCT

>In-frame_FAM126A_ENST00000409923_chr7_23023563_-_TRA2A_ENST00000297071_chr7_23547154_-_477nt
ATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAAT
TTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATGGAATGGAG
CTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGACCAACTCAT
AGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGATATGATCGT
GGGTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAAGATCT

>In-frame_FAM126A_ENST00000409923_chr7_23023563_-_TRA2A_ENST00000392502_chr7_23547154_-_474nt
ATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAAT
TTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATGGAATGGAG
CTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGACCAACTCAT
AGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGATATGATCGT
GGGTATGACAGATATGAAGACTATGATTACCGATACAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAAGATCTCGT

>In-frame_FAM126A_ENST00000409923_chr7_23023563_-_TRA2A_ENST00000538367_chr7_23547154_-_477nt
ATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAAT
TTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATGGAATGGAG
CTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGACCAACTCAT
AGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGATATGATCGT
GGGTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAAGATCT

>In-frame_FAM126A_ENST00000409763_chr7_23023563_-_TRA2A_ENST00000297071_chr7_23547154_-_324nt
GCTATGGAAAGGGCAAATGGAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCA
GGCATCTACATGGGCAGACCAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGAT
TCTTACTATGATAGAGGATATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTAT

>In-frame_FAM126A_ENST00000409763_chr7_23023563_-_TRA2A_ENST00000392502_chr7_23547154_-_321nt
GCTATGGAAAGGGCAAATGGAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCA
GGCATCTACATGGGCAGACCAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGAT
TCTTACTATGATAGAGGATATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACAGACGATCACCTTCTCCTTATTATAGT

>In-frame_FAM126A_ENST00000409763_chr7_23023563_-_TRA2A_ENST00000538367_chr7_23547154_-_324nt
GCTATGGAAAGGGCAAATGGAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCA
GGCATCTACATGGGCAGACCAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGAT
TCTTACTATGATAGAGGATATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_FAM126A_ENST00000432176_chr7_23023563_-_TRA2A_ENST00000297071_chr7_23547154_-_1489nt
GAGAGGCTGGCGGCAGTGGTGGCTCTCCCGGCTGGGTTGTCAGTCAGTGAGAGGAGGGGGAAGATGGCTCACCGGGACCCGTTCTGCTAG
GAAGAAGGGGAGCAGGTGGTGCTGCTACTCGGGAGGAAGCAGAGCAGCCTCCGTCGCTGTCGCTGAGAGCCTCACGAGTCGAGGTCCTGC
AGGTGGAGCTCCGGCAGCCGCCCTGGTTGAAGGTTTAGAACAGATGTGGAAAAATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGT
TGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAATTTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATA
AAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATGGAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAA
CCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGACCAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAG
GTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGATATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACA
GAAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAAGATCTCGTTCCTACAGCCCAAGACGCTATTGATAACGGAATG
GTTGCAATTAAGGACATTTTTTTTCCTCTTTTTTTTTTTTTTTTTTTTAATTCTGAGATTTCCCCAAGCTGTGGATTCTTCCTACTCCTT
AAGAAAAAAACTTTGGTTTATTTAGCATCTACACTTTTGTCAGTTGTGTTGCTGTTTTCCACCCATTTTATTATACTCTTAAAAGATGTA
ATTGTTGTCATTTTGAACAGTTAAACATCTTGAGTATAAAAAGAACCCCAATGTTATGTTATGCTTTGTAAATTTTTTTTTTTGCTTTTA
CCTAGATAAACTTCTAGCTAATCAAATAAGGAAAGAAACTGTCTTTTTAAAGCTTCTTTTGTGTTAGATACTGTATTAGAGATCTGCATT
TATCATGAGTTCCTTTTTTTTTTTAACTTTATTTTTGGGAAAGTAACACATGAAGTAGTTCAGTCATGTCAGGTTTGTCTGGGGTGGAAT
GGAACAGTCAGGTAGTTGAAAGTTTTTTTTTAGAGATGAAAAGCTTGTGAACTCCTGTAAAACATGCTGTATTTGAAATACATCTGTTAA
AACTTAAAAACTAAAGTGTGATTTTTTTTGTTGTTGTTAAGTTTATTGAAGTTTATTCCCTTAATCAGTGAAGGACAACCCTTATTTATT
ACCTAGAGCAGTTGTATAATTCGCTGTTAGAAATTTTGGTATTGGGACAGTGGATAAGCAGGTTATCACATAGCATAGAATTCTTAAAAG

>In-frame_FAM126A_ENST00000432176_chr7_23023563_-_TRA2A_ENST00000392502_chr7_23547154_-_1116nt
GAGAGGCTGGCGGCAGTGGTGGCTCTCCCGGCTGGGTTGTCAGTCAGTGAGAGGAGGGGGAAGATGGCTCACCGGGACCCGTTCTGCTAG
GAAGAAGGGGAGCAGGTGGTGCTGCTACTCGGGAGGAAGCAGAGCAGCCTCCGTCGCTGTCGCTGAGAGCCTCACGAGTCGAGGTCCTGC
AGGTGGAGCTCCGGCAGCCGCCCTGGTTGAAGGTTTAGAACAGATGTGGAAAAATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGT
TGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAATTTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATA
AAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATGGAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAA
CCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGACCAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAG
GTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGATATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACA
GACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAAGATCTCGTTCCTACAGCCCAAGACGCTATTGATAACGGAATGGTT
GCAATTAAGGACATTTTTTTTCCTCTTTTTTTTTTTTTTTTTTTTAATTCTGAGATTTCCCCAAGCTGTGGATTCTTCCTACTCCTTAAG
AAAAAAACTTTGGTTTATTTAGCATCTACACTTTTGTCAGTTGTGTTGCTGTTTTCCACCCATTTTATTATACTCTTAAAAGATGTAATT
GTTGTCATTTTGAACAGTTAAACATCTTGAGTATAAAAAGAACCCCAATGTTATGTTATGCTTTGTAAATTTTTTTTTTTGCTTTTACCT
AGATAAACTTCTAGCTAATCAAATAAGGAAAGAAACTGTCTTTTTAAAGCTTCTTTTGTGTTAGATACTGTATTAGAGATCTGCATTTAT

>In-frame_FAM126A_ENST00000432176_chr7_23023563_-_TRA2A_ENST00000538367_chr7_23547154_-_810nt
GAGAGGCTGGCGGCAGTGGTGGCTCTCCCGGCTGGGTTGTCAGTCAGTGAGAGGAGGGGGAAGATGGCTCACCGGGACCCGTTCTGCTAG
GAAGAAGGGGAGCAGGTGGTGCTGCTACTCGGGAGGAAGCAGAGCAGCCTCCGTCGCTGTCGCTGAGAGCCTCACGAGTCGAGGTCCTGC
AGGTGGAGCTCCGGCAGCCGCCCTGGTTGAAGGTTTAGAACAGATGTGGAAAAATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGT
TGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAATTTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATA
AAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATGGAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAA
CCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGACCAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAG
GTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGATATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACA
GAAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAAGATCTCGTTCCTACAGCCCAAGACGCTATTGATAACGGAATG
GTTGCAATTAAGGACATTTTTTTTCCTCTTTTTTTTTTTTTTTTTTTTAATTCTGAGATTTCCCCAAGCTGTGGATTCTTCCTACTCCTT

>In-frame_FAM126A_ENST00000409923_chr7_23023563_-_TRA2A_ENST00000297071_chr7_23547154_-_1444nt
AGTGAGAGGAGGGGGAAGATGGCTCACCGGGACCCGTTCTGCTAGGAAGAAGGGGAGCAGGTGGTGCTGCTACTCGGGAGGAAGCAGAGC
AGCCTCCGTCGCTGTCGCTGAGAGCCTCACGAGTCGAGGTCCTGCAGGTGGAGCTCCGGCAGCCGCCCTGGTTGAAGGTTTAGAACAGAT
GTGGAAAAATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATG
CCACAAATTTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATG
GAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGAC
CAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGAT
ATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGAT
CAAGATCTCGTTCCTACAGCCCAAGACGCTATTGATAACGGAATGGTTGCAATTAAGGACATTTTTTTTCCTCTTTTTTTTTTTTTTTTT
TTTAATTCTGAGATTTCCCCAAGCTGTGGATTCTTCCTACTCCTTAAGAAAAAAACTTTGGTTTATTTAGCATCTACACTTTTGTCAGTT
GTGTTGCTGTTTTCCACCCATTTTATTATACTCTTAAAAGATGTAATTGTTGTCATTTTGAACAGTTAAACATCTTGAGTATAAAAAGAA
CCCCAATGTTATGTTATGCTTTGTAAATTTTTTTTTTTGCTTTTACCTAGATAAACTTCTAGCTAATCAAATAAGGAAAGAAACTGTCTT
TTTAAAGCTTCTTTTGTGTTAGATACTGTATTAGAGATCTGCATTTATCATGAGTTCCTTTTTTTTTTTAACTTTATTTTTGGGAAAGTA
ACACATGAAGTAGTTCAGTCATGTCAGGTTTGTCTGGGGTGGAATGGAACAGTCAGGTAGTTGAAAGTTTTTTTTTAGAGATGAAAAGCT
TGTGAACTCCTGTAAAACATGCTGTATTTGAAATACATCTGTTAAAACTTAAAAACTAAAGTGTGATTTTTTTTGTTGTTGTTAAGTTTA
TTGAAGTTTATTCCCTTAATCAGTGAAGGACAACCCTTATTTATTACCTAGAGCAGTTGTATAATTCGCTGTTAGAAATTTTGGTATTGG
GACAGTGGATAAGCAGGTTATCACATAGCATAGAATTCTTAAAAGATACATGTGGGGAAAAGTAGTCTCAAATAAAAGCTAATTTCTTTG

>In-frame_FAM126A_ENST00000409923_chr7_23023563_-_TRA2A_ENST00000392502_chr7_23547154_-_1071nt
AGTGAGAGGAGGGGGAAGATGGCTCACCGGGACCCGTTCTGCTAGGAAGAAGGGGAGCAGGTGGTGCTGCTACTCGGGAGGAAGCAGAGC
AGCCTCCGTCGCTGTCGCTGAGAGCCTCACGAGTCGAGGTCCTGCAGGTGGAGCTCCGGCAGCCGCCCTGGTTGAAGGTTTAGAACAGAT
GTGGAAAAATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATG
CCACAAATTTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATG
GAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGAC
CAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGAT
ATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAA
GATCTCGTTCCTACAGCCCAAGACGCTATTGATAACGGAATGGTTGCAATTAAGGACATTTTTTTTCCTCTTTTTTTTTTTTTTTTTTTT
AATTCTGAGATTTCCCCAAGCTGTGGATTCTTCCTACTCCTTAAGAAAAAAACTTTGGTTTATTTAGCATCTACACTTTTGTCAGTTGTG
TTGCTGTTTTCCACCCATTTTATTATACTCTTAAAAGATGTAATTGTTGTCATTTTGAACAGTTAAACATCTTGAGTATAAAAAGAACCC
CAATGTTATGTTATGCTTTGTAAATTTTTTTTTTTGCTTTTACCTAGATAAACTTCTAGCTAATCAAATAAGGAAAGAAACTGTCTTTTT

>In-frame_FAM126A_ENST00000409923_chr7_23023563_-_TRA2A_ENST00000538367_chr7_23547154_-_765nt
AGTGAGAGGAGGGGGAAGATGGCTCACCGGGACCCGTTCTGCTAGGAAGAAGGGGAGCAGGTGGTGCTGCTACTCGGGAGGAAGCAGAGC
AGCCTCCGTCGCTGTCGCTGAGAGCCTCACGAGTCGAGGTCCTGCAGGTGGAGCTCCGGCAGCCGCCCTGGTTGAAGGTTTAGAACAGAT
GTGGAAAAATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATG
CCACAAATTTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATG
GAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGAC
CAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGAT
ATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGAT
CAAGATCTCGTTCCTACAGCCCAAGACGCTATTGATAACGGAATGGTTGCAATTAAGGACATTTTTTTTCCTCTTTTTTTTTTTTTTTTT

>In-frame_FAM126A_ENST00000409763_chr7_23023563_-_TRA2A_ENST00000297071_chr7_23547154_-_1434nt
GGGGGAAGATGGCTCACCGGGACCCGTTCTGCTAGGAAGAAGGGGAGCAGGTGGTGCTGCTACTCGGGAGGAAGCAGAGCAGCCTCCGTC
GCTGTCGCTGAGAGCCTCACGAGTCGAGGTCCTGCAGGTGGAGCTCCGGCAGCCGCCCTGGTTGAAGGTTTAGAACAGATGTGGAAAAAT
GTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAATTT
GAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATGGAATGGAGCT
GGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGACCAACTCATAG
TGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGATATGATCGTGG
GTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAAGATCTCG
TTCCTACAGCCCAAGACGCTATTGATAACGGAATGGTTGCAATTAAGGACATTTTTTTTCCTCTTTTTTTTTTTTTTTTTTTTAATTCTG
AGATTTCCCCAAGCTGTGGATTCTTCCTACTCCTTAAGAAAAAAACTTTGGTTTATTTAGCATCTACACTTTTGTCAGTTGTGTTGCTGT
TTTCCACCCATTTTATTATACTCTTAAAAGATGTAATTGTTGTCATTTTGAACAGTTAAACATCTTGAGTATAAAAAGAACCCCAATGTT
ATGTTATGCTTTGTAAATTTTTTTTTTTGCTTTTACCTAGATAAACTTCTAGCTAATCAAATAAGGAAAGAAACTGTCTTTTTAAAGCTT
CTTTTGTGTTAGATACTGTATTAGAGATCTGCATTTATCATGAGTTCCTTTTTTTTTTTAACTTTATTTTTGGGAAAGTAACACATGAAG
TAGTTCAGTCATGTCAGGTTTGTCTGGGGTGGAATGGAACAGTCAGGTAGTTGAAAGTTTTTTTTTAGAGATGAAAAGCTTGTGAACTCC
TGTAAAACATGCTGTATTTGAAATACATCTGTTAAAACTTAAAAACTAAAGTGTGATTTTTTTTGTTGTTGTTAAGTTTATTGAAGTTTA
TTCCCTTAATCAGTGAAGGACAACCCTTATTTATTACCTAGAGCAGTTGTATAATTCGCTGTTAGAAATTTTGGTATTGGGACAGTGGAT

>In-frame_FAM126A_ENST00000409763_chr7_23023563_-_TRA2A_ENST00000392502_chr7_23547154_-_1061nt
GGGGGAAGATGGCTCACCGGGACCCGTTCTGCTAGGAAGAAGGGGAGCAGGTGGTGCTGCTACTCGGGAGGAAGCAGAGCAGCCTCCGTC
GCTGTCGCTGAGAGCCTCACGAGTCGAGGTCCTGCAGGTGGAGCTCCGGCAGCCGCCCTGGTTGAAGGTTTAGAACAGATGTGGAAAAAT
GTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAATTT
GAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATGGAATGGAGCT
GGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGACCAACTCATAG
TGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGATATGATCGTGG
GTATGACAGATATGAAGACTATGATTACCGATACAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAAGATCTCGTTC
CTACAGCCCAAGACGCTATTGATAACGGAATGGTTGCAATTAAGGACATTTTTTTTCCTCTTTTTTTTTTTTTTTTTTTTAATTCTGAGA
TTTCCCCAAGCTGTGGATTCTTCCTACTCCTTAAGAAAAAAACTTTGGTTTATTTAGCATCTACACTTTTGTCAGTTGTGTTGCTGTTTT
CCACCCATTTTATTATACTCTTAAAAGATGTAATTGTTGTCATTTTGAACAGTTAAACATCTTGAGTATAAAAAGAACCCCAATGTTATG
TTATGCTTTGTAAATTTTTTTTTTTGCTTTTACCTAGATAAACTTCTAGCTAATCAAATAAGGAAAGAAACTGTCTTTTTAAAGCTTCTT

>In-frame_FAM126A_ENST00000409763_chr7_23023563_-_TRA2A_ENST00000538367_chr7_23547154_-_755nt
GGGGGAAGATGGCTCACCGGGACCCGTTCTGCTAGGAAGAAGGGGAGCAGGTGGTGCTGCTACTCGGGAGGAAGCAGAGCAGCCTCCGTC
GCTGTCGCTGAGAGCCTCACGAGTCGAGGTCCTGCAGGTGGAGCTCCGGCAGCCGCCCTGGTTGAAGGTTTAGAACAGATGTGGAAAAAT
GTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAATTT
GAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGGCTATGGAAAGGGCAAATGGAATGGAGCT
GGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGACCAACTCATAG
TGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGATATGATCGTGG
GTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAAGATCTCG
TTCCTACAGCCCAAGACGCTATTGATAACGGAATGGTTGCAATTAAGGACATTTTTTTTCCTCTTTTTTTTTTTTTTTTTTTTAATTCTG


Top

FusionGenePPI for FAM126A_TRA2A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FAM126ALPAR6, P2RY8, GAN, CDH1, RGS20, GC, RPGR, P2RX5, SHPK, NR2F2TRA2ATADA2A, YWHAG, NUDT21, SELENBP1, CRABP1, TNNT1, CDK2AP2, C11orf58, ELAVL1, CUL3, CUL5, COPS5, SRSF10, RBM25, SRSF5, CDC5L, SEPT2, NFIA, NHP2L1, NCSTN, SF3A1, BUD31, SF3B3, PHGDH, S100A9, HNRNPC, HNRNPU, PRPF40A, SF3B6, HNRNPM, SAP18, PRPF6, IK, HP1BP3, SEPT7, SMARCB1, PLEC, BARD1, PAXIP1, MAGOH, EIF4A3, PPP1CC, DHX15, U2SURP, CDK6, LBP, NXF1, YTHDC1, CLK3, SRPK2, OBSL1, EZH2, SUZ12, EED, RNF2, BMI1, ZNF22, LARP7, SRRM1, MRPS9, MRPS26, THRAP3, LUC7L2, LUC7L, ZNF768, PTCD1, PTCD3, SRRM2, C17orf85, ZFR, PABPC4L, PABPC4, RBBP6, ELAVL2, RPL6, MRPS23, MRPS27, TRUB2, MRPS6, RPL26L1, MTERF3, PAIP1, MRPS18B, MRPL32, C10orf2, MRPS10, DAP3, MEPCE, UPF1, PPIG, LARP1, LARP1B, PHAX, MRPS31, MKRN1, MRPS18C, MRPS5, MRPS7, MRPS22, MRPS15, MRPS35, MRPS25, RRP9, NGRN, MRPS2, MOV10, MRPS33, SRRT, PRPF3, MRPS11, PNN, SRP14, GAR1, MRPS24, CASC3, WDR33, CSNK1E, CSNK1D, MRPS14, GAPDHS, ZCCHC3, MKRN2, ZC3H11A, NOA1, TRA2B, ISY1, SRSF8, CLK1, SRSF7, APOBEC3F, HIST1H2AG, SRSF12, CLK2, MRPL34, MRPS21, SNIP1, NTRK1, SRSF3, SRSF6, EWSR1, CNTRL, CDK2, FEN1, U2AF2, SNRNP70, ZC3H18, C11orf57, SNRPN, NCOA5, PABPC1, SYF2, APOBEC3D, NR3C1, FOXA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FAM126A_TRA2A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FAM126A_TRA2A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFAM126AC1864663HYPOMYELINATION AND CONGENITAL CATARACT2CTD_human;ORPHANET;UNIPROT
HgeneFAM126AC0236969Substance-Related Disorders1CTD_human
HgeneFAM126AC3714756Intellectual Disability1CTD_human
TgeneTRA2AC0037274Dermatologic disorders1CTD_human
TgeneTRA2AC0311375Arsenic Poisoning1CTD_human