FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12426

FusionGeneSummary for FAF1_EPS15

check button Fusion gene summary
Fusion gene informationFusion gene name: FAF1_EPS15
Fusion gene ID: 12426
HgeneTgene
Gene symbol

FAF1

EPS15

Gene ID

11124

2060

Gene nameFas associated factor 1epidermal growth factor receptor pathway substrate 15
SynonymsCGI-03|HFAF1s|UBXD12|UBXN3A|hFAF1AF-1P|AF1P|MLLT5
Cytomap

1p32.3

1p32.3

Type of geneprotein-codingprotein-coding
DescriptionFAS-associated factor 1Fas (TNFRSF6) associated factor 1TNFRSF6-associated factor 1UBX domain protein 3AUBX domain-containing protein 12UBX domain-containing protein 3Aepidermal growth factor receptor substrate 15ALL1 fused gene from chromosome 1protein AF-1p
Modification date2018052220180522
UniProtAcc

Q9UNN5

P42566

Ensembl transtripts involved in fusion geneENST00000396153, ENST00000371778, 
ENST00000545823, ENST00000472808, 
ENST00000371730, ENST00000371733, 
ENST00000396122, ENST00000493793, 
Fusion gene scores* DoF score15 X 10 X 8=12005 X 4 X 4=80
# samples 216
** MAII scorelog2(21/1200*10)=-2.51457317282976
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/80*10)=-0.415037499278844
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FAF1 [Title/Abstract] AND EPS15 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFAF1

GO:0010942

positive regulation of cell death

15596450

TgeneEPS15

GO:0048268

clathrin coat assembly

12807910


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-2F-A9KP-01AFAF1chr1

51171458

-EPS15chr1

51946986

-
TCGARVSTADTCGA-BR-A4QI-01AFAF1chr1

51323601

-EPS15chr1

51946986

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000396153ENST00000371730FAF1chr1

51171458

-EPS15chr1

51946986

-
In-frameENST00000396153ENST00000371733FAF1chr1

51171458

-EPS15chr1

51946986

-
5CDS-intronENST00000396153ENST00000396122FAF1chr1

51171458

-EPS15chr1

51946986

-
5CDS-intronENST00000396153ENST00000493793FAF1chr1

51171458

-EPS15chr1

51946986

-
Frame-shitENST00000371778ENST00000371730FAF1chr1

51171458

-EPS15chr1

51946986

-
Frame-shitENST00000371778ENST00000371733FAF1chr1

51171458

-EPS15chr1

51946986

-
5CDS-intronENST00000371778ENST00000396122FAF1chr1

51171458

-EPS15chr1

51946986

-
5CDS-intronENST00000371778ENST00000493793FAF1chr1

51171458

-EPS15chr1

51946986

-
intron-3CDSENST00000545823ENST00000371730FAF1chr1

51171458

-EPS15chr1

51946986

-
intron-3CDSENST00000545823ENST00000371733FAF1chr1

51171458

-EPS15chr1

51946986

-
intron-intronENST00000545823ENST00000396122FAF1chr1

51171458

-EPS15chr1

51946986

-
intron-intronENST00000545823ENST00000493793FAF1chr1

51171458

-EPS15chr1

51946986

-
intron-3CDSENST00000472808ENST00000371730FAF1chr1

51171458

-EPS15chr1

51946986

-
intron-3CDSENST00000472808ENST00000371733FAF1chr1

51171458

-EPS15chr1

51946986

-
intron-intronENST00000472808ENST00000396122FAF1chr1

51171458

-EPS15chr1

51946986

-
intron-intronENST00000472808ENST00000493793FAF1chr1

51171458

-EPS15chr1

51946986

-
In-frameENST00000396153ENST00000371730FAF1chr1

51323601

-EPS15chr1

51946986

-
In-frameENST00000396153ENST00000371733FAF1chr1

51323601

-EPS15chr1

51946986

-
5CDS-intronENST00000396153ENST00000396122FAF1chr1

51323601

-EPS15chr1

51946986

-
5CDS-intronENST00000396153ENST00000493793FAF1chr1

51323601

-EPS15chr1

51946986

-
Frame-shitENST00000371778ENST00000371730FAF1chr1

51323601

-EPS15chr1

51946986

-
Frame-shitENST00000371778ENST00000371733FAF1chr1

51323601

-EPS15chr1

51946986

-
5CDS-intronENST00000371778ENST00000396122FAF1chr1

51323601

-EPS15chr1

51946986

-
5CDS-intronENST00000371778ENST00000493793FAF1chr1

51323601

-EPS15chr1

51946986

-
intron-3CDSENST00000545823ENST00000371730FAF1chr1

51323601

-EPS15chr1

51946986

-
intron-3CDSENST00000545823ENST00000371733FAF1chr1

51323601

-EPS15chr1

51946986

-
intron-intronENST00000545823ENST00000396122FAF1chr1

51323601

-EPS15chr1

51946986

-
intron-intronENST00000545823ENST00000493793FAF1chr1

51323601

-EPS15chr1

51946986

-
intron-3CDSENST00000472808ENST00000371730FAF1chr1

51323601

-EPS15chr1

51946986

-
intron-3CDSENST00000472808ENST00000371733FAF1chr1

51323601

-EPS15chr1

51946986

-
intron-intronENST00000472808ENST00000396122FAF1chr1

51323601

-EPS15chr1

51946986

-
intron-intronENST00000472808ENST00000493793FAF1chr1

51323601

-EPS15chr1

51946986

-

Top

FusionProtFeatures for FAF1_EPS15


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FAF1

Q9UNN5

EPS15

P42566

Ubiquitin-binding protein (PubMed:19722279). Requiredfor the progression of DNA replication forks by targeting DNAreplication licensing factor CDT1 for degradation(PubMed:26842564). Potentiates but cannot initiate FAS-inducedapoptosis (By similarity). {ECO:0000250|UniProtKB:P54731,ECO:0000269|PubMed:19722279, ECO:0000269|PubMed:26842564}. Involved in cell growth regulation. May be involved inthe regulation of mitogenic signals and control of cellproliferation. Involved in the internalization of ligand-induciblereceptors of the receptor tyrosine kinase (RTK) type, inparticular EGFR. Plays a role in the assembly of clathrin-coatedpits (CCPs). Acts as a clathrin adapter required for post-Golgitrafficking. Seems to be involved in CCPs maturation includinginvagination or budding. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR); internalization of ITGB1as DAB2-dependent cargo but not TFR seems to require associationwith DAB2. {ECO:0000269|PubMed:16903783,ECO:0000269|PubMed:18362181, ECO:0000269|PubMed:19458185,ECO:0000269|PubMed:22648170}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFAF1chr1:51171458chr1:51946986ENST00000371778-8201_57219651DomainUBA
HgeneFAF1chr1:51171458chr1:51946986ENST00000396153-7191_57219651DomainUBA
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025173_18411897Calcium bindingNote=1
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025236_24711897Calcium bindingNote=2
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025173_18411897Calcium bindingNote=1
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025236_24711897Calcium bindingNote=2
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025768_85011897Compositional biasNote=Pro-rich
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025768_85011897Compositional biasNote=Pro-rich
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025128_21611897DomainEH 2
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-02515_10411897DomainEH 1
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025160_19511897DomainEF-hand 1
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025223_25811897DomainEF-hand 2
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025224_31411897DomainEH 3
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025851_87011897DomainUIM 1
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025877_89611897DomainUIM 2
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025128_21611897DomainEH 2
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-02515_10411897DomainEH 1
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025160_19511897DomainEF-hand 1
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025223_25811897DomainEF-hand 2
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025224_31411897DomainEH 3
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025851_87011897DomainUIM 1
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025877_89611897DomainUIM 2
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025768_77411897MotifNote=SH3-binding
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025768_77411897MotifNote=SH3-binding
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025599_82711897RegionNote=15 X 3 AA repeats of D-P-F
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025599_82711897RegionNote=15 X 3 AA repeats of D-P-F
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025599_60111897RepeatNote=1
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025623_62511897RepeatNote=2
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025629_63111897RepeatNote=3
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025634_63611897RepeatNote=4
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025640_64211897RepeatNote=5
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025645_64711897RepeatNote=6
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025651_65311897RepeatNote=7
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025664_66611897RepeatNote=8
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025672_67411897RepeatNote=9
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025692_69411897RepeatNote=10
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025709_71111897RepeatNote=11
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025737_73911897RepeatNote=12
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025798_80011897RepeatNote=13
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025804_80611897RepeatNote=14
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-025825_82711897RepeatNote=15
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025599_60111897RepeatNote=1
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025623_62511897RepeatNote=2
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025629_63111897RepeatNote=3
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025634_63611897RepeatNote=4
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025640_64211897RepeatNote=5
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025645_64711897RepeatNote=6
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025651_65311897RepeatNote=7
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025664_66611897RepeatNote=8
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025672_67411897RepeatNote=9
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025692_69411897RepeatNote=10
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025709_71111897RepeatNote=11
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025737_73911897RepeatNote=12
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025798_80011897RepeatNote=13
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025804_80611897RepeatNote=14
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-025825_82711897RepeatNote=15

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFAF1chr1:51171458chr1:51946986ENST00000371778-820569_646219651DomainUBX
HgeneFAF1chr1:51171458chr1:51946986ENST00000396153-719569_646219651DomainUBX
HgeneFAF1chr1:51323601chr1:51946986ENST00000371778-3201_5738651DomainUBA
HgeneFAF1chr1:51323601chr1:51946986ENST00000371778-320569_64638651DomainUBX
HgeneFAF1chr1:51323601chr1:51946986ENST00000396153-2191_5738651DomainUBA
HgeneFAF1chr1:51323601chr1:51946986ENST00000396153-219569_64638651DomainUBX


Top

FusionGeneSequence for FAF1_EPS15


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FAF1_ENST00000396153_chr1_51171458_-_EPS15_ENST00000371730_chr1_51946986_-_971aa
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSETGGETIPGPAFNPASHPASAPTSSSSSAFRPVMPS
RQIVERQPRMLDFRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLTVLTPDLPPPSSS
SHAGALQESLNQNFMLIITHREVQREYNLNFSGSSTIQELSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADT
DGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKTDAIFDSLSPVNGFLSGDKVK
PVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKTDEIFLKTDKDMDGF
VSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNIIGSSPVADFSAI
KELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCAEE
AQLARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDP
FKGSDPFASDCFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNE
DPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDP

>In-frame_FAF1_ENST00000396153_chr1_51171458_-_EPS15_ENST00000371733_chr1_51946986_-_1105aa
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSETGGETIPGPAFNPASHPASAPTSSSSSAFRPVMPS
RQIVERQPRMLDFRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLTVLTPDLPPPSSS
SHAGALQESLNQNFMLIITHREVQREYNLNFSGSSTIQELSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADT
DGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKTDAIFDSLSPVNGFLSGDKVK
PVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKTDEIFLKTDKDMDGF
VSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNIIGSSPVADFSAI
KELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCAEE
AQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQHLQDSQQEISSMQMKLMEMKDLENHNSQLNWC
SSPHSILVNGATDTCSLSTSSSETANLNEHVEGQSNLESEPIHQESPARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDPFN
VDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFRQSTDPFATSSTDPFSAANNSSITSVETLKHND
PFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPC
PLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSATPSEEDMIEWAKRESEREEEQRLA

>In-frame_FAF1_ENST00000396153_chr1_51323601_-_EPS15_ENST00000371730_chr1_51946986_-_790aa
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVLSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTD
GKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKTDAIFDSLSPVNGFLSGDKVKP
VLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKTDEIFLKTDKDMDGFV
SGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNIIGSSPVADFSAIK
ELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCAEEA
QLARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPF
KGSDPFASDCFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNED
PFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPF

>In-frame_FAF1_ENST00000396153_chr1_51323601_-_EPS15_ENST00000371733_chr1_51946986_-_924aa
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVLSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTD
GKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKTDAIFDSLSPVNGFLSGDKVKP
VLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKTDEIFLKTDKDMDGFV
SGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNIIGSSPVADFSAIK
ELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCAEEA
QLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQHLQDSQQEISSMQMKLMEMKDLENHNSQLNWCS
SPHSILVNGATDTCSLSTSSSETANLNEHVEGQSNLESEPIHQESPARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDPFNV
DSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDP
FAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCP
LPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSATPSEEDMIEWAKRESEREEEQRLAR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FAF1_ENST00000396153_chr1_51171458_-_EPS15_ENST00000371730_chr1_51946986_-_2913nt
ATGGCGTCCAACATGGACCGGGAGATGATCCTGGCGGATTTTCAGGCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGCTT
GAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATACCACAGGAAAATGGCATTCTACAAAGTGAATATGGAGGTGAGACC
ATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCTCCTACTTCCTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCATCC
AGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTTGAATACAGAGACAGAAATGTTGATGTGGTACTTGAAGACACCTGT
ACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATACCTGTGTCCAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATGTG
GAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAACAGTCTTTATGTCCTTACACCAGATTTGCCACCACCTTCATCATCT
AGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATGCTGATCATCACCCACCGAGAAGTCCAGCGGGAGTACAACCTGAAC
TTCTCAGGAAGCAGTACTATTCAAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTGGA
AGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACACA
GATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGT
AGTTTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGG
GCTGTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAA
CCAGTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACAGA
GATGAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCA
TCTAAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGATTT
GTGTCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAAAG
GACTGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTT
CTTACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATT
AAGGAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATACT
ATTAAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAACAG
CAGGTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAG
GCCCAACTGGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGT
TCTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAAC
TTGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCT
TTCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCA
GCCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCA
GCCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATGAA
GATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAGAT
GAACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCTGGGAAAAGATCCATCAACAAATTGGATTCT
CCTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCA
TTCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGATC
GAATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAGCAGGAACAAGAAGACTTAGAACTGGCTATT

>In-frame_FAF1_ENST00000396153_chr1_51171458_-_EPS15_ENST00000371733_chr1_51946986_-_3315nt
ATGGCGTCCAACATGGACCGGGAGATGATCCTGGCGGATTTTCAGGCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGCTT
GAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATACCACAGGAAAATGGCATTCTACAAAGTGAATATGGAGGTGAGACC
ATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCTCCTACTTCCTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCATCC
AGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTTGAATACAGAGACAGAAATGTTGATGTGGTACTTGAAGACACCTGT
ACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATACCTGTGTCCAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATGTG
GAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAACAGTCTTTATGTCCTTACACCAGATTTGCCACCACCTTCATCATCT
AGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATGCTGATCATCACCCACCGAGAAGTCCAGCGGGAGTACAACCTGAAC
TTCTCAGGAAGCAGTACTATTCAAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTGGA
AGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACACA
GATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGT
AGTTTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGG
GCTGTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAA
CCAGTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACAGA
GATGAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCA
TCTAAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGATTT
GTGTCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAAAG
GACTGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTT
CTTACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATT
AAGGAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATACT
ATTAAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAACAG
CAGGTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAG
GCCCAACTGATCTCTTCTCTGAAAGCTGAATTAACTAGTCAGGAATCGCAGATCTCCACTTACGAAGAAGAATTGGCAAAAGCTAGAGAA
GAGCTGAGCCGTCTACAGCAAGAAACAGCAGAATTGGAGGAGAGTGTAGAGTCAGGGAAGGCTCAGTTGGAACCTCTTCAGCAGCACCTA
CAAGATTCACAACAGGAAATTAGTTCAATGCAAATGAAACTGATGGAAATGAAAGATTTGGAAAATCATAATAGTCAGTTAAATTGGTGC
AGTAGCCCACACAGCATTCTTGTAAACGGAGCTACAGATTATTGCAGCCTCAGCACCAGCAGCAGTGAAACAGCCAACCTTAATGAACAT
GTTGAAGGCCAGAGCAACCTAGAGTCTGAGCCCATACACCAGGAATCTCCAGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACT
GATGAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTAAT
GTAGACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAG
GATGATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAATCT
ACTGATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATGAT
CCTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGT
GGATTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATT
ACAAAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCTGC
CCTCTACCACCTGGGAAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCAAC
GATAGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCAAT
TTTGCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCC

>In-frame_FAF1_ENST00000396153_chr1_51323601_-_EPS15_ENST00000371730_chr1_51946986_-_2370nt
ATGGCGTCCAACATGGACCGGGAGATGATCCTGGCGGATTTTCAGGCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGCTT
GAACAAAATAATTGGGACTTAGTGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTGGAAGG
GTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACACAGAT
GGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGTAGT
TTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGGGCT
GTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAACCA
GTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACAGAGAT
GAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCATCT
AAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGATTTGTG
TCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAAAGGAC
TGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTTCTT
ACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATTAAG
GAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATACTATT
AAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAACAGCAG
GTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAGGCC
CAACTGGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGTTCT
GAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAACTTG
GATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCTTTC
AAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCAGCC
AACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCAGCC
ACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATGAAGAT
CCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAGATGAA
CCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCTGGGAAAAGATCCATCAACAAATTGGATTCTCCT
GATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCATTC
ACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGATCGAA
TGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAGCAGGAACAAGAAGACTTAGAACTGGCTATTGCA

