FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12511

FusionGeneSummary for FAM120A_WNK2

check button Fusion gene summary
Fusion gene informationFusion gene name: FAM120A_WNK2
Fusion gene ID: 12511
HgeneTgene
Gene symbol

FAM120A

WNK2

Gene ID

23196

65268

Gene namefamily with sequence similarity 120AWNK lysine deficient protein kinase 2
SynonymsC9orf10|HBVPTPAP|OSSANY-CO-43|P/OKcl.13|PRKWNK2|SDCCAG43
Cytomap

9q22.31

9q22.31

Type of geneprotein-codingprotein-coding
Descriptionconstitutive coactivator of PPAR-gamma-like protein 1oxidative stess-associated Src activatoroxidative stress-associated Src activatorserine/threonine-protein kinase WNK2antigen NY-CO-43mitogen-activated protein kinase kinase kinaseprotein kinase lysine-deficient 2protein kinase with no lysine 2serologically defined colon cancer antigen 43
Modification date2018052320180523
UniProtAcc

Q9NZB2

Q9Y3S1

Ensembl transtripts involved in fusion geneENST00000277165, ENST00000375389, 
ENST00000340893, ENST00000333936, 
ENST00000475933, 
ENST00000427277, 
ENST00000297954, ENST00000395475, 
ENST00000356055, ENST00000349097, 
ENST00000395477, ENST00000471076, 
Fusion gene scores* DoF score6 X 6 X 3=1087 X 7 X 7=343
# samples 67
** MAII scorelog2(6/108*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/343*10)=-2.29278174922785
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FAM120A [Title/Abstract] AND WNK2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneWNK2

GO:0006468

protein phosphorylation

21733846

TgeneWNK2

GO:0046777

protein autophosphorylation

17667937


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-HU-A4GH-01AFAM120Achr9

96261168

+WNK2chr9

96030909

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000277165ENST00000427277FAM120Achr9

96261168

+WNK2chr9

96030909

+
In-frameENST00000277165ENST00000297954FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-3UTRENST00000277165ENST00000395475FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-5UTRENST00000277165ENST00000356055FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-5UTRENST00000277165ENST00000349097FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-5UTRENST00000277165ENST00000395477FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-intronENST00000277165ENST00000471076FAM120Achr9

96261168

+WNK2chr9

96030909

+
In-frameENST00000375389ENST00000427277FAM120Achr9

96261168

+WNK2chr9

96030909

+
In-frameENST00000375389ENST00000297954FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-3UTRENST00000375389ENST00000395475FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-5UTRENST00000375389ENST00000356055FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-5UTRENST00000375389ENST00000349097FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-5UTRENST00000375389ENST00000395477FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-intronENST00000375389ENST00000471076FAM120Achr9

96261168

+WNK2chr9

96030909

+
In-frameENST00000340893ENST00000427277FAM120Achr9

96261168

+WNK2chr9

96030909

+
In-frameENST00000340893ENST00000297954FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-3UTRENST00000340893ENST00000395475FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-5UTRENST00000340893ENST00000356055FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-5UTRENST00000340893ENST00000349097FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-5UTRENST00000340893ENST00000395477FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-intronENST00000340893ENST00000471076FAM120Achr9

96261168

+WNK2chr9

96030909

+
In-frameENST00000333936ENST00000427277FAM120Achr9

96261168

+WNK2chr9

96030909

+
In-frameENST00000333936ENST00000297954FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-3UTRENST00000333936ENST00000395475FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-5UTRENST00000333936ENST00000356055FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-5UTRENST00000333936ENST00000349097FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-5UTRENST00000333936ENST00000395477FAM120Achr9

96261168

+WNK2chr9

96030909

+
5CDS-intronENST00000333936ENST00000471076FAM120Achr9

96261168

+WNK2chr9

96030909

+
intron-3CDSENST00000475933ENST00000427277FAM120Achr9

96261168

+WNK2chr9

96030909

+
intron-3CDSENST00000475933ENST00000297954FAM120Achr9

96261168

+WNK2chr9

96030909

+
intron-3UTRENST00000475933ENST00000395475FAM120Achr9

96261168

+WNK2chr9

96030909

+
intron-5UTRENST00000475933ENST00000356055FAM120Achr9

96261168

+WNK2chr9

96030909

+
intron-5UTRENST00000475933ENST00000349097FAM120Achr9

96261168

+WNK2chr9

96030909

+
intron-5UTRENST00000475933ENST00000395477FAM120Achr9

96261168

+WNK2chr9

96030909

+
intron-intronENST00000475933ENST00000471076FAM120Achr9

96261168

+WNK2chr9

96030909

+

Top

FusionProtFeatures for FAM120A_WNK2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FAM120A

Q9NZB2

WNK2

Q9Y3S1

Serine/threonine kinase which plays an important role inthe regulation of electrolyte homeostasis, cell signaling,survival, and proliferation. Acts as an activator and inhibitor ofsodium-coupled chloride cotransporters and potassium-coupledchloride cotransporters respectively. Activates SLC12A2, SCNN1A,SCNN1B, SCNN1D and SGK1 and inhibits SLC12A5. Negatively regulatesthe EGF-induced activation of the ERK/MAPK-pathway and thedownstream cell cycle progression. Affects MAPK3/MAPK1 activity bymodulating the activity of MAP2K1 and this modulation depends onphosphorylation of MAP2K1 by PAK1. WNK2 acts by interfering withthe activity of PAK1 by controlling the balance of the activity ofupstream regulators of PAK1 activity, RHOA and RAC1, which displayreciprocal activity. {ECO:0000269|PubMed:17667937,ECO:0000269|PubMed:18593598, ECO:0000269|PubMed:21733846}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFAM120Achr9:96261168chr9:96030909ENST00000277165+518829_11183431119RegionNote=RNA binding
HgeneFAM120Achr9:96261168chr9:96030909ENST00000333936+519829_11183431147RegionNote=RNA binding
HgeneFAM120Achr9:96261168chr9:96030909ENST00000340893+517829_11183431073RegionNote=RNA binding
HgeneFAM120Achr9:96261168chr9:96030909ENST00000375389+59829_1118343629RegionNote=RNA binding
TgeneWNK2chr9:96261168chr9:96030909ENST00000297954+1630195_45313042298DomainProtein kinase
TgeneWNK2chr9:96261168chr9:96030909ENST00000297954+1630275_27813042298Nucleotide bindingATP


Top

FusionGeneSequence for FAM120A_WNK2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FAM120A_ENST00000277165_chr9_96261168_+_WNK2_ENST00000427277_chr9_96030909_+_1264aa
MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQWNHMLGYLAALAKACFGGNI
ELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVWFLPPVCMAHCIRLALIRFHVKVAQSIEDHHQEVIGFCRENGFH
GLVAYDSDYALCNIPYYFSAHALKLSRNGKSLTTSQYLMHEVAKQLDLNPNRFPIFAALLGNHILPDEDLASFHWSLLGPEHPLASLKVR
AHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLVLHTGKRWFIICPVAEH
PAPEAPESSPPLPLSSLPPEASQDSAPYKDQLSSKEQPSFLASQQLLSQAGPSNPPGAPPAPLAPSSPPVTALPQDGAAPATSTMPEPAS
GTASQAGGPGTPQGLTSELETSQPLAETHEAPLAVQPLVVGLAPCTPAPEAASTRDASAPREPLPPPAPEPSPHSGTPQPALGQPAPLLP
AAVGAVSLATSQLPSPPLGPTVPPQPPSALESDGEGPPPRVGFVDSTIKSLDEKLRTLLYQEHVPTSSASAGTPVEVGDRDFTLEPLRGD
QPRSEVCGGDLALPPVPKEAVSGRVQLPQPLVEKSELAPTRGAVMEQGTSSSMTAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFV
RPARVEPTDRDGGEAGESSAEPPPSDMGTVGGQASHPQTLGARALGSPRKRPEQQDVSSPAKTVGRFSVVSTQDEWTLASPHSLRYSAPP
DVYLDEAPSSPDVKLAVRRAQTASSIEVGVGEPVSSDSGDEGPRARPPVQKQASLPVSGSVAGDFVKKATAFLQRPSRAGSLGPETPSRV
GMKVPTISVTSFHSQSSYISSDNDSELEDADIKKELQSLREKHLKEISELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSK
SKLKAGKLLNPLVRQLKVVASSTGHLADSSRGPPAKDPAQASVGLTADSTGLSGKAVQTQQPCSVRASLSSDICSGLASDGGGARGQGWT
VYHPTSERVTYKSSSKPRARFLSGPVSVSIWSALKRLCLGKEHSSRSSTSSLAPGPEPGPQPALHVQAQVNNSNNKKGTFTDDLHKLVDE
WTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPRLPPAPGPLSTTVIPGAAPTLSVPTPGSCGPRAVSTPT

>In-frame_FAM120A_ENST00000277165_chr9_96261168_+_WNK2_ENST00000297954_chr9_96030909_+_1337aa
MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQWNHMLGYLAALAKACFGGNI
ELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVWFLPPVCMAHCIRLALIRFHVKVAQSIEDHHQEVIGFCRENGFH
GLVAYDSDYALCNIPYYFSAHALKLSRNGKSLTTSQYLMHEVAKQLDLNPNRFPIFAALLGNHILPDEDLASFHWSLLGPEHPLASLKVR
AHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLVLHTGKRWFIICPVAEH
PAPEAPESSPPLPLSSLPPEASQGPCRGLTLPCLPWRRAACGAVFLSLFSAESAQSKQPPDSAPYKDQLSSKEQPSFLASQQLLSQAGPS
NPPGAPPAPLAPSSPPVTALPQDGAAPATSTMPEPASGTASQAGGPGTPQGLTSELETSQPLAETHEAPLAVQPLVVGLAPCTPAPEAAS
TRDASAPREPLPPPAPEPSPHSGTPQPALGQPAPLLPAAVGAVSLATSQLPSPPLGPTVPPQPPSALESDGEGPPPRVGFVDSTIKSLDE
KLRTLLYQEHVPTSSASAGTPVEVGDRDFTLEPLRGDQPRSEVCGGDLALPPVPKEAVSGRVQLPQPLVEKSELAPTRGAVMEQGTSSSM
TAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFVRPARVEPTDRDGGEAGESSAEPPPSDMGTVGGQASHPQTLGARALGSPRKRPE
QQDVSSPAKTVGRFSVVSTQDEWTLASPHSLRYSAPPDVYLDEAPSSPDVKLAVRRAQTASSIEVGVGEPVSSDSGDEGPRARPPVQKQA
SLPVSGSVAGDFVKKATAFLQRPSRAGSLGPETPSRVGMKVPTISVTSFHSQSSYISSDNDSELEDADIKKELQSLREKHLKEISELQSQ
QKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSKSKLKAGKLLNPLVRQLKVVASSTGHLADSSRGPPAKDPAQASVGLTADSTGLS
GKAVQTQQPCSVRASLSSDICSGLASDGGGARGQGWTVYHPTSERVTYKSSSKPRARFLSGPVSVSIWSALKRLCLGKEHSSRSSTSSLA
PGPEPGPQPALHVQAQVNNSNNKKGTFTDDLHKLVDEWTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPR

>In-frame_FAM120A_ENST00000375389_chr9_96261168_+_WNK2_ENST00000427277_chr9_96030909_+_1264aa
MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQWNHMLGYLAALAKACFGGNI
ELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVWFLPPVCMAHCIRLALIRFHVKVAQSIEDHHQEVIGFCRENGFH
GLVAYDSDYALCNIPYYFSAHALKLSRNGKSLTTSQYLMHEVAKQLDLNPNRFPIFAALLGNHILPDEDLASFHWSLLGPEHPLASLKVR
AHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLVLHTGKRWFIICPVAEH
PAPEAPESSPPLPLSSLPPEASQDSAPYKDQLSSKEQPSFLASQQLLSQAGPSNPPGAPPAPLAPSSPPVTALPQDGAAPATSTMPEPAS
GTASQAGGPGTPQGLTSELETSQPLAETHEAPLAVQPLVVGLAPCTPAPEAASTRDASAPREPLPPPAPEPSPHSGTPQPALGQPAPLLP
AAVGAVSLATSQLPSPPLGPTVPPQPPSALESDGEGPPPRVGFVDSTIKSLDEKLRTLLYQEHVPTSSASAGTPVEVGDRDFTLEPLRGD
QPRSEVCGGDLALPPVPKEAVSGRVQLPQPLVEKSELAPTRGAVMEQGTSSSMTAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFV
RPARVEPTDRDGGEAGESSAEPPPSDMGTVGGQASHPQTLGARALGSPRKRPEQQDVSSPAKTVGRFSVVSTQDEWTLASPHSLRYSAPP
DVYLDEAPSSPDVKLAVRRAQTASSIEVGVGEPVSSDSGDEGPRARPPVQKQASLPVSGSVAGDFVKKATAFLQRPSRAGSLGPETPSRV
GMKVPTISVTSFHSQSSYISSDNDSELEDADIKKELQSLREKHLKEISELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSK
SKLKAGKLLNPLVRQLKVVASSTGHLADSSRGPPAKDPAQASVGLTADSTGLSGKAVQTQQPCSVRASLSSDICSGLASDGGGARGQGWT
VYHPTSERVTYKSSSKPRARFLSGPVSVSIWSALKRLCLGKEHSSRSSTSSLAPGPEPGPQPALHVQAQVNNSNNKKGTFTDDLHKLVDE
WTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPRLPPAPGPLSTTVIPGAAPTLSVPTPGSCGPRAVSTPT

>In-frame_FAM120A_ENST00000375389_chr9_96261168_+_WNK2_ENST00000297954_chr9_96030909_+_1337aa
MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQWNHMLGYLAALAKACFGGNI
ELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVWFLPPVCMAHCIRLALIRFHVKVAQSIEDHHQEVIGFCRENGFH
GLVAYDSDYALCNIPYYFSAHALKLSRNGKSLTTSQYLMHEVAKQLDLNPNRFPIFAALLGNHILPDEDLASFHWSLLGPEHPLASLKVR
AHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLVLHTGKRWFIICPVAEH
PAPEAPESSPPLPLSSLPPEASQGPCRGLTLPCLPWRRAACGAVFLSLFSAESAQSKQPPDSAPYKDQLSSKEQPSFLASQQLLSQAGPS
NPPGAPPAPLAPSSPPVTALPQDGAAPATSTMPEPASGTASQAGGPGTPQGLTSELETSQPLAETHEAPLAVQPLVVGLAPCTPAPEAAS
TRDASAPREPLPPPAPEPSPHSGTPQPALGQPAPLLPAAVGAVSLATSQLPSPPLGPTVPPQPPSALESDGEGPPPRVGFVDSTIKSLDE
KLRTLLYQEHVPTSSASAGTPVEVGDRDFTLEPLRGDQPRSEVCGGDLALPPVPKEAVSGRVQLPQPLVEKSELAPTRGAVMEQGTSSSM
TAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFVRPARVEPTDRDGGEAGESSAEPPPSDMGTVGGQASHPQTLGARALGSPRKRPE
QQDVSSPAKTVGRFSVVSTQDEWTLASPHSLRYSAPPDVYLDEAPSSPDVKLAVRRAQTASSIEVGVGEPVSSDSGDEGPRARPPVQKQA
SLPVSGSVAGDFVKKATAFLQRPSRAGSLGPETPSRVGMKVPTISVTSFHSQSSYISSDNDSELEDADIKKELQSLREKHLKEISELQSQ
QKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSKSKLKAGKLLNPLVRQLKVVASSTGHLADSSRGPPAKDPAQASVGLTADSTGLS
GKAVQTQQPCSVRASLSSDICSGLASDGGGARGQGWTVYHPTSERVTYKSSSKPRARFLSGPVSVSIWSALKRLCLGKEHSSRSSTSSLA
PGPEPGPQPALHVQAQVNNSNNKKGTFTDDLHKLVDEWTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPR

>In-frame_FAM120A_ENST00000340893_chr9_96261168_+_WNK2_ENST00000427277_chr9_96030909_+_1264aa
MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQWNHMLGYLAALAKACFGGNI
ELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVWFLPPVCMAHCIRLALIRFHVKVAQSIEDHHQEVIGFCRENGFH
GLVAYDSDYALCNIPYYFSAHALKLSRNGKSLTTSQYLMHEVAKQLDLNPNRFPIFAALLGNHILPDEDLASFHWSLLGPEHPLASLKVR
AHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLVLHTGKRWFIICPVAEH
PAPEAPESSPPLPLSSLPPEASQDSAPYKDQLSSKEQPSFLASQQLLSQAGPSNPPGAPPAPLAPSSPPVTALPQDGAAPATSTMPEPAS
GTASQAGGPGTPQGLTSELETSQPLAETHEAPLAVQPLVVGLAPCTPAPEAASTRDASAPREPLPPPAPEPSPHSGTPQPALGQPAPLLP
AAVGAVSLATSQLPSPPLGPTVPPQPPSALESDGEGPPPRVGFVDSTIKSLDEKLRTLLYQEHVPTSSASAGTPVEVGDRDFTLEPLRGD
QPRSEVCGGDLALPPVPKEAVSGRVQLPQPLVEKSELAPTRGAVMEQGTSSSMTAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFV
RPARVEPTDRDGGEAGESSAEPPPSDMGTVGGQASHPQTLGARALGSPRKRPEQQDVSSPAKTVGRFSVVSTQDEWTLASPHSLRYSAPP
DVYLDEAPSSPDVKLAVRRAQTASSIEVGVGEPVSSDSGDEGPRARPPVQKQASLPVSGSVAGDFVKKATAFLQRPSRAGSLGPETPSRV
GMKVPTISVTSFHSQSSYISSDNDSELEDADIKKELQSLREKHLKEISELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSK
SKLKAGKLLNPLVRQLKVVASSTGHLADSSRGPPAKDPAQASVGLTADSTGLSGKAVQTQQPCSVRASLSSDICSGLASDGGGARGQGWT
VYHPTSERVTYKSSSKPRARFLSGPVSVSIWSALKRLCLGKEHSSRSSTSSLAPGPEPGPQPALHVQAQVNNSNNKKGTFTDDLHKLVDE
WTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPRLPPAPGPLSTTVIPGAAPTLSVPTPGSCGPRAVSTPT

>In-frame_FAM120A_ENST00000340893_chr9_96261168_+_WNK2_ENST00000297954_chr9_96030909_+_1337aa
MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQWNHMLGYLAALAKACFGGNI
ELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVWFLPPVCMAHCIRLALIRFHVKVAQSIEDHHQEVIGFCRENGFH
GLVAYDSDYALCNIPYYFSAHALKLSRNGKSLTTSQYLMHEVAKQLDLNPNRFPIFAALLGNHILPDEDLASFHWSLLGPEHPLASLKVR
AHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLVLHTGKRWFIICPVAEH
PAPEAPESSPPLPLSSLPPEASQGPCRGLTLPCLPWRRAACGAVFLSLFSAESAQSKQPPDSAPYKDQLSSKEQPSFLASQQLLSQAGPS
NPPGAPPAPLAPSSPPVTALPQDGAAPATSTMPEPASGTASQAGGPGTPQGLTSELETSQPLAETHEAPLAVQPLVVGLAPCTPAPEAAS
TRDASAPREPLPPPAPEPSPHSGTPQPALGQPAPLLPAAVGAVSLATSQLPSPPLGPTVPPQPPSALESDGEGPPPRVGFVDSTIKSLDE
KLRTLLYQEHVPTSSASAGTPVEVGDRDFTLEPLRGDQPRSEVCGGDLALPPVPKEAVSGRVQLPQPLVEKSELAPTRGAVMEQGTSSSM
TAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFVRPARVEPTDRDGGEAGESSAEPPPSDMGTVGGQASHPQTLGARALGSPRKRPE
QQDVSSPAKTVGRFSVVSTQDEWTLASPHSLRYSAPPDVYLDEAPSSPDVKLAVRRAQTASSIEVGVGEPVSSDSGDEGPRARPPVQKQA
SLPVSGSVAGDFVKKATAFLQRPSRAGSLGPETPSRVGMKVPTISVTSFHSQSSYISSDNDSELEDADIKKELQSLREKHLKEISELQSQ
QKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSKSKLKAGKLLNPLVRQLKVVASSTGHLADSSRGPPAKDPAQASVGLTADSTGLS
GKAVQTQQPCSVRASLSSDICSGLASDGGGARGQGWTVYHPTSERVTYKSSSKPRARFLSGPVSVSIWSALKRLCLGKEHSSRSSTSSLA
PGPEPGPQPALHVQAQVNNSNNKKGTFTDDLHKLVDEWTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPR

>In-frame_FAM120A_ENST00000333936_chr9_96261168_+_WNK2_ENST00000427277_chr9_96030909_+_1264aa
MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQWNHMLGYLAALAKACFGGNI
ELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVWFLPPVCMAHCIRLALIRFHVKVAQSIEDHHQEVIGFCRENGFH
GLVAYDSDYALCNIPYYFSAHALKLSRNGKSLTTSQYLMHEVAKQLDLNPNRFPIFAALLGNHILPDEDLASFHWSLLGPEHPLASLKVR
AHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLVLHTGKRWFIICPVAEH
PAPEAPESSPPLPLSSLPPEASQDSAPYKDQLSSKEQPSFLASQQLLSQAGPSNPPGAPPAPLAPSSPPVTALPQDGAAPATSTMPEPAS
GTASQAGGPGTPQGLTSELETSQPLAETHEAPLAVQPLVVGLAPCTPAPEAASTRDASAPREPLPPPAPEPSPHSGTPQPALGQPAPLLP
AAVGAVSLATSQLPSPPLGPTVPPQPPSALESDGEGPPPRVGFVDSTIKSLDEKLRTLLYQEHVPTSSASAGTPVEVGDRDFTLEPLRGD
QPRSEVCGGDLALPPVPKEAVSGRVQLPQPLVEKSELAPTRGAVMEQGTSSSMTAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFV
RPARVEPTDRDGGEAGESSAEPPPSDMGTVGGQASHPQTLGARALGSPRKRPEQQDVSSPAKTVGRFSVVSTQDEWTLASPHSLRYSAPP
DVYLDEAPSSPDVKLAVRRAQTASSIEVGVGEPVSSDSGDEGPRARPPVQKQASLPVSGSVAGDFVKKATAFLQRPSRAGSLGPETPSRV
GMKVPTISVTSFHSQSSYISSDNDSELEDADIKKELQSLREKHLKEISELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSK
SKLKAGKLLNPLVRQLKVVASSTGHLADSSRGPPAKDPAQASVGLTADSTGLSGKAVQTQQPCSVRASLSSDICSGLASDGGGARGQGWT
VYHPTSERVTYKSSSKPRARFLSGPVSVSIWSALKRLCLGKEHSSRSSTSSLAPGPEPGPQPALHVQAQVNNSNNKKGTFTDDLHKLVDE
WTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPRLPPAPGPLSTTVIPGAAPTLSVPTPGSCGPRAVSTPT

>In-frame_FAM120A_ENST00000333936_chr9_96261168_+_WNK2_ENST00000297954_chr9_96030909_+_1337aa
MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQWNHMLGYLAALAKACFGGNI
ELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVWFLPPVCMAHCIRLALIRFHVKVAQSIEDHHQEVIGFCRENGFH
GLVAYDSDYALCNIPYYFSAHALKLSRNGKSLTTSQYLMHEVAKQLDLNPNRFPIFAALLGNHILPDEDLASFHWSLLGPEHPLASLKVR
AHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLVLHTGKRWFIICPVAEH
PAPEAPESSPPLPLSSLPPEASQGPCRGLTLPCLPWRRAACGAVFLSLFSAESAQSKQPPDSAPYKDQLSSKEQPSFLASQQLLSQAGPS
NPPGAPPAPLAPSSPPVTALPQDGAAPATSTMPEPASGTASQAGGPGTPQGLTSELETSQPLAETHEAPLAVQPLVVGLAPCTPAPEAAS
TRDASAPREPLPPPAPEPSPHSGTPQPALGQPAPLLPAAVGAVSLATSQLPSPPLGPTVPPQPPSALESDGEGPPPRVGFVDSTIKSLDE
KLRTLLYQEHVPTSSASAGTPVEVGDRDFTLEPLRGDQPRSEVCGGDLALPPVPKEAVSGRVQLPQPLVEKSELAPTRGAVMEQGTSSSM
TAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFVRPARVEPTDRDGGEAGESSAEPPPSDMGTVGGQASHPQTLGARALGSPRKRPE
QQDVSSPAKTVGRFSVVSTQDEWTLASPHSLRYSAPPDVYLDEAPSSPDVKLAVRRAQTASSIEVGVGEPVSSDSGDEGPRARPPVQKQA
SLPVSGSVAGDFVKKATAFLQRPSRAGSLGPETPSRVGMKVPTISVTSFHSQSSYISSDNDSELEDADIKKELQSLREKHLKEISELQSQ
QKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSKSKLKAGKLLNPLVRQLKVVASSTGHLADSSRGPPAKDPAQASVGLTADSTGLS
GKAVQTQQPCSVRASLSSDICSGLASDGGGARGQGWTVYHPTSERVTYKSSSKPRARFLSGPVSVSIWSALKRLCLGKEHSSRSSTSSLA
PGPEPGPQPALHVQAQVNNSNNKKGTFTDDLHKLVDEWTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FAM120A_ENST00000277165_chr9_96261168_+_WNK2_ENST00000427277_chr9_96030909_+_3792nt
ATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGAGCTGCAGAAGCTGGCCCGGGGCAGC
CTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAACTGCCTGCACCGCCTCTACGGCGGC
TTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGCCAAGGCCTGCTTCGGCGGCAACATC
GAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCAGGGCAACGAGCGCCAGACGGCACAG
CAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGTCTGCATGGCCCACTGCATCCGCCTG
GCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGGTTTCTGCAGAGAGAATGGTTTCCAT
GGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGCCCTAAAACTGAGCCGGAACGGGAAA
AGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCGTTTTCCTATTTTTGCTGCTCTCTTA
GGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACATCCACTAGCCTCACTAAAGGTCCGG
GCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACCTCTGACTTGGAT
GCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGATATTATTCAGCG
ACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTTCATCATCTGTCCGGTGGCTGAGCAC
CCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAGCCAAGATTCAGCGCCCTATAAAGAC
CAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCAGCTCCTGAGCCAGGCGGGCCCCAGCAACCCTCCTGGGGCACCCCCA
GCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAGCTCCAGCCACCAGCACCATGCCAGAGCCAGCGTCA
GGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCTGACCAGTGAGCTCGAGACGTCTCAGCCACTAGCGGAGACTCACGAG
GCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTCCAGAGGCTGCCTCAACCAGGGACGCCAGTGCCCCA
AGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAGCGGGACCCCACAGCCCGCCTTGGGTCAACCTGCTCCCCTGCTTCCT
GCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGGGGCCCACCGTCCCCCCACAGCCACCCTCGGCCCTG
GAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGACAGCACCATCAAGAGCCTGGACGAGAAGCTGCGGACTCTGCTCTAC
CAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCGACAGAGACTTCACCCTGGAGCCCCTGAGAGGGGAC
CAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCCAGTGCCTAAGGAGGCGGTCTCAGGGCGTGTCCAGCTGCCCCAGCCC
TTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCACGTCCTCGTCAATGACAGCAGAGTCGTCTCCCAGG
AGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGACTCCCATGTGGTCCCCAGCGTCCCCCAGGATGTACCTGCTTTTGTG
AGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCTCGGCAGAGCCCCCGCCGAGTGACATGGGCACAGTG
GGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTTGGGGTCCCCTCGGAAACGTCCAGAGCAGCAGGATGTCAGCTCACCA
GCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGGCCTCCCCCCACAGCCTGAGATACTCTGCCCCACCC
GACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCTGGCAGTGCGGCGGGCGCAGACGGCCTCCTCCATCGAGGTCGGCGTG
GGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGGTGCAGAAGCAGGCGTCCCTGCCCGTGAGTGGCAGC
GTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAGGCCTTCTCGGGCCGGCTCGCTGGGCCCCGAGACACCCAGCAGGGTG
GGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACATCAGCAGCGACAATGATTCGGAGCTCGAGGATGCT
GACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAAGGAGATCTCGGAGCTGCAGAGCCAGCAGAAGCAGGAGATCGAAGCT
CTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGGCACCCCCCACTGGCCGCCGGAGAAAAACCAGCAAG
AGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCAGCTCAAGGTCGTGGCCTCCAGCACAGGTCACTTGGCTGACTCCAGC
AGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACAGCACGGGCCTGAGCGGGAAGGCAGTGCAGACCCAG
CAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTCCGGCTTAGCCAGTGATGGAGGCGGAGCGCGTGGCCAAGGCTGGACG
GTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTGCTCGATTCCTCAGTGGACCCGTATCTGTGTCCATC
TGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAGTAGGTCCTCCACCAGCAGCCTGGCCCCAGGCCCTGAGCCAGGCCCC
CAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTACCTTCACGGACGACCTGCACAAGCTGGTGGACGAG
TGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCTCAACCAGCTGAAGCAGACCCAGAAGCTGCAAGACATGGAGGCCCAG
GCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAGTGGGGATGCCACGTCTGCCCCCAGCGCCCGGCCCT
CTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGTGCCCACACCAGGTTCCTGTGGTCCACGCGCCGTCTCCACACCCACT

>In-frame_FAM120A_ENST00000277165_chr9_96261168_+_WNK2_ENST00000297954_chr9_96030909_+_4011nt
ATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGAGCTGCAGAAGCTGGCCCGGGGCAGC
CTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAACTGCCTGCACCGCCTCTACGGCGGC
TTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGCCAAGGCCTGCTTCGGCGGCAACATC
GAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCAGGGCAACGAGCGCCAGACGGCACAG
CAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGTCTGCATGGCCCACTGCATCCGCCTG
GCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGGTTTCTGCAGAGAGAATGGTTTCCAT
GGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGCCCTAAAACTGAGCCGGAACGGGAAA
AGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCGTTTTCCTATTTTTGCTGCTCTCTTA
GGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACATCCACTAGCCTCACTAAAGGTCCGG
GCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACCTCTGACTTGGAT
GCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGATATTATTCAGCG
ACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTTCATCATCTGTCCGGTGGCTGAGCAC
CCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAGCCAAGGTCCATGCAGGGGGCTCACC
CTGCCCTGTCTCCCATGGCGCAGAGCAGCCTGTGGGGCTGTGTTCCTATCCTTGTTTTCTGCTGAATCAGCTCAGTCAAAGCAGCCTCCA
GATTCAGCGCCCTATAAAGACCAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCAGCTCCTGAGCCAGGCGGGCCCCAGC
AACCCTCCTGGGGCACCCCCAGCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAGCTCCAGCCACCAGC
ACCATGCCAGAGCCAGCGTCAGGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCTGACCAGTGAGCTCGAGACGTCTCAG
CCACTAGCGGAGACTCACGAGGCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTCCAGAGGCTGCCTCA
ACCAGGGACGCCAGTGCCCCAAGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAGCGGGACCCCACAGCCCGCCTTGGGT
CAACCTGCTCCCCTGCTTCCTGCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGGGGCCCACCGTCCCC
CCACAGCCACCCTCGGCCCTGGAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGACAGCACCATCAAGAGCCTGGACGAG
AAGCTGCGGACTCTGCTCTACCAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCGACAGAGACTTCACC
CTGGAGCCCCTGAGAGGGGACCAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCCAGTGCCTAAGGAGGCGGTCTCAGGG
CGTGTCCAGCTGCCCCAGCCCTTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCACGTCCTCGTCAATG
ACAGCAGAGTCGTCTCCCAGGAGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGACTCCCATGTGGTCCCCAGCGTCCCC
CAGGATGTACCTGCTTTTGTGAGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCTCGGCAGAGCCCCCG
CCGAGTGACATGGGCACAGTGGGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTTGGGGTCCCCTCGGAAACGTCCAGAG
CAGCAGGATGTCAGCTCACCAGCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGGCCTCCCCCCACAGC
CTGAGATACTCTGCCCCACCCGACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCTGGCAGTGCGGCGGGCGCAGACGGCC
TCCTCCATCGAGGTCGGCGTGGGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGGTGCAGAAGCAGGCG
TCCCTGCCCGTGAGTGGCAGCGTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAGGCCTTCTCGGGCCGGCTCGCTGGGC
CCCGAGACACCCAGCAGGGTGGGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACATCAGCAGCGACAAT
GATTCGGAGCTCGAGGATGCTGACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAAGGAGATCTCGGAGCTGCAGAGCCAG
CAGAAGCAGGAGATCGAAGCTCTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGGCACCCCCCACTGGC
CGCCGGAGAAAAACCAGCAAGAGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCAGCTCAAGGTCGTGGCCTCCAGCACA
GGTCACTTGGCTGACTCCAGCAGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACAGCACGGGCCTGAGC
GGGAAGGCAGTGCAGACCCAGCAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTCCGGCTTAGCCAGTGATGGAGGCGGA
GCGCGTGGCCAAGGCTGGACGGTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTGCTCGATTCCTCAGT
GGACCCGTATCTGTGTCCATCTGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAGTAGGTCCTCCACCAGCAGCCTGGCC
CCAGGCCCTGAGCCAGGCCCCCAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTACCTTCACGGACGAC
CTGCACAAGCTGGTGGACGAGTGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCTCAACCAGCTGAAGCAGACCCAGAAG
CTGCAAGACATGGAGGCCCAGGCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAGTGGGGATGCCACGT
CTGCCCCCAGCGCCCGGCCCTCTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGTGCCCACACCAGATGGCGCCCTCGGA
ACCGCCCGGAGAAACCAGGTGTGGTTTGGCCTCCGAGTCCCCCCCACCGCCTGCTGTGGGCACAGCACTCAGCCGCGAGGGGGACAGCGG

>In-frame_FAM120A_ENST00000375389_chr9_96261168_+_WNK2_ENST00000427277_chr9_96030909_+_3792nt
ATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGAGCTGCAGAAGCTGGCCCGGGGCAGC
CTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAACTGCCTGCACCGCCTCTACGGCGGC
TTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGCCAAGGCCTGCTTCGGCGGCAACATC
GAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCAGGGCAACGAGCGCCAGACGGCACAG
CAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGTCTGCATGGCCCACTGCATCCGCCTG
GCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGGTTTCTGCAGAGAGAATGGTTTCCAT
GGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGCCCTAAAACTGAGCCGGAACGGGAAA
AGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCGTTTTCCTATTTTTGCTGCTCTCTTA
GGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACATCCACTAGCCTCACTAAAGGTCCGG
GCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACCTCTGACTTGGAT
GCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGATATTATTCAGCG
ACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTTCATCATCTGTCCGGTGGCTGAGCAC
CCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAGCCAAGATTCAGCGCCCTATAAAGAC
CAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCAGCTCCTGAGCCAGGCGGGCCCCAGCAACCCTCCTGGGGCACCCCCA
GCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAGCTCCAGCCACCAGCACCATGCCAGAGCCAGCGTCA
GGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCTGACCAGTGAGCTCGAGACGTCTCAGCCACTAGCGGAGACTCACGAG
GCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTCCAGAGGCTGCCTCAACCAGGGACGCCAGTGCCCCA
AGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAGCGGGACCCCACAGCCCGCCTTGGGTCAACCTGCTCCCCTGCTTCCT
GCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGGGGCCCACCGTCCCCCCACAGCCACCCTCGGCCCTG
GAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGACAGCACCATCAAGAGCCTGGACGAGAAGCTGCGGACTCTGCTCTAC
CAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCGACAGAGACTTCACCCTGGAGCCCCTGAGAGGGGAC
CAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCCAGTGCCTAAGGAGGCGGTCTCAGGGCGTGTCCAGCTGCCCCAGCCC
TTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCACGTCCTCGTCAATGACAGCAGAGTCGTCTCCCAGG
AGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGACTCCCATGTGGTCCCCAGCGTCCCCCAGGATGTACCTGCTTTTGTG
AGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCTCGGCAGAGCCCCCGCCGAGTGACATGGGCACAGTG
GGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTTGGGGTCCCCTCGGAAACGTCCAGAGCAGCAGGATGTCAGCTCACCA
GCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGGCCTCCCCCCACAGCCTGAGATACTCTGCCCCACCC
GACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCTGGCAGTGCGGCGGGCGCAGACGGCCTCCTCCATCGAGGTCGGCGTG
GGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGGTGCAGAAGCAGGCGTCCCTGCCCGTGAGTGGCAGC
GTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAGGCCTTCTCGGGCCGGCTCGCTGGGCCCCGAGACACCCAGCAGGGTG
GGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACATCAGCAGCGACAATGATTCGGAGCTCGAGGATGCT
GACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAAGGAGATCTCGGAGCTGCAGAGCCAGCAGAAGCAGGAGATCGAAGCT
CTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGGCACCCCCCACTGGCCGCCGGAGAAAAACCAGCAAG
AGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCAGCTCAAGGTCGTGGCCTCCAGCACAGGTCACTTGGCTGACTCCAGC
AGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACAGCACGGGCCTGAGCGGGAAGGCAGTGCAGACCCAG
CAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTCCGGCTTAGCCAGTGATGGAGGCGGAGCGCGTGGCCAAGGCTGGACG
GTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTGCTCGATTCCTCAGTGGACCCGTATCTGTGTCCATC
TGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAGTAGGTCCTCCACCAGCAGCCTGGCCCCAGGCCCTGAGCCAGGCCCC
CAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTACCTTCACGGACGACCTGCACAAGCTGGTGGACGAG
TGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCTCAACCAGCTGAAGCAGACCCAGAAGCTGCAAGACATGGAGGCCCAG
GCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAGTGGGGATGCCACGTCTGCCCCCAGCGCCCGGCCCT
CTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGTGCCCACACCAGGTTCCTGTGGTCCACGCGCCGTCTCCACACCCACT

>In-frame_FAM120A_ENST00000375389_chr9_96261168_+_WNK2_ENST00000297954_chr9_96030909_+_4011nt
ATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGAGCTGCAGAAGCTGGCCCGGGGCAGC
CTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAACTGCCTGCACCGCCTCTACGGCGGC
TTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGCCAAGGCCTGCTTCGGCGGCAACATC
GAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCAGGGCAACGAGCGCCAGACGGCACAG
CAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGTCTGCATGGCCCACTGCATCCGCCTG
GCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGGTTTCTGCAGAGAGAATGGTTTCCAT
GGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGCCCTAAAACTGAGCCGGAACGGGAAA
AGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCGTTTTCCTATTTTTGCTGCTCTCTTA
GGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACATCCACTAGCCTCACTAAAGGTCCGG
GCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACCTCTGACTTGGAT
GCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGATATTATTCAGCG
ACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTTCATCATCTGTCCGGTGGCTGAGCAC
CCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAGCCAAGGTCCATGCAGGGGGCTCACC
CTGCCCTGTCTCCCATGGCGCAGAGCAGCCTGTGGGGCTGTGTTCCTATCCTTGTTTTCTGCTGAATCAGCTCAGTCAAAGCAGCCTCCA
GATTCAGCGCCCTATAAAGACCAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCAGCTCCTGAGCCAGGCGGGCCCCAGC
AACCCTCCTGGGGCACCCCCAGCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAGCTCCAGCCACCAGC
ACCATGCCAGAGCCAGCGTCAGGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCTGACCAGTGAGCTCGAGACGTCTCAG
CCACTAGCGGAGACTCACGAGGCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTCCAGAGGCTGCCTCA
ACCAGGGACGCCAGTGCCCCAAGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAGCGGGACCCCACAGCCCGCCTTGGGT
CAACCTGCTCCCCTGCTTCCTGCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGGGGCCCACCGTCCCC
CCACAGCCACCCTCGGCCCTGGAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGACAGCACCATCAAGAGCCTGGACGAG
AAGCTGCGGACTCTGCTCTACCAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCGACAGAGACTTCACC
CTGGAGCCCCTGAGAGGGGACCAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCCAGTGCCTAAGGAGGCGGTCTCAGGG
CGTGTCCAGCTGCCCCAGCCCTTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCACGTCCTCGTCAATG
ACAGCAGAGTCGTCTCCCAGGAGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGACTCCCATGTGGTCCCCAGCGTCCCC
CAGGATGTACCTGCTTTTGTGAGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCTCGGCAGAGCCCCCG
CCGAGTGACATGGGCACAGTGGGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTTGGGGTCCCCTCGGAAACGTCCAGAG
CAGCAGGATGTCAGCTCACCAGCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGGCCTCCCCCCACAGC
CTGAGATACTCTGCCCCACCCGACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCTGGCAGTGCGGCGGGCGCAGACGGCC
TCCTCCATCGAGGTCGGCGTGGGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGGTGCAGAAGCAGGCG
TCCCTGCCCGTGAGTGGCAGCGTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAGGCCTTCTCGGGCCGGCTCGCTGGGC
CCCGAGACACCCAGCAGGGTGGGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACATCAGCAGCGACAAT
GATTCGGAGCTCGAGGATGCTGACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAAGGAGATCTCGGAGCTGCAGAGCCAG
CAGAAGCAGGAGATCGAAGCTCTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGGCACCCCCCACTGGC
CGCCGGAGAAAAACCAGCAAGAGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCAGCTCAAGGTCGTGGCCTCCAGCACA
GGTCACTTGGCTGACTCCAGCAGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACAGCACGGGCCTGAGC
GGGAAGGCAGTGCAGACCCAGCAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTCCGGCTTAGCCAGTGATGGAGGCGGA
GCGCGTGGCCAAGGCTGGACGGTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTGCTCGATTCCTCAGT
GGACCCGTATCTGTGTCCATCTGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAGTAGGTCCTCCACCAGCAGCCTGGCC
CCAGGCCCTGAGCCAGGCCCCCAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTACCTTCACGGACGAC
CTGCACAAGCTGGTGGACGAGTGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCTCAACCAGCTGAAGCAGACCCAGAAG
CTGCAAGACATGGAGGCCCAGGCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAGTGGGGATGCCACGT
CTGCCCCCAGCGCCCGGCCCTCTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGTGCCCACACCAGATGGCGCCCTCGGA
ACCGCCCGGAGAAACCAGGTGTGGTTTGGCCTCCGAGTCCCCCCCACCGCCTGCTGTGGGCACAGCACTCAGCCGCGAGGGGGACAGCGG

>In-frame_FAM120A_ENST00000340893_chr9_96261168_+_WNK2_ENST00000427277_chr9_96030909_+_3792nt
ATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGAGCTGCAGAAGCTGGCCCGGGGCAGC
CTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAACTGCCTGCACCGCCTCTACGGCGGC
TTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGCCAAGGCCTGCTTCGGCGGCAACATC
GAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCAGGGCAACGAGCGCCAGACGGCACAG
CAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGTCTGCATGGCCCACTGCATCCGCCTG
GCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGGTTTCTGCAGAGAGAATGGTTTCCAT
GGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGCCCTAAAACTGAGCCGGAACGGGAAA
AGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCGTTTTCCTATTTTTGCTGCTCTCTTA
GGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACATCCACTAGCCTCACTAAAGGTCCGG
GCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACCTCTGACTTGGAT
GCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGATATTATTCAGCG
ACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTTCATCATCTGTCCGGTGGCTGAGCAC
CCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAGCCAAGATTCAGCGCCCTATAAAGAC
CAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCAGCTCCTGAGCCAGGCGGGCCCCAGCAACCCTCCTGGGGCACCCCCA
GCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAGCTCCAGCCACCAGCACCATGCCAGAGCCAGCGTCA
GGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCTGACCAGTGAGCTCGAGACGTCTCAGCCACTAGCGGAGACTCACGAG
GCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTCCAGAGGCTGCCTCAACCAGGGACGCCAGTGCCCCA
AGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAGCGGGACCCCACAGCCCGCCTTGGGTCAACCTGCTCCCCTGCTTCCT
GCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGGGGCCCACCGTCCCCCCACAGCCACCCTCGGCCCTG
GAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGACAGCACCATCAAGAGCCTGGACGAGAAGCTGCGGACTCTGCTCTAC
CAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCGACAGAGACTTCACCCTGGAGCCCCTGAGAGGGGAC
CAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCCAGTGCCTAAGGAGGCGGTCTCAGGGCGTGTCCAGCTGCCCCAGCCC
TTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCACGTCCTCGTCAATGACAGCAGAGTCGTCTCCCAGG
AGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGACTCCCATGTGGTCCCCAGCGTCCCCCAGGATGTACCTGCTTTTGTG
AGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCTCGGCAGAGCCCCCGCCGAGTGACATGGGCACAGTG
GGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTTGGGGTCCCCTCGGAAACGTCCAGAGCAGCAGGATGTCAGCTCACCA
GCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGGCCTCCCCCCACAGCCTGAGATACTCTGCCCCACCC
GACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCTGGCAGTGCGGCGGGCGCAGACGGCCTCCTCCATCGAGGTCGGCGTG
GGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGGTGCAGAAGCAGGCGTCCCTGCCCGTGAGTGGCAGC
GTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAGGCCTTCTCGGGCCGGCTCGCTGGGCCCCGAGACACCCAGCAGGGTG
GGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACATCAGCAGCGACAATGATTCGGAGCTCGAGGATGCT
GACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAAGGAGATCTCGGAGCTGCAGAGCCAGCAGAAGCAGGAGATCGAAGCT
CTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGGCACCCCCCACTGGCCGCCGGAGAAAAACCAGCAAG
AGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCAGCTCAAGGTCGTGGCCTCCAGCACAGGTCACTTGGCTGACTCCAGC
AGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACAGCACGGGCCTGAGCGGGAAGGCAGTGCAGACCCAG
CAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTCCGGCTTAGCCAGTGATGGAGGCGGAGCGCGTGGCCAAGGCTGGACG
GTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTGCTCGATTCCTCAGTGGACCCGTATCTGTGTCCATC
TGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAGTAGGTCCTCCACCAGCAGCCTGGCCCCAGGCCCTGAGCCAGGCCCC
CAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTACCTTCACGGACGACCTGCACAAGCTGGTGGACGAG
TGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCTCAACCAGCTGAAGCAGACCCAGAAGCTGCAAGACATGGAGGCCCAG
GCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAGTGGGGATGCCACGTCTGCCCCCAGCGCCCGGCCCT
CTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGTGCCCACACCAGGTTCCTGTGGTCCACGCGCCGTCTCCACACCCACT

>In-frame_FAM120A_ENST00000340893_chr9_96261168_+_WNK2_ENST00000297954_chr9_96030909_+_4011nt
ATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGAGCTGCAGAAGCTGGCCCGGGGCAGC
CTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAACTGCCTGCACCGCCTCTACGGCGGC
TTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGCCAAGGCCTGCTTCGGCGGCAACATC
GAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCAGGGCAACGAGCGCCAGACGGCACAG
CAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGTCTGCATGGCCCACTGCATCCGCCTG
GCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGGTTTCTGCAGAGAGAATGGTTTCCAT
GGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGCCCTAAAACTGAGCCGGAACGGGAAA
AGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCGTTTTCCTATTTTTGCTGCTCTCTTA
GGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACATCCACTAGCCTCACTAAAGGTCCGG
GCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACCTCTGACTTGGAT
GCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGATATTATTCAGCG
ACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTTCATCATCTGTCCGGTGGCTGAGCAC
CCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAGCCAAGGTCCATGCAGGGGGCTCACC
CTGCCCTGTCTCCCATGGCGCAGAGCAGCCTGTGGGGCTGTGTTCCTATCCTTGTTTTCTGCTGAATCAGCTCAGTCAAAGCAGCCTCCA
GATTCAGCGCCCTATAAAGACCAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCAGCTCCTGAGCCAGGCGGGCCCCAGC
AACCCTCCTGGGGCACCCCCAGCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAGCTCCAGCCACCAGC
ACCATGCCAGAGCCAGCGTCAGGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCTGACCAGTGAGCTCGAGACGTCTCAG
CCACTAGCGGAGACTCACGAGGCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTCCAGAGGCTGCCTCA
ACCAGGGACGCCAGTGCCCCAAGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAGCGGGACCCCACAGCCCGCCTTGGGT
CAACCTGCTCCCCTGCTTCCTGCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGGGGCCCACCGTCCCC
CCACAGCCACCCTCGGCCCTGGAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGACAGCACCATCAAGAGCCTGGACGAG
AAGCTGCGGACTCTGCTCTACCAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCGACAGAGACTTCACC
CTGGAGCCCCTGAGAGGGGACCAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCCAGTGCCTAAGGAGGCGGTCTCAGGG
CGTGTCCAGCTGCCCCAGCCCTTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCACGTCCTCGTCAATG
ACAGCAGAGTCGTCTCCCAGGAGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGACTCCCATGTGGTCCCCAGCGTCCCC
CAGGATGTACCTGCTTTTGTGAGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCTCGGCAGAGCCCCCG
CCGAGTGACATGGGCACAGTGGGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTTGGGGTCCCCTCGGAAACGTCCAGAG
CAGCAGGATGTCAGCTCACCAGCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGGCCTCCCCCCACAGC
CTGAGATACTCTGCCCCACCCGACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCTGGCAGTGCGGCGGGCGCAGACGGCC
TCCTCCATCGAGGTCGGCGTGGGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGGTGCAGAAGCAGGCG
TCCCTGCCCGTGAGTGGCAGCGTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAGGCCTTCTCGGGCCGGCTCGCTGGGC
CCCGAGACACCCAGCAGGGTGGGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACATCAGCAGCGACAAT
GATTCGGAGCTCGAGGATGCTGACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAAGGAGATCTCGGAGCTGCAGAGCCAG
CAGAAGCAGGAGATCGAAGCTCTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGGCACCCCCCACTGGC
CGCCGGAGAAAAACCAGCAAGAGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCAGCTCAAGGTCGTGGCCTCCAGCACA
GGTCACTTGGCTGACTCCAGCAGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACAGCACGGGCCTGAGC
GGGAAGGCAGTGCAGACCCAGCAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTCCGGCTTAGCCAGTGATGGAGGCGGA
GCGCGTGGCCAAGGCTGGACGGTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTGCTCGATTCCTCAGT
GGACCCGTATCTGTGTCCATCTGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAGTAGGTCCTCCACCAGCAGCCTGGCC
CCAGGCCCTGAGCCAGGCCCCCAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTACCTTCACGGACGAC
CTGCACAAGCTGGTGGACGAGTGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCTCAACCAGCTGAAGCAGACCCAGAAG
CTGCAAGACATGGAGGCCCAGGCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAGTGGGGATGCCACGT
CTGCCCCCAGCGCCCGGCCCTCTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGTGCCCACACCAGATGGCGCCCTCGGA
ACCGCCCGGAGAAACCAGGTGTGGTTTGGCCTCCGAGTCCCCCCCACCGCCTGCTGTGGGCACAGCACTCAGCCGCGAGGGGGACAGCGG

>In-frame_FAM120A_ENST00000333936_chr9_96261168_+_WNK2_ENST00000427277_chr9_96030909_+_3792nt
ATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGAGCTGCAGAAGCTGGCCCGGGGCAGC
CTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAACTGCCTGCACCGCCTCTACGGCGGC
TTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGCCAAGGCCTGCTTCGGCGGCAACATC
GAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCAGGGCAACGAGCGCCAGACGGCACAG
CAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGTCTGCATGGCCCACTGCATCCGCCTG
GCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGGTTTCTGCAGAGAGAATGGTTTCCAT
GGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGCCCTAAAACTGAGCCGGAACGGGAAA
AGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCGTTTTCCTATTTTTGCTGCTCTCTTA
GGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACATCCACTAGCCTCACTAAAGGTCCGG
GCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACCTCTGACTTGGAT
GCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGATATTATTCAGCG
ACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTTCATCATCTGTCCGGTGGCTGAGCAC
CCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAGCCAAGATTCAGCGCCCTATAAAGAC
CAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCAGCTCCTGAGCCAGGCGGGCCCCAGCAACCCTCCTGGGGCACCCCCA
GCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAGCTCCAGCCACCAGCACCATGCCAGAGCCAGCGTCA
GGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCTGACCAGTGAGCTCGAGACGTCTCAGCCACTAGCGGAGACTCACGAG
GCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTCCAGAGGCTGCCTCAACCAGGGACGCCAGTGCCCCA
AGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAGCGGGACCCCACAGCCCGCCTTGGGTCAACCTGCTCCCCTGCTTCCT
GCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGGGGCCCACCGTCCCCCCACAGCCACCCTCGGCCCTG
GAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGACAGCACCATCAAGAGCCTGGACGAGAAGCTGCGGACTCTGCTCTAC
CAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCGACAGAGACTTCACCCTGGAGCCCCTGAGAGGGGAC
CAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCCAGTGCCTAAGGAGGCGGTCTCAGGGCGTGTCCAGCTGCCCCAGCCC
TTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCACGTCCTCGTCAATGACAGCAGAGTCGTCTCCCAGG
AGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGACTCCCATGTGGTCCCCAGCGTCCCCCAGGATGTACCTGCTTTTGTG
AGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCTCGGCAGAGCCCCCGCCGAGTGACATGGGCACAGTG
GGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTTGGGGTCCCCTCGGAAACGTCCAGAGCAGCAGGATGTCAGCTCACCA
GCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGGCCTCCCCCCACAGCCTGAGATACTCTGCCCCACCC
GACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCTGGCAGTGCGGCGGGCGCAGACGGCCTCCTCCATCGAGGTCGGCGTG
GGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGGTGCAGAAGCAGGCGTCCCTGCCCGTGAGTGGCAGC
GTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAGGCCTTCTCGGGCCGGCTCGCTGGGCCCCGAGACACCCAGCAGGGTG
GGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACATCAGCAGCGACAATGATTCGGAGCTCGAGGATGCT
GACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAAGGAGATCTCGGAGCTGCAGAGCCAGCAGAAGCAGGAGATCGAAGCT
CTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGGCACCCCCCACTGGCCGCCGGAGAAAAACCAGCAAG
AGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCAGCTCAAGGTCGTGGCCTCCAGCACAGGTCACTTGGCTGACTCCAGC
AGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACAGCACGGGCCTGAGCGGGAAGGCAGTGCAGACCCAG
CAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTCCGGCTTAGCCAGTGATGGAGGCGGAGCGCGTGGCCAAGGCTGGACG
GTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTGCTCGATTCCTCAGTGGACCCGTATCTGTGTCCATC
TGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAGTAGGTCCTCCACCAGCAGCCTGGCCCCAGGCCCTGAGCCAGGCCCC
CAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTACCTTCACGGACGACCTGCACAAGCTGGTGGACGAG
TGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCTCAACCAGCTGAAGCAGACCCAGAAGCTGCAAGACATGGAGGCCCAG
GCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAGTGGGGATGCCACGTCTGCCCCCAGCGCCCGGCCCT
CTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGTGCCCACACCAGGTTCCTGTGGTCCACGCGCCGTCTCCACACCCACT

>In-frame_FAM120A_ENST00000333936_chr9_96261168_+_WNK2_ENST00000297954_chr9_96030909_+_4011nt
ATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGAGCTGCAGAAGCTGGCCCGGGGCAGC
CTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAACTGCCTGCACCGCCTCTACGGCGGC
TTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGCCAAGGCCTGCTTCGGCGGCAACATC
GAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCAGGGCAACGAGCGCCAGACGGCACAG
CAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGTCTGCATGGCCCACTGCATCCGCCTG
GCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGGTTTCTGCAGAGAGAATGGTTTCCAT
GGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGCCCTAAAACTGAGCCGGAACGGGAAA
AGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCGTTTTCCTATTTTTGCTGCTCTCTTA
GGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACATCCACTAGCCTCACTAAAGGTCCGG
GCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACCTCTGACTTGGAT
GCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGATATTATTCAGCG
ACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTTCATCATCTGTCCGGTGGCTGAGCAC
CCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAGCCAAGGTCCATGCAGGGGGCTCACC
CTGCCCTGTCTCCCATGGCGCAGAGCAGCCTGTGGGGCTGTGTTCCTATCCTTGTTTTCTGCTGAATCAGCTCAGTCAAAGCAGCCTCCA
GATTCAGCGCCCTATAAAGACCAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCAGCTCCTGAGCCAGGCGGGCCCCAGC
AACCCTCCTGGGGCACCCCCAGCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAGCTCCAGCCACCAGC
ACCATGCCAGAGCCAGCGTCAGGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCTGACCAGTGAGCTCGAGACGTCTCAG
CCACTAGCGGAGACTCACGAGGCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTCCAGAGGCTGCCTCA
ACCAGGGACGCCAGTGCCCCAAGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAGCGGGACCCCACAGCCCGCCTTGGGT
CAACCTGCTCCCCTGCTTCCTGCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGGGGCCCACCGTCCCC
CCACAGCCACCCTCGGCCCTGGAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGACAGCACCATCAAGAGCCTGGACGAG
AAGCTGCGGACTCTGCTCTACCAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCGACAGAGACTTCACC
CTGGAGCCCCTGAGAGGGGACCAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCCAGTGCCTAAGGAGGCGGTCTCAGGG
CGTGTCCAGCTGCCCCAGCCCTTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCACGTCCTCGTCAATG
ACAGCAGAGTCGTCTCCCAGGAGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGACTCCCATGTGGTCCCCAGCGTCCCC
CAGGATGTACCTGCTTTTGTGAGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCTCGGCAGAGCCCCCG
CCGAGTGACATGGGCACAGTGGGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTTGGGGTCCCCTCGGAAACGTCCAGAG
CAGCAGGATGTCAGCTCACCAGCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGGCCTCCCCCCACAGC
CTGAGATACTCTGCCCCACCCGACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCTGGCAGTGCGGCGGGCGCAGACGGCC
TCCTCCATCGAGGTCGGCGTGGGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGGTGCAGAAGCAGGCG
TCCCTGCCCGTGAGTGGCAGCGTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAGGCCTTCTCGGGCCGGCTCGCTGGGC
CCCGAGACACCCAGCAGGGTGGGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACATCAGCAGCGACAAT
GATTCGGAGCTCGAGGATGCTGACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAAGGAGATCTCGGAGCTGCAGAGCCAG
CAGAAGCAGGAGATCGAAGCTCTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGGCACCCCCCACTGGC
CGCCGGAGAAAAACCAGCAAGAGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCAGCTCAAGGTCGTGGCCTCCAGCACA
GGTCACTTGGCTGACTCCAGCAGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACAGCACGGGCCTGAGC
GGGAAGGCAGTGCAGACCCAGCAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTCCGGCTTAGCCAGTGATGGAGGCGGA
GCGCGTGGCCAAGGCTGGACGGTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTGCTCGATTCCTCAGT
GGACCCGTATCTGTGTCCATCTGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAGTAGGTCCTCCACCAGCAGCCTGGCC
CCAGGCCCTGAGCCAGGCCCCCAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTACCTTCACGGACGAC
CTGCACAAGCTGGTGGACGAGTGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCTCAACCAGCTGAAGCAGACCCAGAAG
CTGCAAGACATGGAGGCCCAGGCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAGTGGGGATGCCACGT
CTGCCCCCAGCGCCCGGCCCTCTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGTGCCCACACCAGATGGCGCCCTCGGA
ACCGCCCGGAGAAACCAGGTGTGGTTTGGCCTCCGAGTCCCCCCCACCGCCTGCTGTGGGCACAGCACTCAGCCGCGAGGGGGACAGCGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_FAM120A_ENST00000277165_chr9_96261168_+_WNK2_ENST00000427277_chr9_96030909_+_3986nt
GTCCCTCCCCAGACATGGCCCTGGGAGGCGGCAGCACATGGCGGCCGCGGCGGCCATGAGCGCGCCCCCGACCCGCCCCAGTCCCCCCTA
GAGGCCGCCGCCCCCGCCCGCCAGCCCGCCCGCGCGCCACGGCCCCACCACCCCCGGCCCCGCCGCCCCCCGCCCGCACCCGCGCCCGCG
CCCCCGCCGCCGCCATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGAGCTGCAGAAGC
TGGCCCGGGGCAGCCTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAACTGCCTGCACC
GCCTCTACGGCGGCTTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGCCAAGGCCTGCT
TCGGCGGCAACATCGAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCAGGGCAACGAGC
GCCAGACGGCACAGCAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGTCTGCATGGCCC
ACTGCATCCGCCTGGCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGGTTTCTGCAGAG
AGAATGGTTTCCATGGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGCCCTAAAACTGA
GCCGGAACGGGAAAAGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCGTTTTCCTATTT
TTGCTGCTCTCTTAGGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACATCCACTAGCCT
CACTAAAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACA
CCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTG
GATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTTCATCATCTGTC
CGGTGGCTGAGCACCCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAGCCAAGATTCAG
CGCCCTATAAAGACCAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCAGCTCCTGAGCCAGGCGGGCCCCAGCAACCCTC
CTGGGGCACCCCCAGCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAGCTCCAGCCACCAGCACCATGC
CAGAGCCAGCGTCAGGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCTGACCAGTGAGCTCGAGACGTCTCAGCCACTAG
CGGAGACTCACGAGGCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTCCAGAGGCTGCCTCAACCAGGG
ACGCCAGTGCCCCAAGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAGCGGGACCCCACAGCCCGCCTTGGGTCAACCTG
CTCCCCTGCTTCCTGCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGGGGCCCACCGTCCCCCCACAGC
CACCCTCGGCCCTGGAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGACAGCACCATCAAGAGCCTGGACGAGAAGCTGC
GGACTCTGCTCTACCAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCGACAGAGACTTCACCCTGGAGC
CCCTGAGAGGGGACCAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCCAGTGCCTAAGGAGGCGGTCTCAGGGCGTGTCC
AGCTGCCCCAGCCCTTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCACGTCCTCGTCAATGACAGCAG
AGTCGTCTCCCAGGAGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGACTCCCATGTGGTCCCCAGCGTCCCCCAGGATG
TACCTGCTTTTGTGAGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCTCGGCAGAGCCCCCGCCGAGTG
ACATGGGCACAGTGGGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTTGGGGTCCCCTCGGAAACGTCCAGAGCAGCAGG
ATGTCAGCTCACCAGCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGGCCTCCCCCCACAGCCTGAGAT
ACTCTGCCCCACCCGACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCTGGCAGTGCGGCGGGCGCAGACGGCCTCCTCCA
TCGAGGTCGGCGTGGGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGGTGCAGAAGCAGGCGTCCCTGC
CCGTGAGTGGCAGCGTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAGGCCTTCTCGGGCCGGCTCGCTGGGCCCCGAGA
CACCCAGCAGGGTGGGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACATCAGCAGCGACAATGATTCGG
AGCTCGAGGATGCTGACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAAGGAGATCTCGGAGCTGCAGAGCCAGCAGAAGC
AGGAGATCGAAGCTCTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGGCACCCCCCACTGGCCGCCGGA
GAAAAACCAGCAAGAGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCAGCTCAAGGTCGTGGCCTCCAGCACAGGTCACT
TGGCTGACTCCAGCAGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACAGCACGGGCCTGAGCGGGAAGG
CAGTGCAGACCCAGCAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTCCGGCTTAGCCAGTGATGGAGGCGGAGCGCGTG
GCCAAGGCTGGACGGTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTGCTCGATTCCTCAGTGGACCCG
TATCTGTGTCCATCTGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAGTAGGTCCTCCACCAGCAGCCTGGCCCCAGGCC
CTGAGCCAGGCCCCCAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTACCTTCACGGACGACCTGCACA
AGCTGGTGGACGAGTGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCTCAACCAGCTGAAGCAGACCCAGAAGCTGCAAG
ACATGGAGGCCCAGGCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAGTGGGGATGCCACGTCTGCCCC
CAGCGCCCGGCCCTCTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGTGCCCACACCAGGTTCCTGTGGTCCACGCGCCG

>In-frame_FAM120A_ENST00000277165_chr9_96261168_+_WNK2_ENST00000297954_chr9_96030909_+_4449nt
GTCCCTCCCCAGACATGGCCCTGGGAGGCGGCAGCACATGGCGGCCGCGGCGGCCATGAGCGCGCCCCCGACCCGCCCCAGTCCCCCCTA
GAGGCCGCCGCCCCCGCCCGCCAGCCCGCCCGCGCGCCACGGCCCCACCACCCCCGGCCCCGCCGCCCCCCGCCCGCACCCGCGCCCGCG
CCCCCGCCGCCGCCATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGAGCTGCAGAAGC
TGGCCCGGGGCAGCCTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAACTGCCTGCACC
GCCTCTACGGCGGCTTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGCCAAGGCCTGCT
TCGGCGGCAACATCGAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCAGGGCAACGAGC
GCCAGACGGCACAGCAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGTCTGCATGGCCC
ACTGCATCCGCCTGGCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGGTTTCTGCAGAG
AGAATGGTTTCCATGGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGCCCTAAAACTGA
GCCGGAACGGGAAAAGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCGTTTTCCTATTT
TTGCTGCTCTCTTAGGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACATCCACTAGCCT
CACTAAAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACA
CCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTG
GATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTTCATCATCTGTC
CGGTGGCTGAGCACCCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAGCCAAGGTCCAT
GCAGGGGGCTCACCCTGCCCTGTCTCCCATGGCGCAGAGCAGCCTGTGGGGCTGTGTTCCTATCCTTGTTTTCTGCTGAATCAGCTCAGT
CAAAGCAGCCTCCAGATTCAGCGCCCTATAAAGACCAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCAGCTCCTGAGCC
AGGCGGGCCCCAGCAACCCTCCTGGGGCACCCCCAGCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAG
CTCCAGCCACCAGCACCATGCCAGAGCCAGCGTCAGGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCTGACCAGTGAGC
TCGAGACGTCTCAGCCACTAGCGGAGACTCACGAGGCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTC
CAGAGGCTGCCTCAACCAGGGACGCCAGTGCCCCAAGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAGCGGGACCCCAC
AGCCCGCCTTGGGTCAACCTGCTCCCCTGCTTCCTGCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGG
GGCCCACCGTCCCCCCACAGCCACCCTCGGCCCTGGAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGACAGCACCATCA
AGAGCCTGGACGAGAAGCTGCGGACTCTGCTCTACCAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCG
ACAGAGACTTCACCCTGGAGCCCCTGAGAGGGGACCAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCCAGTGCCTAAGG
AGGCGGTCTCAGGGCGTGTCCAGCTGCCCCAGCCCTTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCA
CGTCCTCGTCAATGACAGCAGAGTCGTCTCCCAGGAGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGACTCCCATGTGG
TCCCCAGCGTCCCCCAGGATGTACCTGCTTTTGTGAGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCT
CGGCAGAGCCCCCGCCGAGTGACATGGGCACAGTGGGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTTGGGGTCCCCTC
GGAAACGTCCAGAGCAGCAGGATGTCAGCTCACCAGCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGG
CCTCCCCCCACAGCCTGAGATACTCTGCCCCACCCGACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCTGGCAGTGCGGC
GGGCGCAGACGGCCTCCTCCATCGAGGTCGGCGTGGGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGG
TGCAGAAGCAGGCGTCCCTGCCCGTGAGTGGCAGCGTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAGGCCTTCTCGGG
CCGGCTCGCTGGGCCCCGAGACACCCAGCAGGGTGGGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACA
TCAGCAGCGACAATGATTCGGAGCTCGAGGATGCTGACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAAGGAGATCTCGG
AGCTGCAGAGCCAGCAGAAGCAGGAGATCGAAGCTCTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGG
CACCCCCCACTGGCCGCCGGAGAAAAACCAGCAAGAGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCAGCTCAAGGTCG
TGGCCTCCAGCACAGGTCACTTGGCTGACTCCAGCAGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACA
GCACGGGCCTGAGCGGGAAGGCAGTGCAGACCCAGCAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTCCGGCTTAGCCA
GTGATGGAGGCGGAGCGCGTGGCCAAGGCTGGACGGTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTG
CTCGATTCCTCAGTGGACCCGTATCTGTGTCCATCTGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAGTAGGTCCTCCA
CCAGCAGCCTGGCCCCAGGCCCTGAGCCAGGCCCCCAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTA
CCTTCACGGACGACCTGCACAAGCTGGTGGACGAGTGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCTCAACCAGCTGA
AGCAGACCCAGAAGCTGCAAGACATGGAGGCCCAGGCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAG
TGGGGATGCCACGTCTGCCCCCAGCGCCCGGCCCTCTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGTGCCCACACCAG
ATGGCGCCCTCGGAACCGCCCGGAGAAACCAGGTGTGGTTTGGCCTCCGAGTCCCCCCCACCGCCTGCTGTGGGCACAGCACTCAGCCGC
GAGGGGGACAGCGGGTGGGCAGCAAGACTGCTTCCTTTGCGGCTTCAGACCCTGTTCGCTCCTAGGTTCCTGTGGTCCACGCGCCGTCTC
CACACCCACTTCCTATACTTGAGTTGATGGTTAGAACCTTGTCGTCACCCTGCAGAAGTACAGTGCCTTGAATGCCAGCTTTTCCGTTCC
CTGATGAAAAGATATGTTAAAAAAAATTATCGGAAAAGGTTTCATTTGCAATTGGCTTGTGCATTGATAATCTTTATTTACTGTTTTAAG

>In-frame_FAM120A_ENST00000375389_chr9_96261168_+_WNK2_ENST00000427277_chr9_96030909_+_3817nt
CCGCGCCCGCGCCCCCGCCGCCGCCATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGA
GCTGCAGAAGCTGGCCCGGGGCAGCCTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAA
CTGCCTGCACCGCCTCTACGGCGGCTTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGC
CAAGGCCTGCTTCGGCGGCAACATCGAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCA
GGGCAACGAGCGCCAGACGGCACAGCAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGT
CTGCATGGCCCACTGCATCCGCCTGGCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGG
TTTCTGCAGAGAGAATGGTTTCCATGGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGC
CCTAAAACTGAGCCGGAACGGGAAAAGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCG
TTTTCCTATTTTTGCTGCTCTCTTAGGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACA
TCCACTAGCCTCACTAAAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAA
CATTCAGGACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAA
GAGAGCAATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTT
CATCATCTGTCCGGTGGCTGAGCACCCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAG
CCAAGATTCAGCGCCCTATAAAGACCAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCAGCTCCTGAGCCAGGCGGGCCC
CAGCAACCCTCCTGGGGCACCCCCAGCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAGCTCCAGCCAC
CAGCACCATGCCAGAGCCAGCGTCAGGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCTGACCAGTGAGCTCGAGACGTC
TCAGCCACTAGCGGAGACTCACGAGGCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTCCAGAGGCTGC
CTCAACCAGGGACGCCAGTGCCCCAAGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAGCGGGACCCCACAGCCCGCCTT
GGGTCAACCTGCTCCCCTGCTTCCTGCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGGGGCCCACCGT
CCCCCCACAGCCACCCTCGGCCCTGGAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGACAGCACCATCAAGAGCCTGGA
CGAGAAGCTGCGGACTCTGCTCTACCAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCGACAGAGACTT
CACCCTGGAGCCCCTGAGAGGGGACCAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCCAGTGCCTAAGGAGGCGGTCTC
AGGGCGTGTCCAGCTGCCCCAGCCCTTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCACGTCCTCGTC
AATGACAGCAGAGTCGTCTCCCAGGAGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGACTCCCATGTGGTCCCCAGCGT
CCCCCAGGATGTACCTGCTTTTGTGAGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCTCGGCAGAGCC
CCCGCCGAGTGACATGGGCACAGTGGGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTTGGGGTCCCCTCGGAAACGTCC
AGAGCAGCAGGATGTCAGCTCACCAGCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGGCCTCCCCCCA
CAGCCTGAGATACTCTGCCCCACCCGACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCTGGCAGTGCGGCGGGCGCAGAC
GGCCTCCTCCATCGAGGTCGGCGTGGGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGGTGCAGAAGCA
GGCGTCCCTGCCCGTGAGTGGCAGCGTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAGGCCTTCTCGGGCCGGCTCGCT
GGGCCCCGAGACACCCAGCAGGGTGGGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACATCAGCAGCGA
CAATGATTCGGAGCTCGAGGATGCTGACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAAGGAGATCTCGGAGCTGCAGAG
CCAGCAGAAGCAGGAGATCGAAGCTCTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGGCACCCCCCAC
TGGCCGCCGGAGAAAAACCAGCAAGAGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCAGCTCAAGGTCGTGGCCTCCAG
CACAGGTCACTTGGCTGACTCCAGCAGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACAGCACGGGCCT
GAGCGGGAAGGCAGTGCAGACCCAGCAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTCCGGCTTAGCCAGTGATGGAGG
CGGAGCGCGTGGCCAAGGCTGGACGGTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTGCTCGATTCCT
CAGTGGACCCGTATCTGTGTCCATCTGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAGTAGGTCCTCCACCAGCAGCCT
GGCCCCAGGCCCTGAGCCAGGCCCCCAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTACCTTCACGGA
CGACCTGCACAAGCTGGTGGACGAGTGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCTCAACCAGCTGAAGCAGACCCA
GAAGCTGCAAGACATGGAGGCCCAGGCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAGTGGGGATGCC
ACGTCTGCCCCCAGCGCCCGGCCCTCTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGTGCCCACACCAGGTTCCTGTGG

>In-frame_FAM120A_ENST00000375389_chr9_96261168_+_WNK2_ENST00000297954_chr9_96030909_+_4280nt
CCGCGCCCGCGCCCCCGCCGCCGCCATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGA
GCTGCAGAAGCTGGCCCGGGGCAGCCTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAA
CTGCCTGCACCGCCTCTACGGCGGCTTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGC
CAAGGCCTGCTTCGGCGGCAACATCGAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCA
GGGCAACGAGCGCCAGACGGCACAGCAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGT
CTGCATGGCCCACTGCATCCGCCTGGCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGG
TTTCTGCAGAGAGAATGGTTTCCATGGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGC
CCTAAAACTGAGCCGGAACGGGAAAAGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCG
TTTTCCTATTTTTGCTGCTCTCTTAGGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACA
TCCACTAGCCTCACTAAAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAA
CATTCAGGACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAA
GAGAGCAATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTT
CATCATCTGTCCGGTGGCTGAGCACCCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAG
CCAAGGTCCATGCAGGGGGCTCACCCTGCCCTGTCTCCCATGGCGCAGAGCAGCCTGTGGGGCTGTGTTCCTATCCTTGTTTTCTGCTGA
ATCAGCTCAGTCAAAGCAGCCTCCAGATTCAGCGCCCTATAAAGACCAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCA
GCTCCTGAGCCAGGCGGGCCCCAGCAACCCTCCTGGGGCACCCCCAGCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCA
AGATGGAGCAGCTCCAGCCACCAGCACCATGCCAGAGCCAGCGTCAGGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCT
GACCAGTGAGCTCGAGACGTCTCAGCCACTAGCGGAGACTCACGAGGCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTG
CACTCCAGCTCCAGAGGCTGCCTCAACCAGGGACGCCAGTGCCCCAAGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAG
CGGGACCCCACAGCCCGCCTTGGGTCAACCTGCTCCCCTGCTTCCTGCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAG
CCCACCCCTGGGGCCCACCGTCCCCCCACAGCCACCCTCGGCCCTGGAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGA
CAGCACCATCAAGAGCCTGGACGAGAAGCTGCGGACTCTGCTCTACCAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGT
GGAGGTGGGCGACAGAGACTTCACCCTGGAGCCCCTGAGAGGGGACCAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCC
AGTGCCTAAGGAGGCGGTCTCAGGGCGTGTCCAGCTGCCCCAGCCCTTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGAT
GGAGCAGGGCACGTCCTCGTCAATGACAGCAGAGTCGTCTCCCAGGAGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGA
CTCCCATGTGGTCCCCAGCGTCCCCCAGGATGTACCTGCTTTTGTGAGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGC
TGGAGAAAGCTCGGCAGAGCCCCCGCCGAGTGACATGGGCACAGTGGGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTT
GGGGTCCCCTCGGAAACGTCCAGAGCAGCAGGATGTCAGCTCACCAGCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGA
GTGGACCCTGGCCTCCCCCCACAGCCTGAGATACTCTGCCCCACCCGACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCT
GGCAGTGCGGCGGGCGCAGACGGCCTCCTCCATCGAGGTCGGCGTGGGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGC
GAGACCCCCGGTGCAGAAGCAGGCGTCCCTGCCCGTGAGTGGCAGCGTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAG
GCCTTCTCGGGCCGGCTCGCTGGGCCCCGAGACACCCAGCAGGGTGGGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCA
GTCGTCCTACATCAGCAGCGACAATGATTCGGAGCTCGAGGATGCTGACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAA
GGAGATCTCGGAGCTGCAGAGCCAGCAGAAGCAGGAGATCGAAGCTCTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTT
CTTCCACACGGCACCCCCCACTGGCCGCCGGAGAAAAACCAGCAAGAGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCA
GCTCAAGGTCGTGGCCTCCAGCACAGGTCACTTGGCTGACTCCAGCAGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCT
CACTGCAGACAGCACGGGCCTGAGCGGGAAGGCAGTGCAGACCCAGCAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTC
CGGCTTAGCCAGTGATGGAGGCGGAGCGCGTGGCCAAGGCTGGACGGTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAG
CAAACCTCGTGCTCGATTCCTCAGTGGACCCGTATCTGTGTCCATCTGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAG
TAGGTCCTCCACCAGCAGCCTGGCCCCAGGCCCTGAGCCAGGCCCCCAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAA
CAAGAAGGGTACCTTCACGGACGACCTGCACAAGCTGGTGGACGAGTGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCT
CAACCAGCTGAAGCAGACCCAGAAGCTGCAAGACATGGAGGCCCAGGCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACC
TCGAGCAGGAGTGGGGATGCCACGTCTGCCCCCAGCGCCCGGCCCTCTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGT
GCCCACACCAGATGGCGCCCTCGGAACCGCCCGGAGAAACCAGGTGTGGTTTGGCCTCCGAGTCCCCCCCACCGCCTGCTGTGGGCACAG
CACTCAGCCGCGAGGGGGACAGCGGGTGGGCAGCAAGACTGCTTCCTTTGCGGCTTCAGACCCTGTTCGCTCCTAGGTTCCTGTGGTCCA
CGCGCCGTCTCCACACCCACTTCCTATACTTGAGTTGATGGTTAGAACCTTGTCGTCACCCTGCAGAAGTACAGTGCCTTGAATGCCAGC
TTTTCCGTTCCCTGATGAAAAGATATGTTAAAAAAAATTATCGGAAAAGGTTTCATTTGCAATTGGCTTGTGCATTGATAATCTTTATTT

>In-frame_FAM120A_ENST00000340893_chr9_96261168_+_WNK2_ENST00000427277_chr9_96030909_+_3817nt
CCGCGCCCGCGCCCCCGCCGCCGCCATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGA
GCTGCAGAAGCTGGCCCGGGGCAGCCTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAA
CTGCCTGCACCGCCTCTACGGCGGCTTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGC
CAAGGCCTGCTTCGGCGGCAACATCGAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCA
GGGCAACGAGCGCCAGACGGCACAGCAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGT
CTGCATGGCCCACTGCATCCGCCTGGCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGG
TTTCTGCAGAGAGAATGGTTTCCATGGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGC
CCTAAAACTGAGCCGGAACGGGAAAAGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCG
TTTTCCTATTTTTGCTGCTCTCTTAGGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACA
TCCACTAGCCTCACTAAAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAA
CATTCAGGACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAA
GAGAGCAATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTT
CATCATCTGTCCGGTGGCTGAGCACCCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAG
CCAAGATTCAGCGCCCTATAAAGACCAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCAGCTCCTGAGCCAGGCGGGCCC
CAGCAACCCTCCTGGGGCACCCCCAGCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAGCTCCAGCCAC
CAGCACCATGCCAGAGCCAGCGTCAGGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCTGACCAGTGAGCTCGAGACGTC
TCAGCCACTAGCGGAGACTCACGAGGCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTCCAGAGGCTGC
CTCAACCAGGGACGCCAGTGCCCCAAGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAGCGGGACCCCACAGCCCGCCTT
GGGTCAACCTGCTCCCCTGCTTCCTGCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGGGGCCCACCGT
CCCCCCACAGCCACCCTCGGCCCTGGAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGACAGCACCATCAAGAGCCTGGA
CGAGAAGCTGCGGACTCTGCTCTACCAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCGACAGAGACTT
CACCCTGGAGCCCCTGAGAGGGGACCAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCCAGTGCCTAAGGAGGCGGTCTC
AGGGCGTGTCCAGCTGCCCCAGCCCTTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCACGTCCTCGTC
AATGACAGCAGAGTCGTCTCCCAGGAGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGACTCCCATGTGGTCCCCAGCGT
CCCCCAGGATGTACCTGCTTTTGTGAGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCTCGGCAGAGCC
CCCGCCGAGTGACATGGGCACAGTGGGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTTGGGGTCCCCTCGGAAACGTCC
AGAGCAGCAGGATGTCAGCTCACCAGCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGGCCTCCCCCCA
CAGCCTGAGATACTCTGCCCCACCCGACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCTGGCAGTGCGGCGGGCGCAGAC
GGCCTCCTCCATCGAGGTCGGCGTGGGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGGTGCAGAAGCA
GGCGTCCCTGCCCGTGAGTGGCAGCGTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAGGCCTTCTCGGGCCGGCTCGCT
GGGCCCCGAGACACCCAGCAGGGTGGGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACATCAGCAGCGA
CAATGATTCGGAGCTCGAGGATGCTGACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAAGGAGATCTCGGAGCTGCAGAG
CCAGCAGAAGCAGGAGATCGAAGCTCTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGGCACCCCCCAC
TGGCCGCCGGAGAAAAACCAGCAAGAGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCAGCTCAAGGTCGTGGCCTCCAG
CACAGGTCACTTGGCTGACTCCAGCAGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACAGCACGGGCCT
GAGCGGGAAGGCAGTGCAGACCCAGCAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTCCGGCTTAGCCAGTGATGGAGG
CGGAGCGCGTGGCCAAGGCTGGACGGTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTGCTCGATTCCT
CAGTGGACCCGTATCTGTGTCCATCTGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAGTAGGTCCTCCACCAGCAGCCT
GGCCCCAGGCCCTGAGCCAGGCCCCCAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTACCTTCACGGA
CGACCTGCACAAGCTGGTGGACGAGTGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCTCAACCAGCTGAAGCAGACCCA
GAAGCTGCAAGACATGGAGGCCCAGGCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAGTGGGGATGCC
ACGTCTGCCCCCAGCGCCCGGCCCTCTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGTGCCCACACCAGGTTCCTGTGG

>In-frame_FAM120A_ENST00000340893_chr9_96261168_+_WNK2_ENST00000297954_chr9_96030909_+_4280nt
CCGCGCCCGCGCCCCCGCCGCCGCCATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGA
GCTGCAGAAGCTGGCCCGGGGCAGCCTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAA
CTGCCTGCACCGCCTCTACGGCGGCTTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGC
CAAGGCCTGCTTCGGCGGCAACATCGAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCA
GGGCAACGAGCGCCAGACGGCACAGCAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGT
CTGCATGGCCCACTGCATCCGCCTGGCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGG
TTTCTGCAGAGAGAATGGTTTCCATGGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGC
CCTAAAACTGAGCCGGAACGGGAAAAGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCG
TTTTCCTATTTTTGCTGCTCTCTTAGGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACA
TCCACTAGCCTCACTAAAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAA
CATTCAGGACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAA
GAGAGCAATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTT
CATCATCTGTCCGGTGGCTGAGCACCCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAG
CCAAGGTCCATGCAGGGGGCTCACCCTGCCCTGTCTCCCATGGCGCAGAGCAGCCTGTGGGGCTGTGTTCCTATCCTTGTTTTCTGCTGA
ATCAGCTCAGTCAAAGCAGCCTCCAGATTCAGCGCCCTATAAAGACCAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCA
GCTCCTGAGCCAGGCGGGCCCCAGCAACCCTCCTGGGGCACCCCCAGCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCA
AGATGGAGCAGCTCCAGCCACCAGCACCATGCCAGAGCCAGCGTCAGGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCT
GACCAGTGAGCTCGAGACGTCTCAGCCACTAGCGGAGACTCACGAGGCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTG
CACTCCAGCTCCAGAGGCTGCCTCAACCAGGGACGCCAGTGCCCCAAGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAG
CGGGACCCCACAGCCCGCCTTGGGTCAACCTGCTCCCCTGCTTCCTGCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAG
CCCACCCCTGGGGCCCACCGTCCCCCCACAGCCACCCTCGGCCCTGGAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGA
CAGCACCATCAAGAGCCTGGACGAGAAGCTGCGGACTCTGCTCTACCAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGT
GGAGGTGGGCGACAGAGACTTCACCCTGGAGCCCCTGAGAGGGGACCAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCC
AGTGCCTAAGGAGGCGGTCTCAGGGCGTGTCCAGCTGCCCCAGCCCTTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGAT
GGAGCAGGGCACGTCCTCGTCAATGACAGCAGAGTCGTCTCCCAGGAGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGA
CTCCCATGTGGTCCCCAGCGTCCCCCAGGATGTACCTGCTTTTGTGAGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGC
TGGAGAAAGCTCGGCAGAGCCCCCGCCGAGTGACATGGGCACAGTGGGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTT
GGGGTCCCCTCGGAAACGTCCAGAGCAGCAGGATGTCAGCTCACCAGCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGA
GTGGACCCTGGCCTCCCCCCACAGCCTGAGATACTCTGCCCCACCCGACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCT
GGCAGTGCGGCGGGCGCAGACGGCCTCCTCCATCGAGGTCGGCGTGGGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGC
GAGACCCCCGGTGCAGAAGCAGGCGTCCCTGCCCGTGAGTGGCAGCGTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAG
GCCTTCTCGGGCCGGCTCGCTGGGCCCCGAGACACCCAGCAGGGTGGGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCA
GTCGTCCTACATCAGCAGCGACAATGATTCGGAGCTCGAGGATGCTGACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAA
GGAGATCTCGGAGCTGCAGAGCCAGCAGAAGCAGGAGATCGAAGCTCTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTT
CTTCCACACGGCACCCCCCACTGGCCGCCGGAGAAAAACCAGCAAGAGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCA
GCTCAAGGTCGTGGCCTCCAGCACAGGTCACTTGGCTGACTCCAGCAGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCT
CACTGCAGACAGCACGGGCCTGAGCGGGAAGGCAGTGCAGACCCAGCAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTC
CGGCTTAGCCAGTGATGGAGGCGGAGCGCGTGGCCAAGGCTGGACGGTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAG
CAAACCTCGTGCTCGATTCCTCAGTGGACCCGTATCTGTGTCCATCTGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAG
TAGGTCCTCCACCAGCAGCCTGGCCCCAGGCCCTGAGCCAGGCCCCCAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAA
CAAGAAGGGTACCTTCACGGACGACCTGCACAAGCTGGTGGACGAGTGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCT
CAACCAGCTGAAGCAGACCCAGAAGCTGCAAGACATGGAGGCCCAGGCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACC
TCGAGCAGGAGTGGGGATGCCACGTCTGCCCCCAGCGCCCGGCCCTCTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGT
GCCCACACCAGATGGCGCCCTCGGAACCGCCCGGAGAAACCAGGTGTGGTTTGGCCTCCGAGTCCCCCCCACCGCCTGCTGTGGGCACAG
CACTCAGCCGCGAGGGGGACAGCGGGTGGGCAGCAAGACTGCTTCCTTTGCGGCTTCAGACCCTGTTCGCTCCTAGGTTCCTGTGGTCCA
CGCGCCGTCTCCACACCCACTTCCTATACTTGAGTTGATGGTTAGAACCTTGTCGTCACCCTGCAGAAGTACAGTGCCTTGAATGCCAGC
TTTTCCGTTCCCTGATGAAAAGATATGTTAAAAAAAATTATCGGAAAAGGTTTCATTTGCAATTGGCTTGTGCATTGATAATCTTTATTT

>In-frame_FAM120A_ENST00000333936_chr9_96261168_+_WNK2_ENST00000427277_chr9_96030909_+_3817nt
CCGCGCCCGCGCCCCCGCCGCCGCCATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGA
GCTGCAGAAGCTGGCCCGGGGCAGCCTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAA
CTGCCTGCACCGCCTCTACGGCGGCTTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGC
CAAGGCCTGCTTCGGCGGCAACATCGAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCA
GGGCAACGAGCGCCAGACGGCACAGCAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGT
CTGCATGGCCCACTGCATCCGCCTGGCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGG
TTTCTGCAGAGAGAATGGTTTCCATGGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGC
CCTAAAACTGAGCCGGAACGGGAAAAGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCG
TTTTCCTATTTTTGCTGCTCTCTTAGGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACA
TCCACTAGCCTCACTAAAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAA
CATTCAGGACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAA
GAGAGCAATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTT
CATCATCTGTCCGGTGGCTGAGCACCCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAG
CCAAGATTCAGCGCCCTATAAAGACCAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCAGCTCCTGAGCCAGGCGGGCCC
CAGCAACCCTCCTGGGGCACCCCCAGCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAGCTCCAGCCAC
CAGCACCATGCCAGAGCCAGCGTCAGGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCTGACCAGTGAGCTCGAGACGTC
TCAGCCACTAGCGGAGACTCACGAGGCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTCCAGAGGCTGC
CTCAACCAGGGACGCCAGTGCCCCAAGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAGCGGGACCCCACAGCCCGCCTT
GGGTCAACCTGCTCCCCTGCTTCCTGCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGGGGCCCACCGT
CCCCCCACAGCCACCCTCGGCCCTGGAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGACAGCACCATCAAGAGCCTGGA
CGAGAAGCTGCGGACTCTGCTCTACCAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCGACAGAGACTT
CACCCTGGAGCCCCTGAGAGGGGACCAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCCAGTGCCTAAGGAGGCGGTCTC
AGGGCGTGTCCAGCTGCCCCAGCCCTTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCACGTCCTCGTC
AATGACAGCAGAGTCGTCTCCCAGGAGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGACTCCCATGTGGTCCCCAGCGT
CCCCCAGGATGTACCTGCTTTTGTGAGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCTCGGCAGAGCC
CCCGCCGAGTGACATGGGCACAGTGGGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTTGGGGTCCCCTCGGAAACGTCC
AGAGCAGCAGGATGTCAGCTCACCAGCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGGCCTCCCCCCA
CAGCCTGAGATACTCTGCCCCACCCGACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCTGGCAGTGCGGCGGGCGCAGAC
GGCCTCCTCCATCGAGGTCGGCGTGGGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGGTGCAGAAGCA
GGCGTCCCTGCCCGTGAGTGGCAGCGTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAGGCCTTCTCGGGCCGGCTCGCT
GGGCCCCGAGACACCCAGCAGGGTGGGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACATCAGCAGCGA
CAATGATTCGGAGCTCGAGGATGCTGACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAAGGAGATCTCGGAGCTGCAGAG
CCAGCAGAAGCAGGAGATCGAAGCTCTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGGCACCCCCCAC
TGGCCGCCGGAGAAAAACCAGCAAGAGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCAGCTCAAGGTCGTGGCCTCCAG
CACAGGTCACTTGGCTGACTCCAGCAGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACAGCACGGGCCT
GAGCGGGAAGGCAGTGCAGACCCAGCAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTCCGGCTTAGCCAGTGATGGAGG
CGGAGCGCGTGGCCAAGGCTGGACGGTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTGCTCGATTCCT
CAGTGGACCCGTATCTGTGTCCATCTGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAGTAGGTCCTCCACCAGCAGCCT
GGCCCCAGGCCCTGAGCCAGGCCCCCAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTACCTTCACGGA
CGACCTGCACAAGCTGGTGGACGAGTGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCTCAACCAGCTGAAGCAGACCCA
GAAGCTGCAAGACATGGAGGCCCAGGCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAGTGGGGATGCC
ACGTCTGCCCCCAGCGCCCGGCCCTCTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGTGCCCACACCAGGTTCCTGTGG

>In-frame_FAM120A_ENST00000333936_chr9_96261168_+_WNK2_ENST00000297954_chr9_96030909_+_4280nt
CCGCGCCCGCGCCCCCGCCGCCGCCATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGCCCGAGCGCCGTGGTGCCGGTGGA
GCTGCAGAAGCTGGCCCGGGGCAGCCTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGACGCCGACAA
CTGCCTGCACCGCCTCTACGGCGGCTTCTACACCGACTGGGTCAGCGGCGGCCAGTGGAACCACATGCTTGGCTACCTGGCGGCGCTGGC
CAAGGCCTGCTTCGGCGGCAACATCGAGCTCTTCGTCTTCTTCAACGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCA
GGGCAACGAGCGCCAGACGGCACAGCAGATCGTCAGCCATGTCCAGAACAAGGGCACCCCGCCGCCAAAGGTCTGGTTCCTGCCGCCCGT
CTGCATGGCCCACTGCATCCGCCTGGCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTGAGGATCACCATCAGGAAGTGATTGG
TTTCTGCAGAGAGAATGGTTTCCATGGCTTGGTTGCGTATGACTCTGATTATGCACTGTGCAACATCCCCTACTATTTCAGTGCCCATGC
CCTAAAACTGAGCCGGAACGGGAAAAGTCTCACCACAAGCCAATATCTGATGCATGAAGTTGCCAAGCAACTGGACCTGAATCCAAATCG
TTTTCCTATTTTTGCTGCTCTCTTAGGAAATCACATTCTGCCTGATGAAGATCTGGCTTCCTTTCACTGGAGTTTACTTGGTCCAGAACA
TCCACTAGCCTCACTAAAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAA
CATTCAGGACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAA
GAGAGCAATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGTCCTGCACACCGGGAAGAGGTGGTT
CATCATCTGTCCGGTGGCTGAGCACCCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCAGAAGCCAG
CCAAGGTCCATGCAGGGGGCTCACCCTGCCCTGTCTCCCATGGCGCAGAGCAGCCTGTGGGGCTGTGTTCCTATCCTTGTTTTCTGCTGA
ATCAGCTCAGTCAAAGCAGCCTCCAGATTCAGCGCCCTATAAAGACCAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCCAGTCAGCA
GCTCCTGAGCCAGGCGGGCCCCAGCAACCCTCCTGGGGCACCCCCAGCCCCTTTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCA
AGATGGAGCAGCTCCAGCCACCAGCACCATGCCAGAGCCAGCGTCAGGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCTCAGGGGCT
GACCAGTGAGCTCGAGACGTCTCAGCCACTAGCGGAGACTCACGAGGCCCCGCTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTG
CACTCCAGCTCCAGAGGCTGCCTCAACCAGGGACGCCAGTGCCCCAAGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGCCCCCACAG
CGGGACCCCACAGCCCGCCTTGGGTCAACCTGCTCCCCTGCTTCCTGCCGCAGTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAG
CCCACCCCTGGGGCCCACCGTCCCCCCACAGCCACCCTCGGCCCTGGAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGCTTTGTGGA
CAGCACCATCAAGAGCCTGGACGAGAAGCTGCGGACTCTGCTCTACCAGGAGCACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGT
GGAGGTGGGCGACAGAGACTTCACCCTGGAGCCCCTGAGAGGGGACCAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCCCTGCCCCC
AGTGCCTAAGGAGGCGGTCTCAGGGCGTGTCCAGCTGCCCCAGCCCTTGGTGGAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGAT
GGAGCAGGGCACGTCCTCGTCAATGACAGCAGAGTCGTCTCCCAGGAGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTGGCCTCAGA
CTCCCATGTGGTCCCCAGCGTCCCCCAGGATGTACCTGCTTTTGTGAGACCTGCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGC
TGGAGAAAGCTCGGCAGAGCCCCCGCCGAGTGACATGGGCACAGTGGGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCTCGAGCTTT
GGGGTCCCCTCGGAAACGTCCAGAGCAGCAGGATGTCAGCTCACCAGCCAAGACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGA
GTGGACCCTGGCCTCCCCCCACAGCCTGAGATACTCTGCCCCACCCGACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGACGTGAAGCT
GGCAGTGCGGCGGGCGCAGACGGCCTCCTCCATCGAGGTCGGCGTGGGCGAGCCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGC
GAGACCCCCGGTGCAGAAGCAGGCGTCCCTGCCCGTGAGTGGCAGCGTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTCCTGCAGAG
GCCTTCTCGGGCCGGCTCGCTGGGCCCCGAGACACCCAGCAGGGTGGGCATGAAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCA
GTCGTCCTACATCAGCAGCGACAATGATTCGGAGCTCGAGGATGCTGACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAGCACCTGAA
GGAGATCTCGGAGCTGCAGAGCCAGCAGAAGCAGGAGATCGAAGCTCTGTACCGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTT
CTTCCACACGGCACCCCCCACTGGCCGCCGGAGAAAAACCAGCAAGAGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTGGTGCGGCA
GCTCAAGGTCGTGGCCTCCAGCACAGGTCACTTGGCTGACTCCAGCAGAGGCCCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCT
CACTGCAGACAGCACGGGCCTGAGCGGGAAGGCAGTGCAGACCCAGCAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGACATCTGCTC
CGGCTTAGCCAGTGATGGAGGCGGAGCGCGTGGCCAAGGCTGGACGGTTTACCACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAG
CAAACCTCGTGCTCGATTCCTCAGTGGACCCGTATCTGTGTCCATCTGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAACACAGCAG
TAGGTCCTCCACCAGCAGCCTGGCCCCAGGCCCTGAGCCAGGCCCCCAGCCCGCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAA
CAAGAAGGGTACCTTCACGGACGACCTGCACAAGCTGGTGGACGAGTGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAGCCCACGCT
CAACCAGCTGAAGCAGACCCAGAAGCTGCAAGACATGGAGGCCCAGGCAGGCTGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACC
TCGAGCAGGAGTGGGGATGCCACGTCTGCCCCCAGCGCCCGGCCCTCTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACCCTGTCCGT
GCCCACACCAGATGGCGCCCTCGGAACCGCCCGGAGAAACCAGGTGTGGTTTGGCCTCCGAGTCCCCCCCACCGCCTGCTGTGGGCACAG
CACTCAGCCGCGAGGGGGACAGCGGGTGGGCAGCAAGACTGCTTCCTTTGCGGCTTCAGACCCTGTTCGCTCCTAGGTTCCTGTGGTCCA
CGCGCCGTCTCCACACCCACTTCCTATACTTGAGTTGATGGTTAGAACCTTGTCGTCACCCTGCAGAAGTACAGTGCCTTGAATGCCAGC
TTTTCCGTTCCCTGATGAAAAGATATGTTAAAAAAAATTATCGGAAAAGGTTTCATTTGCAATTGGCTTGTGCATTGATAATCTTTATTT


Top

FusionGenePPI for FAM120A_WNK2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FAM120ASIRT7, CUL3, CAND1, GRK5, CFTR, TARDBP, HECW2, PASK, STAU1, SPRTN, CEP250, NXF1, EZH2, RNF2, BMI1, FBXW11, EFNB2, GGPS1, HNRNPA1, PRMT8, ILF2, RBMX, SPACA4, IFI30, NTRK1, SSX2IP, HNRNPD, HNRNPH2, HNRNPU, MATR3, SEC16A, SYNCRIP, MRPL50, ATL2, FOXK2, FOXQ1, ZNF746, ELAVL2, SSSCA1, BCHE, APOBEC3D, LGALS3BP, GSPT2, CSN1S1, RBM42, CDX1, RBM3, TRIM25, G3BP1, BRCA1, YAP1WNK2YWHAZ, WNK1, SGK1, ATXN1, KLHL3, KLHL2, DGCR14, TSC22D4, PSMC3, SPATA1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneFAM120Achr9:96261168chr9:96030909ENST00000277165+518339_4053431119YES1%2C SRC and FYN
HgeneFAM120Achr9:96261168chr9:96030909ENST00000333936+519339_4053431147YES1%2C SRC and FYN
HgeneFAM120Achr9:96261168chr9:96030909ENST00000340893+517339_4053431073YES1%2C SRC and FYN
HgeneFAM120Achr9:96261168chr9:96030909ENST00000375389+59339_405343629YES1%2C SRC and FYN


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FAM120A_WNK2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FAM120A_WNK2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource