FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12366

FusionGeneSummary for EZH2_AUTS2

check button Fusion gene summary
Fusion gene informationFusion gene name: EZH2_AUTS2
Fusion gene ID: 12366
HgeneTgene
Gene symbol

EZH2

AUTS2

Gene ID

2146

26053

Gene nameenhancer of zeste 2 polycomb repressive complex 2 subunitAUTS2, activator of transcription and developmental regulator
SynonymsENX-1|ENX1|EZH2b|KMT6|KMT6A|WVS|WVS2FBRSL2|MRD26
Cytomap

7q36.1

7q11.22

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase EZH2enhancer of zeste homolog 2lysine N-methyltransferase 6autism susceptibility gene 2 proteinautism susceptibility candidate 2autism-related protein 1
Modification date2018052720180519
UniProtAcc

Q15910

Q8WXX7

Ensembl transtripts involved in fusion geneENST00000478654, ENST00000460911, 
ENST00000350995, ENST00000320356, 
ENST00000541220, ENST00000476773, 
ENST00000483967, ENST00000536783, 
ENST00000406775, ENST00000342771, 
ENST00000403018, ENST00000489774, 
Fusion gene scores* DoF score6 X 7 X 3=12618 X 16 X 6=1728
# samples 620
** MAII scorelog2(6/126*10)=-1.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/1728*10)=-3.11103131238874
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EZH2 [Title/Abstract] AND AUTS2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEZH2

GO:0000122

negative regulation of transcription by RNA polymerase II

20154697

HgeneEZH2

GO:0010718

positive regulation of epithelial to mesenchymal transition

20154697

HgeneEZH2

GO:0043406

positive regulation of MAP kinase activity

20154697

HgeneEZH2

GO:0043547

positive regulation of GTPase activity

20154697

HgeneEZH2

GO:0045814

negative regulation of gene expression, epigenetic

20154697

HgeneEZH2

GO:0070734

histone H3-K27 methylation

24474760

HgeneEZH2

GO:0071902

positive regulation of protein serine/threonine kinase activity

20154697

TgeneAUTS2

GO:0045944

positive regulation of transcription by RNA polymerase II

25519132

TgeneAUTS2

GO:0051571

positive regulation of histone H3-K4 methylation

25519132

TgeneAUTS2

GO:2000620

positive regulation of histone H4-K16 acetylation

25519132


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-34-5928-01AEZH2chr7

148543562

-AUTS2chr7

70227856

+
TCGALDLUSCTCGA-34-5928-01AEZH2chr7

148543589

-AUTS2chr7

70227856

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000478654ENST00000406775EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-3CDSENST00000478654ENST00000342771EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-intronENST00000478654ENST00000403018EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-intronENST00000478654ENST00000489774EZH2chr7

148543562

-AUTS2chr7

70227856

+
Frame-shitENST00000460911ENST00000406775EZH2chr7

148543562

-AUTS2chr7

70227856

+
Frame-shitENST00000460911ENST00000342771EZH2chr7

148543562

-AUTS2chr7

70227856

+
5CDS-intronENST00000460911ENST00000403018EZH2chr7

148543562

-AUTS2chr7

70227856

+
5CDS-intronENST00000460911ENST00000489774EZH2chr7

148543562

-AUTS2chr7

70227856

+
Frame-shitENST00000350995ENST00000406775EZH2chr7

148543562

-AUTS2chr7

70227856

+
Frame-shitENST00000350995ENST00000342771EZH2chr7

148543562

-AUTS2chr7

70227856

+
5CDS-intronENST00000350995ENST00000403018EZH2chr7

148543562

-AUTS2chr7

70227856

+
5CDS-intronENST00000350995ENST00000489774EZH2chr7

148543562

-AUTS2chr7

70227856

+
Frame-shitENST00000320356ENST00000406775EZH2chr7

148543562

-AUTS2chr7

70227856

+
Frame-shitENST00000320356ENST00000342771EZH2chr7

148543562

-AUTS2chr7

70227856

+
5CDS-intronENST00000320356ENST00000403018EZH2chr7

148543562

-AUTS2chr7

70227856

+
5CDS-intronENST00000320356ENST00000489774EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-3CDSENST00000541220ENST00000406775EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-3CDSENST00000541220ENST00000342771EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-intronENST00000541220ENST00000403018EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-intronENST00000541220ENST00000489774EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-3CDSENST00000476773ENST00000406775EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-3CDSENST00000476773ENST00000342771EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-intronENST00000476773ENST00000403018EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-intronENST00000476773ENST00000489774EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-3CDSENST00000483967ENST00000406775EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-3CDSENST00000483967ENST00000342771EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-intronENST00000483967ENST00000403018EZH2chr7

148543562

-AUTS2chr7

70227856

+
intron-intronENST00000483967ENST00000489774EZH2chr7

148543562

-AUTS2chr7

70227856

+
5UTR-3CDSENST00000536783ENST00000406775EZH2chr7

148543562

-AUTS2chr7

70227856

+
5UTR-3CDSENST00000536783ENST00000342771EZH2chr7

148543562

-AUTS2chr7

70227856

+
5UTR-intronENST00000536783ENST00000403018EZH2chr7

148543562

-AUTS2chr7

70227856

+
5UTR-intronENST00000536783ENST00000489774EZH2chr7

148543562

-AUTS2chr7

70227856

+
In-frameENST00000478654ENST00000406775EZH2chr7

148543589

-AUTS2chr7

70227856

+
In-frameENST00000478654ENST00000342771EZH2chr7

148543589

-AUTS2chr7

70227856

+
5CDS-intronENST00000478654ENST00000403018EZH2chr7

148543589

-AUTS2chr7

70227856

+
5CDS-intronENST00000478654ENST00000489774EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-3CDSENST00000460911ENST00000406775EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-3CDSENST00000460911ENST00000342771EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-intronENST00000460911ENST00000403018EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-intronENST00000460911ENST00000489774EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-3CDSENST00000350995ENST00000406775EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-3CDSENST00000350995ENST00000342771EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-intronENST00000350995ENST00000403018EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-intronENST00000350995ENST00000489774EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-3CDSENST00000320356ENST00000406775EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-3CDSENST00000320356ENST00000342771EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-intronENST00000320356ENST00000403018EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-intronENST00000320356ENST00000489774EZH2chr7

148543589

-AUTS2chr7

70227856

+
Frame-shitENST00000541220ENST00000406775EZH2chr7

148543589

-AUTS2chr7

70227856

+
Frame-shitENST00000541220ENST00000342771EZH2chr7

148543589

-AUTS2chr7

70227856

+
5CDS-intronENST00000541220ENST00000403018EZH2chr7

148543589

-AUTS2chr7

70227856

+
5CDS-intronENST00000541220ENST00000489774EZH2chr7

148543589

-AUTS2chr7

70227856

+
In-frameENST00000476773ENST00000406775EZH2chr7

148543589

-AUTS2chr7

70227856

+
In-frameENST00000476773ENST00000342771EZH2chr7

148543589

-AUTS2chr7

70227856

+
5CDS-intronENST00000476773ENST00000403018EZH2chr7

148543589

-AUTS2chr7

70227856

+
5CDS-intronENST00000476773ENST00000489774EZH2chr7

148543589

-AUTS2chr7

70227856

+
Frame-shitENST00000483967ENST00000406775EZH2chr7

148543589

-AUTS2chr7

70227856

+
Frame-shitENST00000483967ENST00000342771EZH2chr7

148543589

-AUTS2chr7

70227856

+
5CDS-intronENST00000483967ENST00000403018EZH2chr7

148543589

-AUTS2chr7

70227856

+
5CDS-intronENST00000483967ENST00000489774EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-3CDSENST00000536783ENST00000406775EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-3CDSENST00000536783ENST00000342771EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-intronENST00000536783ENST00000403018EZH2chr7

148543589

-AUTS2chr7

70227856

+
intron-intronENST00000536783ENST00000489774EZH2chr7

148543589

-AUTS2chr7

70227856

+

Top

FusionProtFeatures for EZH2_AUTS2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EZH2

Q15910

AUTS2

Q8WXX7

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain thetranscriptionally repressive state of many genes, including Hoxgenes, throughout development. PcG PRC1 complex acts via chromatinremodeling and modification of histones; it mediatesmonoubiquitination of histone H2A 'Lys-119', rendering chromatinheritably changed in its expressibility (PubMed:25519132). ThePRC1-like complex that contains PCGF5, RNF2, CSNK2B, RYBP andAUTS2 has decreased histone H2A ubiquitination activity, due tothe phosphorylation of RNF2 by CSNK2B (PubMed:25519132). As aconsequence, the complex mediates transcriptional activation(PubMed:25519132). In the cytoplasm, plays a role in axon anddendrite elongation and in neuronal migration during embryonicbrain development. Promotes reorganization of the actincytoskeleton, lamellipodia formation and neurite elongation viaits interaction with RAC guanine nucleotide exchange factors,which then leads to the activation of RAC1 (By similarity).{ECO:0000250|UniProtKB:A0A087WPF7, ECO:0000269|PubMed:25519132}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAUTS2chr7:148543589chr7:70227856ENST00000342771+5191122_11812471260Compositional biasHis-rich
TgeneAUTS2chr7:148543589chr7:70227856ENST00000342771+519288_4712471260Compositional biasPro-rich
TgeneAUTS2chr7:148543589chr7:70227856ENST00000342771+519525_5482471260Compositional biasHis-rich
TgeneAUTS2chr7:148543589chr7:70227856ENST00000342771+519545_6462471260Compositional biasPro-rich
TgeneAUTS2chr7:148543589chr7:70227856ENST00000403018+051122_1181-15267Compositional biasHis-rich
TgeneAUTS2chr7:148543589chr7:70227856ENST00000403018+05288_471-15267Compositional biasPro-rich
TgeneAUTS2chr7:148543589chr7:70227856ENST00000403018+05525_548-15267Compositional biasHis-rich
TgeneAUTS2chr7:148543589chr7:70227856ENST00000403018+05545_646-15267Compositional biasPro-rich
TgeneAUTS2chr7:148543589chr7:70227856ENST00000406775+5181122_11812471236Compositional biasHis-rich
TgeneAUTS2chr7:148543589chr7:70227856ENST00000406775+518288_4712471236Compositional biasPro-rich
TgeneAUTS2chr7:148543589chr7:70227856ENST00000406775+518525_5482471236Compositional biasHis-rich
TgeneAUTS2chr7:148543589chr7:70227856ENST00000406775+518545_6462471236Compositional biasPro-rich
TgeneAUTS2chr7:148543589chr7:70227856ENST00000342771+519289_4722471260RegionImportant for regulation of lamellipodia formation
TgeneAUTS2chr7:148543589chr7:70227856ENST00000403018+05289_472-15267RegionImportant for regulation of lamellipodia formation
TgeneAUTS2chr7:148543589chr7:70227856ENST00000406775+518289_4722471236RegionImportant for regulation of lamellipodia formation

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEZH2chr7:148543589chr7:70227856ENST00000320356-120523_605-41752Compositional biasNote=Cys-rich
HgeneEZH2chr7:148543589chr7:70227856ENST00000350995-119523_605-31708Compositional biasNote=Cys-rich
HgeneEZH2chr7:148543589chr7:70227856ENST00000460911-120523_605-30747Compositional biasNote=Cys-rich
HgeneEZH2chr7:148543589chr7:70227856ENST00000476773-319523_60573696Compositional biasNote=Cys-rich
HgeneEZH2chr7:148543589chr7:70227856ENST00000478654-420523_60573696Compositional biasNote=Cys-rich
HgeneEZH2chr7:148543589chr7:70227856ENST00000483967-320523_60573738Compositional biasNote=Cys-rich
HgeneEZH2chr7:148543589chr7:70227856ENST00000541220-319523_60573696Compositional biasNote=Cys-rich
HgeneEZH2chr7:148543589chr7:70227856ENST00000320356-120503_605-41752DomainCXC
HgeneEZH2chr7:148543589chr7:70227856ENST00000320356-120612_727-41752DomainSET
HgeneEZH2chr7:148543589chr7:70227856ENST00000350995-119503_605-31708DomainCXC
HgeneEZH2chr7:148543589chr7:70227856ENST00000350995-119612_727-31708DomainSET
HgeneEZH2chr7:148543589chr7:70227856ENST00000460911-120503_605-30747DomainCXC
HgeneEZH2chr7:148543589chr7:70227856ENST00000460911-120612_727-30747DomainSET
HgeneEZH2chr7:148543589chr7:70227856ENST00000476773-319503_60573696DomainCXC
HgeneEZH2chr7:148543589chr7:70227856ENST00000476773-319612_72773696DomainSET
HgeneEZH2chr7:148543589chr7:70227856ENST00000478654-420503_60573696DomainCXC
HgeneEZH2chr7:148543589chr7:70227856ENST00000478654-420612_72773696DomainSET
HgeneEZH2chr7:148543589chr7:70227856ENST00000483967-320503_60573738DomainCXC
HgeneEZH2chr7:148543589chr7:70227856ENST00000483967-320612_72773738DomainSET
HgeneEZH2chr7:148543589chr7:70227856ENST00000541220-319503_60573696DomainCXC
HgeneEZH2chr7:148543589chr7:70227856ENST00000541220-319612_72773696DomainSET


Top

FusionGeneSequence for EZH2_AUTS2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EZH2_ENST00000478654_chr7_148543589_-_AUTS2_ENST00000406775_chr7_70227856_+_1061aa
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSIRS_VLARYQNMTARMQ
GRLSPRTRV_REARRRARTVAKSQSLSLWCLKTPALRSHSQYPSRRRSPNSELLLRTLTWCSAQRPHLNPHL_VHSHHRALLRPSSSLPR
SLRCRGHPGHSPPPSCSIRTSHLCRPTPLLRASPSHCQPTTAVA_ASTV_AAAEAALQRRLSPPHLTSPTTPLPPRSPSPCPTTAPCTAS
HPPSSPPHTHITPICLPLPLLCLLHHH_HQEVCRWPDTRPGALTQSKTSCDRN_TLVFWPLRVLTAGLPWALRPTCGPSSISTSTSTSTP
TSTRTSTPSRRSPTPSHPPPSCRRQHLPCLTNTLQKLTHSTGTVSSIPILLQCRASPL_SHPLALLVHYKEHFSRS_QILSDLC_GNQGS
GVLCMFTSPGRFTTTNRKSRNRCSQTHISWTLD_NLSS_AALQAPVFLEPSTTPMTWHGLQLCSLPLVLHTQLGPLLGHLLITATSSTLL
PT_SLLIGRLHSQA_QQLVAMPSGDLEILPLHPTQCSATRMAPVCRTLATLTNPGTGCTERLRRSRPLRPG_SQGSWSAARPLQLMTEIE
M_INETHLLVKMTKKGKASRRDTPATLHQHLSSR_MPWDIPAAPLNRSGLI_TLRLGRRTNPKRGRETTRNPARTWPPTSTRRKRATCPR
RTGTATRGAPRAKRPSSWPGCRLPTCGPRWWRVPGPTAPRAGRPSRARVSRPTRTPRRAPRSR_RRSGRKTMTCLQRPRRPTGPRSRRLP
TPRPACTRGPWPRCP_RWG_RAFTP_TASAAWTGLA__PPSWASAPSRAESASRTLLSTGTPSGTP_GILTENLTFTGETRWAGTSC_GT
TRSTGSRLPGCTKPTAPSGTGSLTTTATTTTTTTTRCLWTLGGSTSGEATWTSGSACTCSEKTTSTRGSTPCTPPPSTDTSPTPASSPRD

>In-frame_EZH2_ENST00000478654_chr7_148543589_-_AUTS2_ENST00000342771_chr7_70227856_+_1085aa
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSIRS_VLARYQNMTARMQ
GRLSPRTRV_REARRRARTVAKSQSLSLWCLKTPALRSHSQYPSRRRSPNSELLLRTLTWCSAQRPHLNPHL_VHSHHRALLRPSSSLPR
SLRCRGHPGHSPPPSCSIRTSHLCRPTPLLRASPSHCQPTTAVA_ASTV_AAAEAALQRRLSPPHLTSPTTPLPPRSPSPCPTTAPCTAS
HPPSSPPHTHITPICLPLPLLCLLHHH_HQEVCRWPDTRPGALTQSKTSCDRN_TLVFWPLRVLTAGLPWALRPTCGPSSISTSTSTSTP
TSTRTSTPSRRSPTPSHPPPSCRRQHLPCLTNTLQKLTHSTGTVSSIPILLQCRASPL_SHPLALLVHYKEHFSRRHPTLSMSLLGLGQS
HTLYSKRTRG_QILSDLC_GNQGSGVLCMFTSPGRFTTTNRKSRNRCSQTHISWTLD_NLSS_AALQAPVFLEPSTTPMTWHGLQLCSLP
LVLHTQLGPLLGHLLITATSSTLLPT_SLLIGRLHSQA_QQLVAMPSGDLEILPLHPTQCSATRMAPVCRTLATLTNPGTGCTERLRRSR
PLRPG_SQGSWSAARPLQLMTEIEM_INETHLLVKMTKKGKASRRDTPATLHQHLSSR_MPWDIPAAPLNRSGLI_TLRLGRRTNPKRGR
ETTRNPARTWPPTSTRRKRATCPRRTGTATRGAPRAKRPSSWPGCRLPTCGPRWWRVPGPTAPRAGRPSRARVSRPTRTPRRAPRSR_RR
SGRKTMTCLQRPRRPTGPRSRRLPTPRPACTRGPWPRCP_RWG_RAFTP_TASAAWTGLA__PPSWASAPSRAESASRTLLSTGTPSGTP
_GILTENLTFTGETRWAGTSC_GTTRSTGSRLPGCTKPTAPSGTGSLTTTATTTTTTTTRCLWTLGGSTSGEATWTSGSACTCSEKTTST
RGSTPCTPPPSTDTSPTPASSPRDSPACTIPASAPPRATRTDSSTRPLRQQR_AHLPRSSPRWGAARSLPEGRLLCPQR_GRGPLPTR_R

>In-frame_EZH2_ENST00000476773_chr7_148543589_-_AUTS2_ENST00000406775_chr7_70227856_+_1061aa
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSIRS_VLARYQNMTARMQ
GRLSPRTRV_REARRRARTVAKSQSLSLWCLKTPALRSHSQYPSRRRSPNSELLLRTLTWCSAQRPHLNPHL_VHSHHRALLRPSSSLPR
SLRCRGHPGHSPPPSCSIRTSHLCRPTPLLRASPSHCQPTTAVA_ASTV_AAAEAALQRRLSPPHLTSPTTPLPPRSPSPCPTTAPCTAS
HPPSSPPHTHITPICLPLPLLCLLHHH_HQEVCRWPDTRPGALTQSKTSCDRN_TLVFWPLRVLTAGLPWALRPTCGPSSISTSTSTSTP
TSTRTSTPSRRSPTPSHPPPSCRRQHLPCLTNTLQKLTHSTGTVSSIPILLQCRASPL_SHPLALLVHYKEHFSRS_QILSDLC_GNQGS
GVLCMFTSPGRFTTTNRKSRNRCSQTHISWTLD_NLSS_AALQAPVFLEPSTTPMTWHGLQLCSLPLVLHTQLGPLLGHLLITATSSTLL
PT_SLLIGRLHSQA_QQLVAMPSGDLEILPLHPTQCSATRMAPVCRTLATLTNPGTGCTERLRRSRPLRPG_SQGSWSAARPLQLMTEIE
M_INETHLLVKMTKKGKASRRDTPATLHQHLSSR_MPWDIPAAPLNRSGLI_TLRLGRRTNPKRGRETTRNPARTWPPTSTRRKRATCPR
RTGTATRGAPRAKRPSSWPGCRLPTCGPRWWRVPGPTAPRAGRPSRARVSRPTRTPRRAPRSR_RRSGRKTMTCLQRPRRPTGPRSRRLP
TPRPACTRGPWPRCP_RWG_RAFTP_TASAAWTGLA__PPSWASAPSRAESASRTLLSTGTPSGTP_GILTENLTFTGETRWAGTSC_GT
TRSTGSRLPGCTKPTAPSGTGSLTTTATTTTTTTTRCLWTLGGSTSGEATWTSGSACTCSEKTTSTRGSTPCTPPPSTDTSPTPASSPRD

>In-frame_EZH2_ENST00000476773_chr7_148543589_-_AUTS2_ENST00000342771_chr7_70227856_+_1085aa
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSIRS_VLARYQNMTARMQ
GRLSPRTRV_REARRRARTVAKSQSLSLWCLKTPALRSHSQYPSRRRSPNSELLLRTLTWCSAQRPHLNPHL_VHSHHRALLRPSSSLPR
SLRCRGHPGHSPPPSCSIRTSHLCRPTPLLRASPSHCQPTTAVA_ASTV_AAAEAALQRRLSPPHLTSPTTPLPPRSPSPCPTTAPCTAS
HPPSSPPHTHITPICLPLPLLCLLHHH_HQEVCRWPDTRPGALTQSKTSCDRN_TLVFWPLRVLTAGLPWALRPTCGPSSISTSTSTSTP
TSTRTSTPSRRSPTPSHPPPSCRRQHLPCLTNTLQKLTHSTGTVSSIPILLQCRASPL_SHPLALLVHYKEHFSRRHPTLSMSLLGLGQS
HTLYSKRTRG_QILSDLC_GNQGSGVLCMFTSPGRFTTTNRKSRNRCSQTHISWTLD_NLSS_AALQAPVFLEPSTTPMTWHGLQLCSLP
LVLHTQLGPLLGHLLITATSSTLLPT_SLLIGRLHSQA_QQLVAMPSGDLEILPLHPTQCSATRMAPVCRTLATLTNPGTGCTERLRRSR
PLRPG_SQGSWSAARPLQLMTEIEM_INETHLLVKMTKKGKASRRDTPATLHQHLSSR_MPWDIPAAPLNRSGLI_TLRLGRRTNPKRGR
ETTRNPARTWPPTSTRRKRATCPRRTGTATRGAPRAKRPSSWPGCRLPTCGPRWWRVPGPTAPRAGRPSRARVSRPTRTPRRAPRSR_RR
SGRKTMTCLQRPRRPTGPRSRRLPTPRPACTRGPWPRCP_RWG_RAFTP_TASAAWTGLA__PPSWASAPSRAESASRTLLSTGTPSGTP
_GILTENLTFTGETRWAGTSC_GTTRSTGSRLPGCTKPTAPSGTGSLTTTATTTTTTTTRCLWTLGGSTSGEATWTSGSACTCSEKTTST
RGSTPCTPPPSTDTSPTPASSPRDSPACTIPASAPPRATRTDSSTRPLRQQR_AHLPRSSPRWGAARSLPEGRLLCPQR_GRGPLPTR_R


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EZH2_ENST00000478654_chr7_148543589_-_AUTS2_ENST00000406775_chr7_70227856_+_3185nt
ATGGGCCAGACTGGGAAGAAATCTGAGAAGGGACCAGTTTGTTGGCGGAAGCGTGTAAAATCAGAGTACATGCGACTGAGACAGCTCAAG
AGGTTCAGACGAGCTGATGAAGTAAAGAGTATGTTTAGTTCCAATCGTCAGAAAATTTTGGAAAGAACGGAAATCTTAAACCAAGAATGG
AAACAGCGAAGGATACAGCCTGTGCACATCCTGACTTCTATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAG
GGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGC
TTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGG
TGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGC
AGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTC
AGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGA
CTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCA
CACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAG
GAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCT
CTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCC
ACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTG
ACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCC
CACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGT
GGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGG
ACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTT
CAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTG
CCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCG
TTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAA
CGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAG
ATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCAC
CTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACA
AACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGA
AGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGG
TGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCG
AGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCA
ACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCA
GCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGG
ACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACG
ACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACC
ACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCA
GAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGAC
TCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCG
CACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCC

>In-frame_EZH2_ENST00000478654_chr7_148543589_-_AUTS2_ENST00000342771_chr7_70227856_+_3257nt
ATGGGCCAGACTGGGAAGAAATCTGAGAAGGGACCAGTTTGTTGGCGGAAGCGTGTAAAATCAGAGTACATGCGACTGAGACAGCTCAAG
AGGTTCAGACGAGCTGATGAAGTAAAGAGTATGTTTAGTTCCAATCGTCAGAAAATTTTGGAAAGAACGGAAATCTTAAACCAAGAATGG
AAACAGCGAAGGATACAGCCTGTGCACATCCTGACTTCTATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAG
GGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGC
TTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGG
TGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGC
AGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTC
AGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGA
CTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCA
CACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAG
GAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCT
CTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCC
ACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTG
ACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCC
CACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCC
CACACACTTTACTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTC
ACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTG
AGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCG
CTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTA
ATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGT
TCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGA
CCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACT
CATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATG
CCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGA
GAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACG
AGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCA
ACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGG
AGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGC
ACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCA
TGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCT
TGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCT
CGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGC
TGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACA
CGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATC
CCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCT
CCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGG

>In-frame_EZH2_ENST00000476773_chr7_148543589_-_AUTS2_ENST00000406775_chr7_70227856_+_3185nt
ATGGGCCAGACTGGGAAGAAATCTGAGAAGGGACCAGTTTGTTGGCGGAAGCGTGTAAAATCAGAGTACATGCGACTGAGACAGCTCAAG
AGGTTCAGACGAGCTGATGAAGTAAAGAGTATGTTTAGTTCCAATCGTCAGAAAATTTTGGAAAGAACGGAAATCTTAAACCAAGAATGG
AAACAGCGAAGGATACAGCCTGTGCACATCCTGACTTCTATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAG
GGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGC
TTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGG
TGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGC
AGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTC
AGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGA
CTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCA
CACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAG
GAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCT
CTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCC
ACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTG
ACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCC
CACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGT
GGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGG
ACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTT
CAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTG
CCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCG
TTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAA
CGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAG
ATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCAC
CTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACA
AACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGA
AGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGG
TGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCG
AGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCA
ACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCA
GCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGG
ACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACG
ACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACC
ACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCA
GAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGAC
TCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCG
CACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCC

>In-frame_EZH2_ENST00000476773_chr7_148543589_-_AUTS2_ENST00000342771_chr7_70227856_+_3257nt
ATGGGCCAGACTGGGAAGAAATCTGAGAAGGGACCAGTTTGTTGGCGGAAGCGTGTAAAATCAGAGTACATGCGACTGAGACAGCTCAAG
AGGTTCAGACGAGCTGATGAAGTAAAGAGTATGTTTAGTTCCAATCGTCAGAAAATTTTGGAAAGAACGGAAATCTTAAACCAAGAATGG
AAACAGCGAAGGATACAGCCTGTGCACATCCTGACTTCTATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAG
GGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGC
TTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGG
TGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGC
AGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTC
AGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGA
CTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCA
CACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAG
GAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCT
CTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCC
ACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTG
ACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCC
CACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCC
CACACACTTTACTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTC
ACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTG
AGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCG
CTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTA
ATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGT
TCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGA
CCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACT
CATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATG
CCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGA
GAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACG
AGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCA
ACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGG
AGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGC
ACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCA
TGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCT
TGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCT
CGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGC
TGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACA
CGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATC
CCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCT
CCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_EZH2_ENST00000478654_chr7_148543589_-_AUTS2_ENST00000406775_chr7_70227856_+_4864nt
CGCGCCGCTGCGGGCGGCCCGGCCGGCGGGGCTCCGGGAGTGCGAACCGGGCGGCGGCGGCGGCGCCAGGACCTCCCCGCCACTGCTGTG
CCGGTCCCGGGGTTACTTTTTGAAAGCGGGAGGAATCGAGAAGCACGATCTTTTGGAAAACTTGGTGAACGCCTAAATAATCATGGGCCA
GACTGGGAAGAAATCTGAGAAGGGACCAGTTTGTTGGCGGAAGCGTGTAAAATCAGAGTACATGCGACTGAGACAGCTCAAGAGGTTCAG
ACGAGCTGATGAAGTAAAGAGTATGTTTAGTTCCAATCGTCAGAAAATTTTGGAAAGAACGGAAATCTTAAACCAAGAATGGAAACAGCG
AAGGATACAGCCTGTGCACATCCTGACTTCTATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATT
GTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGAC
CCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGC
ACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAG
GTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTC
TCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCC
GCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACC
CTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTG
CAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGT
GCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCAC
ACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATAC
CCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACT
GGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCT
ATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGA
CTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTG
TTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTA
GAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCC
AACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCG
TCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGAT
AAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTC
CCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAA
GAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGG
CACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGT
GCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAG
GTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCG
TCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGAC
AGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATC
CGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTC
CACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCAC
CACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGAC
TACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGC
ATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCC
CCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCAC
ACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAG
AGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTT
GAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATA
AAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCC
ACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGT
TCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGT
GCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTA
TGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTT
CCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCC
AGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGT
GCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACAC
ACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACC
CAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGT
TTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAG
GGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAA
TACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATA
TATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTATATTAAAGTGCTATCTGACGTTGTTATCCTGTTTTTGCAAAAAAAAAAAA

>In-frame_EZH2_ENST00000478654_chr7_148543589_-_AUTS2_ENST00000342771_chr7_70227856_+_5501nt
CGCGCCGCTGCGGGCGGCCCGGCCGGCGGGGCTCCGGGAGTGCGAACCGGGCGGCGGCGGCGGCGCCAGGACCTCCCCGCCACTGCTGTG
CCGGTCCCGGGGTTACTTTTTGAAAGCGGGAGGAATCGAGAAGCACGATCTTTTGGAAAACTTGGTGAACGCCTAAATAATCATGGGCCA
GACTGGGAAGAAATCTGAGAAGGGACCAGTTTGTTGGCGGAAGCGTGTAAAATCAGAGTACATGCGACTGAGACAGCTCAAGAGGTTCAG
ACGAGCTGATGAAGTAAAGAGTATGTTTAGTTCCAATCGTCAGAAAATTTTGGAAAGAACGGAAATCTTAAACCAAGAATGGAAACAGCG
AAGGATACAGCCTGTGCACATCCTGACTTCTATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATT
GTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGAC
CCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGC
ACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAG
GTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTC
TCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCC
GCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACC
CTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTG
CAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGT
GCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCAC
ACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATAC
CCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACT
GGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACT
TTACTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCC
TGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTG
AGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCT
GCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCG
TCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCAC
AAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCG
CCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTT
AGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGA
CATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCAC
TCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGC
GCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACC
TCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAG
GAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGG
CCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACC
CCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGAT
CCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCC
CGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTG
GACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTC
CACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATC
AGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTG
GGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAG
GCCCGATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATG
GCTCACACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTA
TATGTTGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAAC
CAAAACAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAA
AATTCTTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGT
AAGATGAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACT
TAATATCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGC
TTTTCACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTAC
GTGATATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATC
TGAAGTTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATT
TGCCAGATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACC
ATGCCTTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGA
AAGCTTCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACT
GTATTCCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAA
AAAAAGTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTC
TACATATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATT
AGTTCCATTTGGTCTTCTAGTATATTAAAGTGCTATCTGACGTTGTTATCCTGTTTTTGCAAAAAAAAAAAAAAAAAAAAGTTAACTACA
GACCATTGTTTCTAATAAGCAGAGAGATCTATTTTAGTAGTAAACTGAAGGTTTAGTTGTGAGCTTCAGATTTTGTGAACTCCAGATGTT
GTGCGGTGTTTTTTTTTTTTTTTAAGACAACAACTAAAAAAAATGCAAGGAATATGTACACTGGAACTGTAGTGGTAGCTTTCAGTATTG
TAAAGAGATTGTTCTATACGGACCTTTTTGCTGTTTATCCTGTATGTAATAAAGTCCTTTCTAGATCCTATGTGAAAAGAAAAGTGAAGC
AACTGAATCTTCAGCATGTTCTCATCGGCGGAGCCTTCTTGTGTAATGTAAACTGTGCCATGTTATTAAAAAATGTGAACTAAGCTTCCA
GCTGCTTGTTTGTGTGAGGTGACCATCATTACCTTAGGGAAGAAGCCATACCTGTACAAGACCGGGCTCTTGAAAAGAAACACCTCGAAC
CCAGCCCGTGTAAGAACAGAAGGCTCACCTGCAGTGGCTGACCACCCTACCCAACTCGGTTAGTGTCTCACCAATTTGTTACTATAAACA

>In-frame_EZH2_ENST00000476773_chr7_148543589_-_AUTS2_ENST00000406775_chr7_70227856_+_5012nt
GACGACGTTCGCGGCGGGGAACTCGGAGTAGCTTCGCCTCTGACGTTTCCCCACGACGCACCCCGAAATCCCCCTGAGCTCCGGCGGTCG
CGGGCTGCCCTCGCCGCCTGGTCTGGCTTTATGCTAAGTTTGAGGGAAGAGTCGAGCTGCTCTGCTCTCTATTGATTGTGTTTCTGGAGG
GCGTCCTGTTGAATTCCCACTTCATTGTGTACATCCCCTTCCGTTCCCCCCAAAAATCTGTGCCACAGGGTTACTTTTTGAAAGCGGGAG
GAATCGAGAAGCACGATCTTTTGGAAAACTTGGTGAACGCCTAAATAATCATGGGCCAGACTGGGAAGAAATCTGAGAAGGGACCAGTTT
GTTGGCGGAAGCGTGTAAAATCAGAGTACATGCGACTGAGACAGCTCAAGAGGTTCAGACGAGCTGATGAAGTAAAGAGTATGTTTAGTT
CCAATCGTCAGAAAATTTTGGAAAGAACGGAAATCTTAAACCAAGAATGGAAACAGCGAAGGATACAGCCTGTGCACATCCTGACTTCTA
TCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCA
GGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCA
GCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAG
TACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCAC
CCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAG
CTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGC
CTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAA
TATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTA
CTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCC
CTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCA
CGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAG
TCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCA
GCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCA
CCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGG
CCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGG
GACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGG
CCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAG
TGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCC
AGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAA
AGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTC
CACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAA
GGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGA
GGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGC
CGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCT
GCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGAT
GCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCAT
CAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACT
TGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGC
CGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGA
GCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCC
CGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGG
CAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGT
CTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGA
GAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTG
GGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTT
TCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGA
TGACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATG
AGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTT
ACTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAAC
ACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCC
CGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTG
TTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTT
GTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAA
ATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGT
GTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTT
CTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGT
GATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGT
GTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGA
GAATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTC

>In-frame_EZH2_ENST00000476773_chr7_148543589_-_AUTS2_ENST00000342771_chr7_70227856_+_5649nt
GACGACGTTCGCGGCGGGGAACTCGGAGTAGCTTCGCCTCTGACGTTTCCCCACGACGCACCCCGAAATCCCCCTGAGCTCCGGCGGTCG
CGGGCTGCCCTCGCCGCCTGGTCTGGCTTTATGCTAAGTTTGAGGGAAGAGTCGAGCTGCTCTGCTCTCTATTGATTGTGTTTCTGGAGG
GCGTCCTGTTGAATTCCCACTTCATTGTGTACATCCCCTTCCGTTCCCCCCAAAAATCTGTGCCACAGGGTTACTTTTTGAAAGCGGGAG
GAATCGAGAAGCACGATCTTTTGGAAAACTTGGTGAACGCCTAAATAATCATGGGCCAGACTGGGAAGAAATCTGAGAAGGGACCAGTTT
GTTGGCGGAAGCGTGTAAAATCAGAGTACATGCGACTGAGACAGCTCAAGAGGTTCAGACGAGCTGATGAAGTAAAGAGTATGTTTAGTT
CCAATCGTCAGAAAATTTTGGAAAGAACGGAAATCTTAAACCAAGAATGGAAACAGCGAAGGATACAGCCTGTGCACATCCTGACTTCTA
TCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCA
GGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCA
GCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAG
TACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCAC
CCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAG
CTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGC
CTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAA
TATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTA
CTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCC
CTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCA
CGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAG
TCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCA
GCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGGACCCGAGGTTGACAGATCC
TTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAA
GAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGC
CATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACC
TCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGG
CAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAA
CCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAG
CGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGA
GAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGC
TCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGA
GCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCG
GGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGA
GCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCA
GACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGT
GACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGG
AGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGA
CCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGA
CCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCA
CCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACA
CCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCT
CAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGAC
TCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACAGGAGCAAGAACGA
GGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGGGAAAGCCCCACCC
CTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGATCTTTTAGCCCAG
TCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACAACACACACCAATT
GGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTGGGAAGGCCGTGTA
CATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTTGTACAAATGTAAA
TAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGTCGGCTAAAGCTGT
GTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCTAACTCAAAGGAGC
CTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTCCTTGCTTGTTTTT
TTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGGCTCTGGGGGAAAG
TGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAGGGGACGGGTGGTG
GTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTCCTATTTCATACCT
GTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAGATGATGGATATGT
TTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCAAGTCTGGGAACAG
CCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAGTGTGTTTTTTGAG
TTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATATGACTTTACTAGC
AGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTAGTATATTAAAGTG
CTATCTGACGTTGTTATCCTGTTTTTGCAAAAAAAAAAAAAAAAAAAAGTTAACTACAGACCATTGTTTCTAATAAGCAGAGAGATCTAT
TTTAGTAGTAAACTGAAGGTTTAGTTGTGAGCTTCAGATTTTGTGAACTCCAGATGTTGTGCGGTGTTTTTTTTTTTTTTTAAGACAACA
ACTAAAAAAAATGCAAGGAATATGTACACTGGAACTGTAGTGGTAGCTTTCAGTATTGTAAAGAGATTGTTCTATACGGACCTTTTTGCT
GTTTATCCTGTATGTAATAAAGTCCTTTCTAGATCCTATGTGAAAAGAAAAGTGAAGCAACTGAATCTTCAGCATGTTCTCATCGGCGGA
GCCTTCTTGTGTAATGTAAACTGTGCCATGTTATTAAAAAATGTGAACTAAGCTTCCAGCTGCTTGTTTGTGTGAGGTGACCATCATTAC
CTTAGGGAAGAAGCCATACCTGTACAAGACCGGGCTCTTGAAAAGAAACACCTCGAACCCAGCCCGTGTAAGAACAGAAGGCTCACCTGC


Top

FusionGenePPI for EZH2_AUTS2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EZH2VAV1, EED, CCDC85B, ATRX, HDAC1, HDAC2, PHF1, ATP1A1, NINL, PSMB6, WDR61, RPN2, WSB2, GTF3C1, KLHDC2, PIN4, POLA2, SUZ12, ZMYND11, E2F6, SNAI1, JARID2, MTF2, RBBP4, KDM2B, EZH1, EZH2, CTNNB1, EWSR1, HIST1H3A, HIST1H1A, DNMT1, DNMT3A, DNMT3B, AKT1, KDM5A, SETD8, SIRT1, EPC1, MYOD1, YY1, RBL2, PHB2, PPP1R8, WT1, USP7, CDK1, CDK2, RUNX3, PPARG, POU5F1, PHF19, HOTAIR, HIST3H3, MAPK8IP2, C7orf25, GADD45G, TAF1D, MAPKAPK3, RASA1, ATP1B1, RPS6KA5, TNFSF11, MAP3K7, TK1, DNAJB11, SMN1, PFDN1, ZAK, GATA4, PJA1, CDYL, RELA, RELB, EHMT1, SMYD3, EPC2, CDKN2B-AS1, UHRF1, HIC1, HDAC3, RORA, PML, RARA, SS18, SSX2, TLE1, CDK6, ASXL1, ESR1, MED1, SUV39H1, KDM1A, PRMT5, CUL1, BTRC, JAK2, BRCA1, FBXW11, CEP63, LOXL2, VCP, NPLOC4, CPSF6, KIF5B, RAP1GAP, TDRD1, ACTG1, NUDT21, PLEC, UFD1L, THRAP3, CIT, WWP2, AEBP2, DHX9, ILF3, UBB, DDX5, SON, SNRPA, HIST4H4, UPF1, LIMA1, TAF15, FBXL18, PABPC4, U2AF1, SNRNP70, CALML3, POTEE, SNRPD3, YBX1, SNRPN, TUBB4B, ANXA4, LARP1, NCL, ARG1, SRSF1, C10orf12, TUBA1B, LUC7L2, TRIM28, AR, IMMT, FUS, SRSF3, WWP1, RBM14, SNRPD2, U2AF2, ATP5B, ELAVL1, FLG, HIST1H2AE, HIST1H2AB, DDX3X, FABP5, TRA2A, SAFB2, FAM120A, RALY, SRSF7, SNRPD1, SF3B1, HSPB1, SNRNP200, ZC3HAV1, COPB1, ILF2, KLC2, LRRC40, SRSF9, SERPINB12, CPSF1, GNB2L1, HSPA1A, HSPA1B, RBBP7, FIP1L1, PDCD6IP, SNRPF, SF3B2, ZNF638, ADAR, DBN1, PKM, SRSF10, EFTUD2, ACTN1, PHGDH, DSC3, ATP2A2, ASPSCR1, ATP5C1, EPRS, CHCHD3, IGLL5, KLC4, NUMA1, RBM39, SF3B3, TPI1, CNBP, DAZAP1, ERH, KLHL12, SLC25A10, SYNE1, DHX36, FBL, SDCBP, AKAP8, CPSF7, LGALS7, MYLPF, PHF5A, DHX30, PDS5A, ANKFY1, CPSF2, DYNLT3, TRIM25, HNRNPAB, KHDRBS1, KLC1, LRPPRC, MAGOH, NOP2, FAM208A, H2AFY, YBX3, KAT7, HYOU1, P4HB, CSNK2B, DEC1, CRY2, CHD4, NCOA1, RIN3, CDKN2C, GEMIN7, FAT1, MKI67, SEPT2, SNRPB2, SSR1, API5, NOP14, RBX1, HUWE1, EHMT2, OIP5, MKRN2, RPL36, ITSN2, MRPL2, CCDC93, FNBP1L, DNAAF5, CEP192, CDCA7L, WDR76, REEP4, DNAJC21, CENPV, C17orf96, TRIM37, PRDM14, DDB2, KAT2B, PCGF1, MDM2, ZBTB16, HNF4A, DANCR, LATS2AUTS2PCGF3, PCGF5, RNF2, CSNK2A2, RYBP, RING1, YAF2, CSNK2A1, CSNK2B, DCAF7, FBRS, EP300, RERE, RBM14, ZNF608, ZNF609, TLE3, WDR5, PCGF6, ATN1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneEZH2chr7:148543589chr7:70227856ENST00000476773-31939_6873696EED
HgeneEZH2chr7:148543589chr7:70227856ENST00000478654-42039_6873696EED
HgeneEZH2chr7:148543589chr7:70227856ENST00000483967-32039_6873738EED
HgeneEZH2chr7:148543589chr7:70227856ENST00000541220-31939_6873696EED


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneEZH2chr7:148543589chr7:70227856ENST00000320356-120329_522-41752CDYL
HgeneEZH2chr7:148543589chr7:70227856ENST00000350995-119329_522-31708CDYL
HgeneEZH2chr7:148543589chr7:70227856ENST00000460911-120329_522-30747CDYL
HgeneEZH2chr7:148543589chr7:70227856ENST00000476773-319329_52273696CDYL
HgeneEZH2chr7:148543589chr7:70227856ENST00000478654-420329_52273696CDYL
HgeneEZH2chr7:148543589chr7:70227856ENST00000483967-320329_52273738CDYL
HgeneEZH2chr7:148543589chr7:70227856ENST00000541220-319329_52273696CDYL
HgeneEZH2chr7:148543589chr7:70227856ENST00000320356-1201_340-41752DNMT1%2C DNMT3A and DNMT3B
HgeneEZH2chr7:148543589chr7:70227856ENST00000350995-1191_340-31708DNMT1%2C DNMT3A and DNMT3B
HgeneEZH2chr7:148543589chr7:70227856ENST00000460911-1201_340-30747DNMT1%2C DNMT3A and DNMT3B
HgeneEZH2chr7:148543589chr7:70227856ENST00000476773-3191_34073696DNMT1%2C DNMT3A and DNMT3B
HgeneEZH2chr7:148543589chr7:70227856ENST00000478654-4201_34073696DNMT1%2C DNMT3A and DNMT3B
HgeneEZH2chr7:148543589chr7:70227856ENST00000483967-3201_34073738DNMT1%2C DNMT3A and DNMT3B
HgeneEZH2chr7:148543589chr7:70227856ENST00000541220-3191_34073696DNMT1%2C DNMT3A and DNMT3B
HgeneEZH2chr7:148543589chr7:70227856ENST00000320356-12039_68-41752EED
HgeneEZH2chr7:148543589chr7:70227856ENST00000350995-11939_68-31708EED
HgeneEZH2chr7:148543589chr7:70227856ENST00000460911-12039_68-30747EED


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EZH2_AUTS2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EZH2_AUTS2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEZH2C0033578Prostatic Neoplasms3CTD_human
HgeneEZH2C0001815Primary Myelofibrosis1CTD_human
HgeneEZH2C0010278Craniosynostosis1CTD_human
HgeneEZH2C0014170Endometrial Neoplasms1CTD_human
HgeneEZH2C0024301Lymphoma, Follicular1CTD_human
HgeneEZH2C0029463Osteosarcoma1CTD_human
HgeneEZH2C0079744Diffuse Large B-Cell Lymphoma1CTD_human
HgeneEZH2C0265210Weaver syndrome1ORPHANET;UNIPROT
HgeneEZH2C0349639Juvenile Myelomonocytic Leukemia1CTD_human
HgeneEZH2C0749794Upper Extremity Deformities, Congenital1CTD_human
HgeneEZH2C1301355Myelodysplastic-Myeloproliferative Diseases1CTD_human
HgeneEZH2C1458155Mammary Neoplasms1CTD_human
HgeneEZH2C1860789Leukemia, Megakaryoblastic, of Down Syndrome1CTD_human
HgeneEZH2C3463824MYELODYSPLASTIC SYNDROME1CTD_human
TgeneAUTS2C0036341Schizophrenia2PSYGENET
TgeneAUTS2C0014544Epilepsy1CTD_human