>In-frame_FAF1_ENST00000396153_chr1_51323601_-_EPS15_ENST00000371733_chr1_51946986_-_2772nt
ATGGCGTCCAACATGGACCGGGAGATGATCCTGGCGGATTTTCAGGCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGCTT
GAACAAAATAATTGGGACTTAGTGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTGGAAGG
GTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACACAGAT
GGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGTAGT
TTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGGGCT
GTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAACCA
GTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACAGAGAT
GAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCATCT
AAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGATTTGTG
TCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAAAGGAC
TGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTTCTT
ACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATTAAG
GAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATACTATT
AAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAACAGCAG
GTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAGGCC
CAACTGATCTCTTCTCTGAAAGCTGAATTAACTAGTCAGGAATCGCAGATCTCCACTTACGAAGAAGAATTGGCAAAAGCTAGAGAAGAG
CTGAGCCGTCTACAGCAAGAAACAGCAGAATTGGAGGAGAGTGTAGAGTCAGGGAAGGCTCAGTTGGAACCTCTTCAGCAGCACCTACAA
GATTCACAACAGGAAATTAGTTCAATGCAAATGAAACTGATGGAAATGAAAGATTTGGAAAATCATAATAGTCAGTTAAATTGGTGCAGT
AGCCCACACAGCATTCTTGTAAACGGAGCTACAGATTATTGCAGCCTCAGCACCAGCAGCAGTGAAACAGCCAACCTTAATGAACATGTT
GAAGGCCAGAGCAACCTAGAGTCTGAGCCCATACACCAGGAATCTCCAGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGAT
GAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTAATGTA
GACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGAT
GATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAATCTACT
GATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATGATCCT
TTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGA
TTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATTACA
AAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCTGCCCT
CTACCACCTGGGAAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCAACGAT
AGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCAATTTT
GCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_FAF1_ENST00000396153_chr1_51171458_-_EPS15_ENST00000371730_chr1_51946986_-_5802nt
AGGGGCGGAGGCGGCGGCCAGGGAGGAAGCGGAGGAGGCGGAGGCGGCCGCGGCGTTCGCCCGCCCGCTCGCTCGCTCGGTTTCCCCGCC
CCCGCCGGGCTTAACGCCGCTGAAGGTATCCGGGTGCGCGCTGTCGCAACCTGCCCTCATCCTGGCCCGCGACTGTAAGACCGGACCCAC
ATCCAGACCAATCTTCCTGTCCGGGCTGCTGCGACGCGGGCTCCGCAGGTTGCAGGCGGGCGGCCGGGGCGCCTGAAGGTTACCGAGTGC
ATGAGCGCCTAGCGCTTCCCGCGCTGCCCCGCCCGCTGGCCCGCCGACCCGCCCGCCGGCTCGCCCGCCAGCCCCTCGGCGCCCGGCGGC
GGCGGCGGCGGTGGCGGCGACGGTCGCAGGAGGTGCCGTCTGCCTCCCAGGTGCGCGCTTCGCTCCCGGAGCCGCGGAACTCGGCGGCCG
CCATGGCGTCCAACATGGACCGGGAGATGATCCTGGCGGATTTTCAGGCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGC
TTGAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATACCACAGGAAAATGGCATTCTACAAAGTGAATATGGAGGTGAGA
CCATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCTCCTACTTCCTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCAT
CCAGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTTGAATACAGAGACAGAAATGTTGATGTGGTACTTGAAGACACCT
GTACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATACCTGTGTCCAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATG
TGGAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAACAGTCTTTATGTCCTTACACCAGATTTGCCACCACCTTCATCAT
CTAGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATGCTGATCATCACCCACCGAGAAGTCCAGCGGGAGTACAACCTGA
ACTTCTCAGGAAGCAGTACTATTCAAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTG
GAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACA
CAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAA
GTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCAT
GGGCTGTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGA
AACCAGTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACA
GAGATGAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCAC
CATCTAAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGAT
TTGTGTCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAA
AGGACTGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACG
TTCTTACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTA
TTAAGGAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATA
CTATTAAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAAC
AGCAGGTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGG
AGGCCCAACTGGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTT
GTTCTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAA
ACTTGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATC
CTTTCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTG
CAGCCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATT
CAGCCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATG
AAGATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAG
ATGAACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCTGGGAAAAGATCCATCAACAAATTGGATT
CTCCTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATC
CATTCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGA
TCGAATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAGCAGGAACAAGAAGACTTAGAACTGGCTA
TTGCACTCAGCAAATCTGAGATATCAGAAGCATGAAGAATTCTCTTGTTCTTTGGCAACAATATAGTATTCTTCTTCCTGAATACTGAAA
CTATTTACAATGTGTATCAAAACTACCTGTGAGCATGGGAATACAAAAGGTTTGAGATTCCTGTAAATGTGACAAAATTTTAGGATTTTT
TTTTTTTCTTCATTACAGATTCGTCTTTTTTTTTTTTTCTTATAAAAGCCGTAACCCAGTCAGACAAATTCACCTTCACTTAGGCCCCTG
TTCTGGTATACATTTACTGTGAGCTTTTGCCTGCCTGTGCTATTTTACTTGTAAAGCTAGAGCACCCAAGCTTCTGCCTTCTGGAATATA
GAGAAATAGTTTCACCCTGCACTACCCTGTTCTGTAGTTATTCTGATGATAGCCAGTGAGGTTCTTAAAGTTTGCAGTATTCTCCCCTGA
TTGGAATGGTTGAGTGAGGGTAAGGGAAAGAATATCTTATTTCTTTTATGATTGGTGCAAATTGGCTAAAGTGCATTTTTAAATTTCCTC
TACTTAATTTGTTTTTCAGAGATAAGGAAAAATATTTTGCACAGATTTACTCCACTATGGAAAAGGGATGCTGTAGGTTGAACCATTATA
GCCTCAGATTCGATCTTTTCCTAACTAAAAATATTAAAGCCTCATGTGTGAAATAAATTTTTAAAAAGATTTATCTGGATTTAGAGAATT
TTAGATCAACAGATACCTCTCAGTGTGTTTGCTAATTAATAAAAATCAGTTTCTTACAAATAAAGTTTGTAAGAAAATGTTCATTTTAAG
TGATAGATAGTGGAGAAAATTTATCACCTAAAATATACCCATCAGTATAAGGCAAGCAAAAGTCTTAACATGGCAGCCATTCTGCCTTTG
CCGTGGCCCTGTCCTGTTTAGTTCTTAGTGGGTTAATTTTTGTACTTTTGCAGAAGAAACTTCAGCAAGCTAGAACTGGAAGGTACTTTA
ATTTTTCATATATATTTGTTTTTTTTTTTTTAATGAAGGCTCATTTACTTGAAATGTAAAAACTTTCACTGAATACAAATAGAAAAAGTG
ATGTGTTTTATATCATATTGCTTTTTGTCCATCTTTGTGGTTTAGTTTATTTACTCACTTCATGTTTTTCACCTATAAAATTGTCAAGCT
AGCAAAAAAACTCTTGTTTTTTTAATTGGGAGAGAAGAGACCTGCCAGATTATCAGACCTCTTCATGTTAAAAGACCATCTCCTGTAAAA
CTGACCTAGTGGACAAGCTGAATTTGAAATAGACTGTGAAGTAAGCTGTAACTTGTCATTTTAATTTTGTTTAACACGGTTACTGACTTA
GATGATGTATTAAATACCAAGATAAAGAAAAATGCACCTAAAATCTAATTAGAATTCTCTGGGTCAACAAGTCAAGGTGGTATTGATCTG
TGTTAATCTGAGTAACTTATTGCCTAGCCTATAAATAAATTCCAAAATATCCAATTCATTTCTTCTTGAAATGGTGCTTGTTTTGTTTTC
TTTCCATTACACAATTAGACTCCTACAGTTTAAAACAAACTTTAAACCACTATCTTGCACTGCTAACTTTTTTCTACCTTTGTAAATAGA
AACATTTCTGCATAAAAGTCATACATATGAAGCAAGGGCTGAATCATAATCACAAGGCTTAATTTTGATAAACGAATCCAGTGACCTAAG
GATTTTCTGCAAAATTTGACTGGGAGTTGTGATAGGTGGTATTTTTGTTTATTTTCTTCCTCTTACTCCTTAGGATAAAGGTAAGTTGAC
TTGAACAACTTTCTTTTGCACTGGGAAAATAAGCAAATGTTTAAATGCTTCAAAAAAATTTTCAATTAAACTCAAATATTAAATATCTAT
AACTTATAAACACCAACTTTCAATGTAATAAATGTATCCTAATCTTATGTATGTTTAACTGGATTACATAGATTTTTATCTTTTGTTAAA
ATGTGTATACCCCGTGGACCAACATAATATTAAAGTATGTATATATTATATAAATATATATGTATATGTGCTCGCTTGTGTAGGATGAAT
GTCTTAGAGTCGTTTGTGGTATTTTATGTTGTTGACTCTGGCTCCAGGGCCTGTGCTTGAAAAGGACAGATAAGTATTGCCCAGAGCTAA
GTGGCACTACTTACAAAGTTTTAAATGTCTTCTACATACTGATTCATGTTTATTTGAGCTCTCTTTATAGAATTTTCTCTTAAAGTTTCA
AACCTCTAAGTTGTAGCCTGTAATTATGAGAACAGTAAACTTTAAGTAATAATAAAGAATCCCATCCATATATCCAATTTGCAATTGAGT
TTTGCATGGTTCTCTGATTATGTCCATGCTGTGTCCAAGGAGGAGTAGGTACATACAATCAGCACAGATTAATATATGTAAAGGGTTTGG

>In-frame_FAF1_ENST00000396153_chr1_51171458_-_EPS15_ENST00000371733_chr1_51946986_-_6204nt
AGGGGCGGAGGCGGCGGCCAGGGAGGAAGCGGAGGAGGCGGAGGCGGCCGCGGCGTTCGCCCGCCCGCTCGCTCGCTCGGTTTCCCCGCC
CCCGCCGGGCTTAACGCCGCTGAAGGTATCCGGGTGCGCGCTGTCGCAACCTGCCCTCATCCTGGCCCGCGACTGTAAGACCGGACCCAC
ATCCAGACCAATCTTCCTGTCCGGGCTGCTGCGACGCGGGCTCCGCAGGTTGCAGGCGGGCGGCCGGGGCGCCTGAAGGTTACCGAGTGC
ATGAGCGCCTAGCGCTTCCCGCGCTGCCCCGCCCGCTGGCCCGCCGACCCGCCCGCCGGCTCGCCCGCCAGCCCCTCGGCGCCCGGCGGC
GGCGGCGGCGGTGGCGGCGACGGTCGCAGGAGGTGCCGTCTGCCTCCCAGGTGCGCGCTTCGCTCCCGGAGCCGCGGAACTCGGCGGCCG
CCATGGCGTCCAACATGGACCGGGAGATGATCCTGGCGGATTTTCAGGCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGC
TTGAACAAAATAATTGGGACTTAGTGGCAGCTATCAATGGTGTAATACCACAGGAAAATGGCATTCTACAAAGTGAATATGGAGGTGAGA
CCATACCAGGACCTGCATTTAATCCAGCAAGTCATCCAGCTTCAGCTCCTACTTCCTCTTCTTCTTCAGCGTTTCGACCTGTAATGCCAT
CCAGGCAGATTGTAGAAAGGCAACCTCGGATGCTGGACTTCAGGGTTGAATACAGAGACAGAAATGTTGATGTGGTACTTGAAGACACCT
GTACTGTTGGAGAGATTAAACAGATTCTAGAAAATGAACTTCAGATACCTGTGTCCAAAATGCTGTTAAAAGGCTGGAAGACGGGAGATG
TGGAAGACAGTACGGTCCTAAAATCTCTACACTTGCCAAAAAACAACAGTCTTTATGTCCTTACACCAGATTTGCCACCACCTTCATCAT
CTAGTCATGCTGGTGCCCTGCAGGAGTCATTAAATCAAAACTTCATGCTGATCATCACCCACCGAGAAGTCCAGCGGGAGTACAACCTGA
ACTTCTCAGGAAGCAGTACTATTCAAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTG
GAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACA
CAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAA
GTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCAT
GGGCTGTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGA
AACCAGTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACA
GAGATGAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCAC
CATCTAAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGAT
TTGTGTCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAA
AGGACTGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACG
TTCTTACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTA
TTAAGGAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATA
CTATTAAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAAC
AGCAGGTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGG
AGGCCCAACTGATCTCTTCTCTGAAAGCTGAATTAACTAGTCAGGAATCGCAGATCTCCACTTACGAAGAAGAATTGGCAAAAGCTAGAG
AAGAGCTGAGCCGTCTACAGCAAGAAACAGCAGAATTGGAGGAGAGTGTAGAGTCAGGGAAGGCTCAGTTGGAACCTCTTCAGCAGCACC
TACAAGATTCACAACAGGAAATTAGTTCAATGCAAATGAAACTGATGGAAATGAAAGATTTGGAAAATCATAATAGTCAGTTAAATTGGT
GCAGTAGCCCACACAGCATTCTTGTAAACGGAGCTACAGATTATTGCAGCCTCAGCACCAGCAGCAGTGAAACAGCCAACCTTAATGAAC
ATGTTGAAGGCCAGAGCAACCTAGAGTCTGAGCCCATACACCAGGAATCTCCAGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGA
CTGATGAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTA
ATGTAGACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCA
AGGATGATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAAT
CTACTGATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATG
ATCCTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAG
GTGGATTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGA
TTACAAAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCT
GCCCTCTACCACCTGGGAAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCA
ACGATAGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCA
ATTTTGCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTG
CCCGACTAAATCAGCAGGAACAAGAAGACTTAGAACTGGCTATTGCACTCAGCAAATCTGAGATATCAGAAGCATGAAGAATTCTCTTGT
TCTTTGGCAACAATATAGTATTCTTCTTCCTGAATACTGAAACTATTTACAATGTGTATCAAAACTACCTGTGAGCATGGGAATACAAAA
GGTTTGAGATTCCTGTAAATGTGACAAAATTTTAGGATTTTTTTTTTTTCTTCATTACAGATTCGTCTTTTTTTTTTTTTCTTATAAAAG
CCGTAACCCAGTCAGACAAATTCACCTTCACTTAGGCCCCTGTTCTGGTATACATTTACTGTGAGCTTTTGCCTGCCTGTGCTATTTTAC
TTGTAAAGCTAGAGCACCCAAGCTTCTGCCTTCTGGAATATAGAGAAATAGTTTCACCCTGCACTACCCTGTTCTGTAGTTATTCTGATG
ATAGCCAGTGAGGTTCTTAAAGTTTGCAGTATTCTCCCCTGATTGGAATGGTTGAGTGAGGGTAAGGGAAAGAATATCTTATTTCTTTTA
TGATTGGTGCAAATTGGCTAAAGTGCATTTTTAAATTTCCTCTACTTAATTTGTTTTTCAGAGATAAGGAAAAATATTTTGCACAGATTT
ACTCCACTATGGAAAAGGGATGCTGTAGGTTGAACCATTATAGCCTCAGATTCGATCTTTTCCTAACTAAAAATATTAAAGCCTCATGTG
TGAAATAAATTTTTAAAAAGATTTATCTGGATTTAGAGAATTTTAGATCAACAGATACCTCTCAGTGTGTTTGCTAATTAATAAAAATCA
GTTTCTTACAAATAAAGTTTGTAAGAAAATGTTCATTTTAAGTGATAGATAGTGGAGAAAATTTATCACCTAAAATATACCCATCAGTAT
AAGGCAAGCAAAAGTCTTAACATGGCAGCCATTCTGCCTTTGCCGTGGCCCTGTCCTGTTTAGTTCTTAGTGGGTTAATTTTTGTACTTT
TGCAGAAGAAACTTCAGCAAGCTAGAACTGGAAGGTACTTTAATTTTTCATATATATTTGTTTTTTTTTTTTTAATGAAGGCTCATTTAC
TTGAAATGTAAAAACTTTCACTGAATACAAATAGAAAAAGTGATGTGTTTTATATCATATTGCTTTTTGTCCATCTTTGTGGTTTAGTTT
ATTTACTCACTTCATGTTTTTCACCTATAAAATTGTCAAGCTAGCAAAAAAACTCTTGTTTTTTTAATTGGGAGAGAAGAGACCTGCCAG
ATTATCAGACCTCTTCATGTTAAAAGACCATCTCCTGTAAAACTGACCTAGTGGACAAGCTGAATTTGAAATAGACTGTGAAGTAAGCTG
TAACTTGTCATTTTAATTTTGTTTAACACGGTTACTGACTTAGATGATGTATTAAATACCAAGATAAAGAAAAATGCACCTAAAATCTAA
TTAGAATTCTCTGGGTCAACAAGTCAAGGTGGTATTGATCTGTGTTAATCTGAGTAACTTATTGCCTAGCCTATAAATAAATTCCAAAAT
ATCCAATTCATTTCTTCTTGAAATGGTGCTTGTTTTGTTTTCTTTCCATTACACAATTAGACTCCTACAGTTTAAAACAAACTTTAAACC
ACTATCTTGCACTGCTAACTTTTTTCTACCTTTGTAAATAGAAACATTTCTGCATAAAAGTCATACATATGAAGCAAGGGCTGAATCATA
ATCACAAGGCTTAATTTTGATAAACGAATCCAGTGACCTAAGGATTTTCTGCAAAATTTGACTGGGAGTTGTGATAGGTGGTATTTTTGT
TTATTTTCTTCCTCTTACTCCTTAGGATAAAGGTAAGTTGACTTGAACAACTTTCTTTTGCACTGGGAAAATAAGCAAATGTTTAAATGC
TTCAAAAAAATTTTCAATTAAACTCAAATATTAAATATCTATAACTTATAAACACCAACTTTCAATGTAATAAATGTATCCTAATCTTAT
GTATGTTTAACTGGATTACATAGATTTTTATCTTTTGTTAAAATGTGTATACCCCGTGGACCAACATAATATTAAAGTATGTATATATTA
TATAAATATATATGTATATGTGCTCGCTTGTGTAGGATGAATGTCTTAGAGTCGTTTGTGGTATTTTATGTTGTTGACTCTGGCTCCAGG
GCCTGTGCTTGAAAAGGACAGATAAGTATTGCCCAGAGCTAAGTGGCACTACTTACAAAGTTTTAAATGTCTTCTACATACTGATTCATG
TTTATTTGAGCTCTCTTTATAGAATTTTCTCTTAAAGTTTCAAACCTCTAAGTTGTAGCCTGTAATTATGAGAACAGTAAACTTTAAGTA
ATAATAAAGAATCCCATCCATATATCCAATTTGCAATTGAGTTTTGCATGGTTCTCTGATTATGTCCATGCTGTGTCCAAGGAGGAGTAG

>In-frame_FAF1_ENST00000396153_chr1_51323601_-_EPS15_ENST00000371730_chr1_51946986_-_5259nt
AGGGGCGGAGGCGGCGGCCAGGGAGGAAGCGGAGGAGGCGGAGGCGGCCGCGGCGTTCGCCCGCCCGCTCGCTCGCTCGGTTTCCCCGCC
CCCGCCGGGCTTAACGCCGCTGAAGGTATCCGGGTGCGCGCTGTCGCAACCTGCCCTCATCCTGGCCCGCGACTGTAAGACCGGACCCAC
ATCCAGACCAATCTTCCTGTCCGGGCTGCTGCGACGCGGGCTCCGCAGGTTGCAGGCGGGCGGCCGGGGCGCCTGAAGGTTACCGAGTGC
ATGAGCGCCTAGCGCTTCCCGCGCTGCCCCGCCCGCTGGCCCGCCGACCCGCCCGCCGGCTCGCCCGCCAGCCCCTCGGCGCCCGGCGGC
GGCGGCGGCGGTGGCGGCGACGGTCGCAGGAGGTGCCGTCTGCCTCCCAGGTGCGCGCTTCGCTCCCGGAGCCGCGGAACTCGGCGGCCG
CCATGGCGTCCAACATGGACCGGGAGATGATCCTGGCGGATTTTCAGGCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGC
TTGAACAAAATAATTGGGACTTAGTGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTGGAA
GGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACACAG
ATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGTA
GTTTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGGG
CTGTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAAC
CAGTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACAGAG
ATGAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCAT
CTAAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGATTTG
TGTCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAAAGG
ACTGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTTC
TTACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATTA
AGGAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATACTA
TTAAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAACAGC
AGGTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAGG
CCCAACTGGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGTT
CTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAACT
TGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCTT
TCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCAG
CCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCAG
CCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATGAAG
ATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAGATG
AACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCTGGGAAAAGATCCATCAACAAATTGGATTCTC
CTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCAT
TCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGATCG
AATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAGCAGGAACAAGAAGACTTAGAACTGGCTATTG
CACTCAGCAAATCTGAGATATCAGAAGCATGAAGAATTCTCTTGTTCTTTGGCAACAATATAGTATTCTTCTTCCTGAATACTGAAACTA
TTTACAATGTGTATCAAAACTACCTGTGAGCATGGGAATACAAAAGGTTTGAGATTCCTGTAAATGTGACAAAATTTTAGGATTTTTTTT
TTTTCTTCATTACAGATTCGTCTTTTTTTTTTTTTCTTATAAAAGCCGTAACCCAGTCAGACAAATTCACCTTCACTTAGGCCCCTGTTC
TGGTATACATTTACTGTGAGCTTTTGCCTGCCTGTGCTATTTTACTTGTAAAGCTAGAGCACCCAAGCTTCTGCCTTCTGGAATATAGAG
AAATAGTTTCACCCTGCACTACCCTGTTCTGTAGTTATTCTGATGATAGCCAGTGAGGTTCTTAAAGTTTGCAGTATTCTCCCCTGATTG
GAATGGTTGAGTGAGGGTAAGGGAAAGAATATCTTATTTCTTTTATGATTGGTGCAAATTGGCTAAAGTGCATTTTTAAATTTCCTCTAC
TTAATTTGTTTTTCAGAGATAAGGAAAAATATTTTGCACAGATTTACTCCACTATGGAAAAGGGATGCTGTAGGTTGAACCATTATAGCC
TCAGATTCGATCTTTTCCTAACTAAAAATATTAAAGCCTCATGTGTGAAATAAATTTTTAAAAAGATTTATCTGGATTTAGAGAATTTTA
GATCAACAGATACCTCTCAGTGTGTTTGCTAATTAATAAAAATCAGTTTCTTACAAATAAAGTTTGTAAGAAAATGTTCATTTTAAGTGA
TAGATAGTGGAGAAAATTTATCACCTAAAATATACCCATCAGTATAAGGCAAGCAAAAGTCTTAACATGGCAGCCATTCTGCCTTTGCCG
TGGCCCTGTCCTGTTTAGTTCTTAGTGGGTTAATTTTTGTACTTTTGCAGAAGAAACTTCAGCAAGCTAGAACTGGAAGGTACTTTAATT
TTTCATATATATTTGTTTTTTTTTTTTTAATGAAGGCTCATTTACTTGAAATGTAAAAACTTTCACTGAATACAAATAGAAAAAGTGATG
TGTTTTATATCATATTGCTTTTTGTCCATCTTTGTGGTTTAGTTTATTTACTCACTTCATGTTTTTCACCTATAAAATTGTCAAGCTAGC
AAAAAAACTCTTGTTTTTTTAATTGGGAGAGAAGAGACCTGCCAGATTATCAGACCTCTTCATGTTAAAAGACCATCTCCTGTAAAACTG
ACCTAGTGGACAAGCTGAATTTGAAATAGACTGTGAAGTAAGCTGTAACTTGTCATTTTAATTTTGTTTAACACGGTTACTGACTTAGAT
GATGTATTAAATACCAAGATAAAGAAAAATGCACCTAAAATCTAATTAGAATTCTCTGGGTCAACAAGTCAAGGTGGTATTGATCTGTGT
TAATCTGAGTAACTTATTGCCTAGCCTATAAATAAATTCCAAAATATCCAATTCATTTCTTCTTGAAATGGTGCTTGTTTTGTTTTCTTT
CCATTACACAATTAGACTCCTACAGTTTAAAACAAACTTTAAACCACTATCTTGCACTGCTAACTTTTTTCTACCTTTGTAAATAGAAAC
ATTTCTGCATAAAAGTCATACATATGAAGCAAGGGCTGAATCATAATCACAAGGCTTAATTTTGATAAACGAATCCAGTGACCTAAGGAT
TTTCTGCAAAATTTGACTGGGAGTTGTGATAGGTGGTATTTTTGTTTATTTTCTTCCTCTTACTCCTTAGGATAAAGGTAAGTTGACTTG
AACAACTTTCTTTTGCACTGGGAAAATAAGCAAATGTTTAAATGCTTCAAAAAAATTTTCAATTAAACTCAAATATTAAATATCTATAAC
TTATAAACACCAACTTTCAATGTAATAAATGTATCCTAATCTTATGTATGTTTAACTGGATTACATAGATTTTTATCTTTTGTTAAAATG
TGTATACCCCGTGGACCAACATAATATTAAAGTATGTATATATTATATAAATATATATGTATATGTGCTCGCTTGTGTAGGATGAATGTC
TTAGAGTCGTTTGTGGTATTTTATGTTGTTGACTCTGGCTCCAGGGCCTGTGCTTGAAAAGGACAGATAAGTATTGCCCAGAGCTAAGTG
GCACTACTTACAAAGTTTTAAATGTCTTCTACATACTGATTCATGTTTATTTGAGCTCTCTTTATAGAATTTTCTCTTAAAGTTTCAAAC
CTCTAAGTTGTAGCCTGTAATTATGAGAACAGTAAACTTTAAGTAATAATAAAGAATCCCATCCATATATCCAATTTGCAATTGAGTTTT
GCATGGTTCTCTGATTATGTCCATGCTGTGTCCAAGGAGGAGTAGGTACATACAATCAGCACAGATTAATATATGTAAAGGGTTTGGGAC

>In-frame_FAF1_ENST00000396153_chr1_51323601_-_EPS15_ENST00000371733_chr1_51946986_-_5661nt
AGGGGCGGAGGCGGCGGCCAGGGAGGAAGCGGAGGAGGCGGAGGCGGCCGCGGCGTTCGCCCGCCCGCTCGCTCGCTCGGTTTCCCCGCC
CCCGCCGGGCTTAACGCCGCTGAAGGTATCCGGGTGCGCGCTGTCGCAACCTGCCCTCATCCTGGCCCGCGACTGTAAGACCGGACCCAC
ATCCAGACCAATCTTCCTGTCCGGGCTGCTGCGACGCGGGCTCCGCAGGTTGCAGGCGGGCGGCCGGGGCGCCTGAAGGTTACCGAGTGC
ATGAGCGCCTAGCGCTTCCCGCGCTGCCCCGCCCGCTGGCCCGCCGACCCGCCCGCCGGCTCGCCCGCCAGCCCCTCGGCGCCCGGCGGC
GGCGGCGGCGGTGGCGGCGACGGTCGCAGGAGGTGCCGTCTGCCTCCCAGGTGCGCGCTTCGCTCCCGGAGCCGCGGAACTCGGCGGCCG
CCATGGCGTCCAACATGGACCGGGAGATGATCCTGGCGGATTTTCAGGCATGTACTGGCATTGAAAACATTGACGAAGCTATTACATTGC
TTGAACAAAATAATTGGGACTTAGTGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTGGAA
GGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACACAG
ATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGTA
GTTTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGGG
CTGTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAAC
CAGTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACAGAG
ATGAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCAT
CTAAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGATTTG
TGTCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAAAGG
ACTGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTTC
TTACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATTA
AGGAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATACTA
TTAAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAACAGC
AGGTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAGG
CCCAACTGATCTCTTCTCTGAAAGCTGAATTAACTAGTCAGGAATCGCAGATCTCCACTTACGAAGAAGAATTGGCAAAAGCTAGAGAAG
AGCTGAGCCGTCTACAGCAAGAAACAGCAGAATTGGAGGAGAGTGTAGAGTCAGGGAAGGCTCAGTTGGAACCTCTTCAGCAGCACCTAC
AAGATTCACAACAGGAAATTAGTTCAATGCAAATGAAACTGATGGAAATGAAAGATTTGGAAAATCATAATAGTCAGTTAAATTGGTGCA
GTAGCCCACACAGCATTCTTGTAAACGGAGCTACAGATTATTGCAGCCTCAGCACCAGCAGCAGTGAAACAGCCAACCTTAATGAACATG
TTGAAGGCCAGAGCAACCTAGAGTCTGAGCCCATACACCAGGAATCTCCAGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACTG
ATGAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTAATG
TAGACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGG
ATGATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAATCTA
CTGATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATGATC
CTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGTG
GATTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATTA
CAAAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCTGCC
CTCTACCACCTGGGAAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCAACG
ATAGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCAATT
TTGCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCC
GACTAAATCAGCAGGAACAAGAAGACTTAGAACTGGCTATTGCACTCAGCAAATCTGAGATATCAGAAGCATGAAGAATTCTCTTGTTCT
TTGGCAACAATATAGTATTCTTCTTCCTGAATACTGAAACTATTTACAATGTGTATCAAAACTACCTGTGAGCATGGGAATACAAAAGGT
TTGAGATTCCTGTAAATGTGACAAAATTTTAGGATTTTTTTTTTTTCTTCATTACAGATTCGTCTTTTTTTTTTTTTCTTATAAAAGCCG
TAACCCAGTCAGACAAATTCACCTTCACTTAGGCCCCTGTTCTGGTATACATTTACTGTGAGCTTTTGCCTGCCTGTGCTATTTTACTTG
TAAAGCTAGAGCACCCAAGCTTCTGCCTTCTGGAATATAGAGAAATAGTTTCACCCTGCACTACCCTGTTCTGTAGTTATTCTGATGATA
GCCAGTGAGGTTCTTAAAGTTTGCAGTATTCTCCCCTGATTGGAATGGTTGAGTGAGGGTAAGGGAAAGAATATCTTATTTCTTTTATGA
TTGGTGCAAATTGGCTAAAGTGCATTTTTAAATTTCCTCTACTTAATTTGTTTTTCAGAGATAAGGAAAAATATTTTGCACAGATTTACT
CCACTATGGAAAAGGGATGCTGTAGGTTGAACCATTATAGCCTCAGATTCGATCTTTTCCTAACTAAAAATATTAAAGCCTCATGTGTGA
AATAAATTTTTAAAAAGATTTATCTGGATTTAGAGAATTTTAGATCAACAGATACCTCTCAGTGTGTTTGCTAATTAATAAAAATCAGTT
TCTTACAAATAAAGTTTGTAAGAAAATGTTCATTTTAAGTGATAGATAGTGGAGAAAATTTATCACCTAAAATATACCCATCAGTATAAG
GCAAGCAAAAGTCTTAACATGGCAGCCATTCTGCCTTTGCCGTGGCCCTGTCCTGTTTAGTTCTTAGTGGGTTAATTTTTGTACTTTTGC
AGAAGAAACTTCAGCAAGCTAGAACTGGAAGGTACTTTAATTTTTCATATATATTTGTTTTTTTTTTTTTAATGAAGGCTCATTTACTTG
AAATGTAAAAACTTTCACTGAATACAAATAGAAAAAGTGATGTGTTTTATATCATATTGCTTTTTGTCCATCTTTGTGGTTTAGTTTATT
TACTCACTTCATGTTTTTCACCTATAAAATTGTCAAGCTAGCAAAAAAACTCTTGTTTTTTTAATTGGGAGAGAAGAGACCTGCCAGATT
ATCAGACCTCTTCATGTTAAAAGACCATCTCCTGTAAAACTGACCTAGTGGACAAGCTGAATTTGAAATAGACTGTGAAGTAAGCTGTAA
CTTGTCATTTTAATTTTGTTTAACACGGTTACTGACTTAGATGATGTATTAAATACCAAGATAAAGAAAAATGCACCTAAAATCTAATTA
GAATTCTCTGGGTCAACAAGTCAAGGTGGTATTGATCTGTGTTAATCTGAGTAACTTATTGCCTAGCCTATAAATAAATTCCAAAATATC
CAATTCATTTCTTCTTGAAATGGTGCTTGTTTTGTTTTCTTTCCATTACACAATTAGACTCCTACAGTTTAAAACAAACTTTAAACCACT
ATCTTGCACTGCTAACTTTTTTCTACCTTTGTAAATAGAAACATTTCTGCATAAAAGTCATACATATGAAGCAAGGGCTGAATCATAATC
ACAAGGCTTAATTTTGATAAACGAATCCAGTGACCTAAGGATTTTCTGCAAAATTTGACTGGGAGTTGTGATAGGTGGTATTTTTGTTTA
TTTTCTTCCTCTTACTCCTTAGGATAAAGGTAAGTTGACTTGAACAACTTTCTTTTGCACTGGGAAAATAAGCAAATGTTTAAATGCTTC
AAAAAAATTTTCAATTAAACTCAAATATTAAATATCTATAACTTATAAACACCAACTTTCAATGTAATAAATGTATCCTAATCTTATGTA
TGTTTAACTGGATTACATAGATTTTTATCTTTTGTTAAAATGTGTATACCCCGTGGACCAACATAATATTAAAGTATGTATATATTATAT
AAATATATATGTATATGTGCTCGCTTGTGTAGGATGAATGTCTTAGAGTCGTTTGTGGTATTTTATGTTGTTGACTCTGGCTCCAGGGCC
TGTGCTTGAAAAGGACAGATAAGTATTGCCCAGAGCTAAGTGGCACTACTTACAAAGTTTTAAATGTCTTCTACATACTGATTCATGTTT
ATTTGAGCTCTCTTTATAGAATTTTCTCTTAAAGTTTCAAACCTCTAAGTTGTAGCCTGTAATTATGAGAACAGTAAACTTTAAGTAATA
ATAAAGAATCCCATCCATATATCCAATTTGCAATTGAGTTTTGCATGGTTCTCTGATTATGTCCATGCTGTGTCCAAGGAGGAGTAGGTA


Top

FusionGenePPI for FAF1_EPS15


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FAF1ASCC2, FAS, CSNK2B, G3BP1, RAE1, CASP8, CTNNB1, VCP, NPLOC4, UFD1L, CUL1, CUL2, CUL3, UBR1, HIF1A, ALPP, VCPIP1, SKP1, FBXW11, KLHL22, KBTBD7, WDR26, AMFR, UBR2, UBR4, PJA2, CDC73, TAF1D, RAP1B, UROD, TK1, ANXA1, DNAJB11, CDKN1A, TNNT1, SIRT6, HSD17B10, RCC1, NR1H2, ANXA7, TSC22D1, NR4A1, ITGB1BP1, IGF2, RAD23A, BTRC, NGLY1, UBC, HSPA4, RELA, HSPA8, FADD, IKBKB, NLRP3, NLRP2, NLRP7, NLRP12, NUDT21, SKIL, CARM1, CARS, FAM114A1, FARSB, GART, HIRIP3, HIST1H4A, HSPH1, ILK, PLOD2, PPM1G, PPP2R5C, PRMT3, PUF60, RANBP3, RPL24, SAMHD1, SEC23A, SET, SF1, SWAP70, TLN1, TROVE2, UGP2, XPO7, VAPA, VAPB, UBL4A, ASNA1, GET4, BAG6, RPN2, DDOST, FAF1, CD40, MAGIX, TCEAL1, CBX3, DNAJA1, ZC3H15, NTRK1, RAP1A, CDT1, IPO5, WDR24, YTHDF1, CDC5L, KCTD10, YTHDF3, WDR59, MMAB, NUP98, MYCBP2, USP11, NSFL1C, UBXN7, UBXN1, ASPSCR1, HSPA2, MIOS, UBXN6, BTBD9, KCTD13, TNFAIP1, UBXN2B, BHLHA15, CHCHD10, CLEC3A, PRCC, TRIM25, XIAPEPS15RNF11, SNAP91, AGFG1, NAGPA, STON2, HGS, AP2A2, DNM2, AP2A1, EGFR, CLINT1, EPN1, SCAMP1, STAM2, GRB2, CRK, RAB11FIP2, REPS2, UBE2D1, UBE2D2, UBE2D3, UBE2H, UBE2E1, SLC6A3, PARK2, USP8, CD4, EPS15, OCLN, UBQLN1, UBC, NEDD4, GJA1, TGFB1, FCHO2, ITSN1, ITSN2, ELAVL1, RAD23A, UBQLN2, EPN3, SH3BP4, AP1B1, NUMB, SPG20, TFAP2A, ABL1, AP2B1, IQGAP1, KRT85, KRT1, KRT10, KRT2, AP2M1, KRT14, KRT86, KRT5, KRT6A, KRT16, KRT9, HSPA8, KRT35, HSPA9, KRT17, KRT33B, KRT83, BMP2K, KRT34, KRT82, NONO, KRT38, KRT75, KRT79, PRDX1, KRT36, KRT32, MAP4, HSPA1L, HSPA1B, KRT37, HSPA5, KRT73, AP2S1, NECAP2, TRAF2, MCCC2, KRT4, ACTB, KRT3, VPRBP, TUBB, HIST4H4, PCCB, KRTAP9-3, NECAP1, VSIG8, CCT3, CRKL, FN1, VCAM1, LAPTM5, ITGA4, OPTN, RABL6, EPHA2, CORO7, AGFG2, SLC25A41, AURKA, SPC25, NTRK1, TMEM17, XPO1, CAPZA2, CLTB, CLTC, DBN1, FLNA, GAK, MYH9, PPP1CB, PICALM, PDLIM7, SYNPO, MAPRE1, LIMA1, GTSE1, ANLN, MYO19, MAPK14, AP1G1, MYO6, SPOPL, SGIP1, FCHO1, CDH1, RUNDC3A, LSR, STAMBPL1, CCDC172, OXCT1, MTNR1A, RNF26


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneEPS15chr1:51171458chr1:51946986ENST00000371733-0252_33011897DAB2
TgeneEPS15chr1:51323601chr1:51946986ENST00000371733-0252_33011897DAB2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FAF1_EPS15


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FAF1_EPS15


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource