FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12361

FusionGeneSummary for EZH1_PDSS2

check button Fusion gene summary
Fusion gene informationFusion gene name: EZH1_PDSS2
Fusion gene ID: 12361
HgeneTgene
Gene symbol

EZH1

PDSS2

Gene ID

2145

57107

Gene nameenhancer of zeste 1 polycomb repressive complex 2 subunitdecaprenyl diphosphate synthase subunit 2
SynonymsKMT6BC6orf210|COQ10D3|DLP1|bA59I9.3|hDLP1
Cytomap

17q21.2

6q21

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase EZH1ENX-2enhancer of zeste homolog 1decaprenyl-diphosphate synthase subunit 2all-trans-decaprenyl-diphosphate synthase subunit 2decaprenyl pyrophosphate synthase subunit 2decaprenyl pyrophosphate synthetase subunit 2prenyl (decaprenyl) diphosphate synthase, subunit 2subunit 2 of decapr
Modification date2018051920180527
UniProtAcc

Q92800

Q86YH6

Ensembl transtripts involved in fusion geneENST00000428826, ENST00000415827, 
ENST00000435174, ENST00000592743, 
ENST00000585893, ENST00000590078, 
ENST00000590783, 
ENST00000369037, 
ENST00000453874, ENST00000369031, 
Fusion gene scores* DoF score6 X 6 X 5=1807 X 5 X 6=210
# samples 68
** MAII scorelog2(6/180*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/210*10)=-1.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EZH1 [Title/Abstract] AND PDSS2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePDSS2

GO:0006744

ubiquinone biosynthetic process

16262699

TgenePDSS2

GO:0008299

isoprenoid biosynthetic process

16262699


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPCPGTCGA-WB-A81F-01AEZH1chr17

40879653

-PDSS2chr6

107595431

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000428826ENST00000369037EZH1chr17

40879653

-PDSS2chr6

107595431

-
In-frameENST00000428826ENST00000453874EZH1chr17

40879653

-PDSS2chr6

107595431

-
In-frameENST00000428826ENST00000369031EZH1chr17

40879653

-PDSS2chr6

107595431

-
intron-3CDSENST00000415827ENST00000369037EZH1chr17

40879653

-PDSS2chr6

107595431

-
intron-3CDSENST00000415827ENST00000453874EZH1chr17

40879653

-PDSS2chr6

107595431

-
intron-3CDSENST00000415827ENST00000369031EZH1chr17

40879653

-PDSS2chr6

107595431

-
Frame-shitENST00000435174ENST00000369037EZH1chr17

40879653

-PDSS2chr6

107595431

-
Frame-shitENST00000435174ENST00000453874EZH1chr17

40879653

-PDSS2chr6

107595431

-
Frame-shitENST00000435174ENST00000369031EZH1chr17

40879653

-PDSS2chr6

107595431

-
Frame-shitENST00000592743ENST00000369037EZH1chr17

40879653

-PDSS2chr6

107595431

-
Frame-shitENST00000592743ENST00000453874EZH1chr17

40879653

-PDSS2chr6

107595431

-
Frame-shitENST00000592743ENST00000369031EZH1chr17

40879653

-PDSS2chr6

107595431

-
In-frameENST00000585893ENST00000369037EZH1chr17

40879653

-PDSS2chr6

107595431

-
In-frameENST00000585893ENST00000453874EZH1chr17

40879653

-PDSS2chr6

107595431

-
In-frameENST00000585893ENST00000369031EZH1chr17

40879653

-PDSS2chr6

107595431

-
Frame-shitENST00000590078ENST00000369037EZH1chr17

40879653

-PDSS2chr6

107595431

-
Frame-shitENST00000590078ENST00000453874EZH1chr17

40879653

-PDSS2chr6

107595431

-
Frame-shitENST00000590078ENST00000369031EZH1chr17

40879653

-PDSS2chr6

107595431

-
intron-3CDSENST00000590783ENST00000369037EZH1chr17

40879653

-PDSS2chr6

107595431

-
intron-3CDSENST00000590783ENST00000453874EZH1chr17

40879653

-PDSS2chr6

107595431

-
intron-3CDSENST00000590783ENST00000369031EZH1chr17

40879653

-PDSS2chr6

107595431

-

Top

FusionProtFeatures for EZH1_PDSS2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EZH1

Q92800

PDSS2

Q86YH6

Supplies decaprenyl diphosphate, the precursor for theside chain of the isoprenoid quinones ubiquinone-10.{ECO:0000269|PubMed:16262699}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEZH1chr17:40879653chr6:107595431ENST00000428826-421524_60682748Compositional biasNote=Cys-rich
HgeneEZH1chr17:40879653chr6:107595431ENST00000435174-419524_60623609Compositional biasNote=Cys-rich
HgeneEZH1chr17:40879653chr6:107595431ENST00000585893-420524_60682708Compositional biasNote=Cys-rich
HgeneEZH1chr17:40879653chr6:107595431ENST00000590078-320524_60612678Compositional biasNote=Cys-rich
HgeneEZH1chr17:40879653chr6:107595431ENST00000592743-320524_60682748Compositional biasNote=Cys-rich
HgeneEZH1chr17:40879653chr6:107595431ENST00000428826-421504_60682748DomainCXC
HgeneEZH1chr17:40879653chr6:107595431ENST00000428826-421613_72882748DomainSET
HgeneEZH1chr17:40879653chr6:107595431ENST00000435174-419504_60623609DomainCXC
HgeneEZH1chr17:40879653chr6:107595431ENST00000435174-419613_72823609DomainSET
HgeneEZH1chr17:40879653chr6:107595431ENST00000585893-420504_60682708DomainCXC
HgeneEZH1chr17:40879653chr6:107595431ENST00000585893-420613_72882708DomainSET
HgeneEZH1chr17:40879653chr6:107595431ENST00000590078-320504_60612678DomainCXC
HgeneEZH1chr17:40879653chr6:107595431ENST00000590078-320613_72812678DomainSET
HgeneEZH1chr17:40879653chr6:107595431ENST00000592743-320504_60682748DomainCXC
HgeneEZH1chr17:40879653chr6:107595431ENST00000592743-320613_72882748DomainSET
HgeneEZH1chr17:40879653chr6:107595431ENST00000428826-421491_49682748MotifNuclear localization signal
HgeneEZH1chr17:40879653chr6:107595431ENST00000435174-419491_49623609MotifNuclear localization signal
HgeneEZH1chr17:40879653chr6:107595431ENST00000585893-420491_49682708MotifNuclear localization signal
HgeneEZH1chr17:40879653chr6:107595431ENST00000590078-320491_49612678MotifNuclear localization signal
HgeneEZH1chr17:40879653chr6:107595431ENST00000592743-320491_49682748MotifNuclear localization signal


Top

FusionGeneSequence for EZH1_PDSS2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EZH1_ENST00000428826_chr17_40879653_-_PDSS2_ENST00000369037_chr6_107595431_-_338aa
MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALTVANFAKVQEKTQILNEEWKKLRVQPVQSMKPVSGHPFLKKSKKFGRDH
GANSTCSPCTSWDSKFK_VAII_WSTERHAIWK_NCTPEWRLSSSKCLQWTSSATEHQGCGTFSKCSTGLGTRSIS_KFYFKGKLTHR_T
WNIDLEGADFSLPWCLTSKELPSCNGISKA_C_GSETGISVWEAHGHES_DKF_CPAFT_RKDQ_LHDF_SKLSSCSLTSGISWKRFVD_

>In-frame_EZH1_ENST00000428826_chr17_40879653_-_PDSS2_ENST00000453874_chr6_107595431_-_236aa
MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALTVANFAKVQEKTQILNEEWKKLRVQPVQSMKPVSGHPFLKKSKKFGRDH
GANSTCSPCTSWDSKFK_VAII_WSTERHAIWK_NCTPEWRLSSSKCLQWTSSATEHQGCGTFSKCSTGLGTRSIS_KFYFKGSRKRKIG

>In-frame_EZH1_ENST00000428826_chr17_40879653_-_PDSS2_ENST00000369031_chr6_107595431_-_179aa
MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALTVANFAKVQEKTQILNEEWKKLRVQPVQSMKPVSGHPFLKKSKKFGRDH

>In-frame_EZH1_ENST00000585893_chr17_40879653_-_PDSS2_ENST00000369037_chr6_107595431_-_338aa
MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALTVANFAKVQEKTQILNEEWKKLRVQPVQSMKPVSGHPFLKKSKKFGRDH
GANSTCSPCTSWDSKFK_VAII_WSTERHAIWK_NCTPEWRLSSSKCLQWTSSATEHQGCGTFSKCSTGLGTRSIS_KFYFKGKLTHR_T
WNIDLEGADFSLPWCLTSKELPSCNGISKA_C_GSETGISVWEAHGHES_DKF_CPAFT_RKDQ_LHDF_SKLSSCSLTSGISWKRFVD_

>In-frame_EZH1_ENST00000585893_chr17_40879653_-_PDSS2_ENST00000453874_chr6_107595431_-_236aa
MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALTVANFAKVQEKTQILNEEWKKLRVQPVQSMKPVSGHPFLKKSKKFGRDH
GANSTCSPCTSWDSKFK_VAII_WSTERHAIWK_NCTPEWRLSSSKCLQWTSSATEHQGCGTFSKCSTGLGTRSIS_KFYFKGSRKRKIG

>In-frame_EZH1_ENST00000585893_chr17_40879653_-_PDSS2_ENST00000369031_chr6_107595431_-_179aa
MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALTVANFAKVQEKTQILNEEWKKLRVQPVQSMKPVSGHPFLKKSKKFGRDH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EZH1_ENST00000428826_chr17_40879653_-_PDSS2_ENST00000369037_chr6_107595431_-_1015nt
ATGGAAATACCAAATCCCCCTACCTCCAAATGTATCACTTACTGGAAAAGAAAAGTGAAATCTGAATACATGCGACTTCGACAACTTAAA
CGGCTTCAGGCAAATATGGGTGCAAAGGCTTTGTATGTGGCAAATTTTGCAAAGGTTCAAGAAAAAACCCAGATCCTCAATGAAGAATGG
AAGAAGCTTCGTGTCCAACCTGTTCAGTCAATGAAGCCTGTGAGTGGACACCCTTTTCTCAAAAAGTCAAAGAAGTTTGGCAGAGATCAC
GGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGACATGCA
ATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAAGGTTGT
GGAACTTTTAGCAAGTGCTCTTATGGACTTGGTACAAGGAGTATATCATGAAAATTCTACTTCAAAGGAAAGTTATATCACAGATGATAT
TGGAATATCGACTTGGAAGGAGCAGACTTTTCTCTCCCATGGTGCCTTACTAGCAAAGAGCTGCCAAGCTGCAATGGAATTAGCAAAGCA
TGATGCTGAGGTTCAGAATATGGCATTTCAGTATGGGAAGCACATGGCCATGAGTCATAAGATAAATTCTGATGTCCAGCCTTTTATTAA
AGAAAAGACCAGTGACTCCATGACTTTTAATCTAAACTCAGCTCCTGTAGTCTTACATCAGGAATTTCTTGGAAGAGATTTGTGGATTAA
ACAGATCGGAGAGGCTCAAGAAAAAGGAAGATTGGACTATGCTAAGTTGCGAGAAAGAATCAAAGCTGGCAAAGGTGTGACTTCAGCTAT
TGACCTGTGTCGTTACCATGGAAACAAGGCACTGGAGGCCCTGGAGAGCTTTCCTCCCTCGGAGGCCAGATCTGCTTTAGAAAACATTGT

>In-frame_EZH1_ENST00000428826_chr17_40879653_-_PDSS2_ENST00000453874_chr6_107595431_-_709nt
ATGGAAATACCAAATCCCCCTACCTCCAAATGTATCACTTACTGGAAAAGAAAAGTGAAATCTGAATACATGCGACTTCGACAACTTAAA
CGGCTTCAGGCAAATATGGGTGCAAAGGCTTTGTATGTGGCAAATTTTGCAAAGGTTCAAGAAAAAACCCAGATCCTCAATGAAGAATGG
AAGAAGCTTCGTGTCCAACCTGTTCAGTCAATGAAGCCTGTGAGTGGACACCCTTTTCTCAAAAAGTCAAAGAAGTTTGGCAGAGATCAC
GGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGACATGCA
ATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAAGGTTGT
GGAACTTTTAGCAAGTGCTCTTATGGACTTGGTACAAGGAGTATATCATGAAAATTCTACTTCAAAGGCTCAAGAAAAAGGAAGATTGGA
CTATGCTAAGTTGCGAGAAAGAATCAAAGCTGGCAAAGGTGTGACTTCAGCTATTGACCTGTGTCGTTACCATGGAAACAAGGCACTGGA

>In-frame_EZH1_ENST00000428826_chr17_40879653_-_PDSS2_ENST00000369031_chr6_107595431_-_538nt
ATGGAAATACCAAATCCCCCTACCTCCAAATGTATCACTTACTGGAAAAGAAAAGTGAAATCTGAATACATGCGACTTCGACAACTTAAA
CGGCTTCAGGCAAATATGGGTGCAAAGGCTTTGTATGTGGCAAATTTTGCAAAGGTTCAAGAAAAAACCCAGATCCTCAATGAAGAATGG
AAGAAGCTTCGTGTCCAACCTGTTCAGTCAATGAAGCCTGTGAGTGGACACCCTTTTCTCAAAAAGTCAAAGAAGTTTGGCAGAGATCAC
GGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGACATGCA
ATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAAGTCATT

>In-frame_EZH1_ENST00000585893_chr17_40879653_-_PDSS2_ENST00000369037_chr6_107595431_-_1015nt
ATGGAAATACCAAATCCCCCTACCTCCAAATGTATCACTTACTGGAAAAGAAAAGTGAAATCTGAATACATGCGACTTCGACAACTTAAA
CGGCTTCAGGCAAATATGGGTGCAAAGGCTTTGTATGTGGCAAATTTTGCAAAGGTTCAAGAAAAAACCCAGATCCTCAATGAAGAATGG
AAGAAGCTTCGTGTCCAACCTGTTCAGTCAATGAAGCCTGTGAGTGGACACCCTTTTCTCAAAAAGTCAAAGAAGTTTGGCAGAGATCAC
GGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGACATGCA
ATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAAGGTTGT
GGAACTTTTAGCAAGTGCTCTTATGGACTTGGTACAAGGAGTATATCATGAAAATTCTACTTCAAAGGAAAGTTATATCACAGATGATAT
TGGAATATCGACTTGGAAGGAGCAGACTTTTCTCTCCCATGGTGCCTTACTAGCAAAGAGCTGCCAAGCTGCAATGGAATTAGCAAAGCA
TGATGCTGAGGTTCAGAATATGGCATTTCAGTATGGGAAGCACATGGCCATGAGTCATAAGATAAATTCTGATGTCCAGCCTTTTATTAA
AGAAAAGACCAGTGACTCCATGACTTTTAATCTAAACTCAGCTCCTGTAGTCTTACATCAGGAATTTCTTGGAAGAGATTTGTGGATTAA
ACAGATCGGAGAGGCTCAAGAAAAAGGAAGATTGGACTATGCTAAGTTGCGAGAAAGAATCAAAGCTGGCAAAGGTGTGACTTCAGCTAT
TGACCTGTGTCGTTACCATGGAAACAAGGCACTGGAGGCCCTGGAGAGCTTTCCTCCCTCGGAGGCCAGATCTGCTTTAGAAAACATTGT

>In-frame_EZH1_ENST00000585893_chr17_40879653_-_PDSS2_ENST00000453874_chr6_107595431_-_709nt
ATGGAAATACCAAATCCCCCTACCTCCAAATGTATCACTTACTGGAAAAGAAAAGTGAAATCTGAATACATGCGACTTCGACAACTTAAA
CGGCTTCAGGCAAATATGGGTGCAAAGGCTTTGTATGTGGCAAATTTTGCAAAGGTTCAAGAAAAAACCCAGATCCTCAATGAAGAATGG
AAGAAGCTTCGTGTCCAACCTGTTCAGTCAATGAAGCCTGTGAGTGGACACCCTTTTCTCAAAAAGTCAAAGAAGTTTGGCAGAGATCAC
GGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGACATGCA
ATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAAGGTTGT
GGAACTTTTAGCAAGTGCTCTTATGGACTTGGTACAAGGAGTATATCATGAAAATTCTACTTCAAAGGCTCAAGAAAAAGGAAGATTGGA
CTATGCTAAGTTGCGAGAAAGAATCAAAGCTGGCAAAGGTGTGACTTCAGCTATTGACCTGTGTCGTTACCATGGAAACAAGGCACTGGA

>In-frame_EZH1_ENST00000585893_chr17_40879653_-_PDSS2_ENST00000369031_chr6_107595431_-_538nt
ATGGAAATACCAAATCCCCCTACCTCCAAATGTATCACTTACTGGAAAAGAAAAGTGAAATCTGAATACATGCGACTTCGACAACTTAAA
CGGCTTCAGGCAAATATGGGTGCAAAGGCTTTGTATGTGGCAAATTTTGCAAAGGTTCAAGAAAAAACCCAGATCCTCAATGAAGAATGG
AAGAAGCTTCGTGTCCAACCTGTTCAGTCAATGAAGCCTGTGAGTGGACACCCTTTTCTCAAAAAGTCAAAGAAGTTTGGCAGAGATCAC
GGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTGCAATCATCTGATGGTCCACTGAAAGACATGCA
ATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAATGGACTAGCTCTGCTACAGAACACCAAGTCATT


* Fusion transcript sequences (Full-length transcript).
>In-frame_EZH1_ENST00000428826_chr17_40879653_-_PDSS2_ENST00000369037_chr6_107595431_-_3199nt
CCCGCGGCTCGGGATGGAGGCTGGACACCTGTTCTGCTGTTGTGTCCTGCCATTCTCCTGAAGAACAGAGGCACACTGTAAAACCCAACA
CTTCCCCTTGCATTCTATAAGATTACAGCAAGATGGAAATACCAAATCCCCCTACCTCCAAATGTATCACTTACTGGAAAAGAAAAGTGA
AATCTGAATACATGCGACTTCGACAACTTAAACGGCTTCAGGCAAATATGGGTGCAAAGGCTTTGTATGTGGCAAATTTTGCAAAGGTTC
AAGAAAAAACCCAGATCCTCAATGAAGAATGGAAGAAGCTTCGTGTCCAACCTGTTCAGTCAATGAAGCCTGTGAGTGGACACCCTTTTC
TCAAAAAGTCAAAGAAGTTTGGCAGAGATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTG
CAATCATCTGATGGTCCACTGAAAGACATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAAT
GGACTAGCTCTGCTACAGAACACCAAGGTTGTGGAACTTTTAGCAAGTGCTCTTATGGACTTGGTACAAGGAGTATATCATGAAAATTCT
ACTTCAAAGGAAAGTTATATCACAGATGATATTGGAATATCGACTTGGAAGGAGCAGACTTTTCTCTCCCATGGTGCCTTACTAGCAAAG
AGCTGCCAAGCTGCAATGGAATTAGCAAAGCATGATGCTGAGGTTCAGAATATGGCATTTCAGTATGGGAAGCACATGGCCATGAGTCAT
AAGATAAATTCTGATGTCCAGCCTTTTATTAAAGAAAAGACCAGTGACTCCATGACTTTTAATCTAAACTCAGCTCCTGTAGTCTTACAT
CAGGAATTTCTTGGAAGAGATTTGTGGATTAAACAGATCGGAGAGGCTCAAGAAAAAGGAAGATTGGACTATGCTAAGTTGCGAGAAAGA
ATCAAAGCTGGCAAAGGTGTGACTTCAGCTATTGACCTGTGTCGTTACCATGGAAACAAGGCACTGGAGGCCCTGGAGAGCTTTCCTCCC
TCGGAGGCCAGATCTGCTTTAGAAAACATTGTGTTTGCTGTGACCAGATTTTCATGACATCAAATTAAAAAGACACTATTGTTAGTTAGC
TGAAAATCCTAGGGAATGAGGTTGATTGGGAGCGCTTTCACGATGCGTTAATGACTTTTAAAACATATGCATTTTTCCTTCCTTTTATCA
CATTGCTAAATGAGTTCTGCTTTCTTTTTGGAACTGCTACAAACAAAATTAGAAGAAAAAAAGGTCAAGCAGTTTTCACTTGTCACGCCA
GAAGCACACTTGAGGCTGCAGTCGCAGAAATAATTAATGAGATTCGCTCCTGTGACCTCAGCAAATGGACAGGAAATAAGTCCTTATTGA
TTGGACCGAGCCAGGGATGGCGCCAGGGCGGTGGCCTGTGGTTTTTCCTGCTAGAGAGGACAAAGCAAGTTGGAAGCTGCAGGTGTCAAG
AGAAATGCTCTCAATACCAACCAGGGAGGATTGTCTAATCAAAAACTAGTGACCAATTTGTCATAATGGAGAGTAGTTCAATGGATTGAG
AAAAATATGTTTTATTTGTTGGCTTGTAATTATGTCTCTGGATTATTATTATTTTTTTTTTAGATGTAGTTTTGCTCTTGTTGCCCAGGC
TGGAGTGCAATGGTGCAGTTTTGACTCACTGCAACCTCCGCCTCCTGGGTTCAAGTGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAA
TTACAGGCACCTGCCACCACGCCTGGCTAATTTTGTATTTTTAGTAGAGATGGGGTTTCACTATGTTGGTCAGGCTAGTCTCGAACTCCT
GACCTCAGGTGATCCGCCTGCCTCGGCCTCCCAAAGTGCTGGGATTAGAGGCTTGAGCCACTGCACCTGGCCTCATGTCTCTGGATTTAT
AATGCAGTATGAATATACTTTGTGCTTTATGGTTTTTATAATGTCTTTTTGGAGAAATTGCCGAAAAGTTGCCAAATACTTGAAGTAGGA
GATTAAAATGTTATCAAATGTTAAATTGGTTATATTAGGAATAGTCTGTTTTTCTTTCCTGAAGATCAGTTTTTTTATTCAAACACATTT
CAAAGAACCAAATTTTTTTTTTCTTTAAGGAAAAAGGAGCTTTTTTTCAAGTGAAATGTATTCATTTGTAATACTTTGGTTTAAGGCATA
CTTTAATTTTTACGAGTTTCAGAAACAGAATTTTTGTACTAGGGAATTCATTGGTGAGAGTGTTCTTTTAACCTCAGAATGTCAAATTTT
GGTCTTGAACCACAGACATCCAATTACAGAAAGAATATAAGCAATCTCACAGGCCTGCAATCGGACACTGTCTCTGTGTGGTTCATAGGA
GATGATTTTTGAGGTTTGCACTCATGCAATTTGAGAACACCGTTGACAAGAAGGCTGAGTTTACATAAATGATCTAGATTGAAACTCAGC
TACCTTTCTTCCTCATGTGGTGTAATTACAGCCCTATCTGGAGACAGCGAATACAGCAAACAGATTTTATTACCTAGTTCGCTCAAACAC
TACATGAAGTTATTTTAGTTAAAGCCCTCCCCCAAAAGTTATAAAACCATTTTATCAGGGCCCAACATGTGGCATGCAATGAAGAGAAAA
TGTAAAGCTACAGAGGTTAATGTATTGTATTATAAAATATTTTAAGTGTACTCAAAATATCATAATTGTACAGTTTATGCCACCATAATT
TGAGGCCTATAGATTTAGCTTAAGAGAACACTGTTCTGTTTGAAATGCTTTCTGTCACTGAAATTGGCTTAATTAGTAACCATGGATAAG
ATGCTTTAGATCAGACTAGGTTTTAATCATTAACTTCCACAAAGAAGTCATACTTTGCGTTAGGTGTGCTGGTTGGATGTGCAGGAACTT
CAGCAAGCAGTAGGTTTTACTAAGCAGATGGTCGGGCACTGCAGGGCACCAGGCAGGATCCTAGGGCGCCTCTTATTCTGCGTTAGCATC
TGGTTTGCTGTATGACCTTGCACAAGTCACTTCCTTCTGAGCCTCAATTTTCTCATCTGTACAATGAGATTCAAAAGTTGACCTGAAAGT

>In-frame_EZH1_ENST00000428826_chr17_40879653_-_PDSS2_ENST00000453874_chr6_107595431_-_1004nt
CCCGCGGCTCGGGATGGAGGCTGGACACCTGTTCTGCTGTTGTGTCCTGCCATTCTCCTGAAGAACAGAGGCACACTGTAAAACCCAACA
CTTCCCCTTGCATTCTATAAGATTACAGCAAGATGGAAATACCAAATCCCCCTACCTCCAAATGTATCACTTACTGGAAAAGAAAAGTGA
AATCTGAATACATGCGACTTCGACAACTTAAACGGCTTCAGGCAAATATGGGTGCAAAGGCTTTGTATGTGGCAAATTTTGCAAAGGTTC
AAGAAAAAACCCAGATCCTCAATGAAGAATGGAAGAAGCTTCGTGTCCAACCTGTTCAGTCAATGAAGCCTGTGAGTGGACACCCTTTTC
TCAAAAAGTCAAAGAAGTTTGGCAGAGATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTG
CAATCATCTGATGGTCCACTGAAAGACATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAAT
GGACTAGCTCTGCTACAGAACACCAAGGTTGTGGAACTTTTAGCAAGTGCTCTTATGGACTTGGTACAAGGAGTATATCATGAAAATTCT
ACTTCAAAGGCTCAAGAAAAAGGAAGATTGGACTATGCTAAGTTGCGAGAAAGAATCAAAGCTGGCAAAGGTGTGACTTCAGCTATTGAC
CTGTGTCGTTACCATGGAAACAAGGCACTGGAGGCCCTGGAGAGCTTTCCTCCCTCGGAGGCCAGATCTGCTTTAGAAAACATTGTGTTT
GCTGTGACCAGATTTTCATGACATCAAATTAAAAAGACACTATTGTTAGTTAGCTGAAAATCCTAGGGAATGAGGTTGATTGGGAGCGCT
TTCACGATGCGTTAATGACTTTTAAAACATATGCATTTTTCCTTCCTTTTATCACATTGCTAAATGAGTTCTGCTTTCTTTTTGGAACTG

>In-frame_EZH1_ENST00000428826_chr17_40879653_-_PDSS2_ENST00000369031_chr6_107595431_-_894nt
CCCGCGGCTCGGGATGGAGGCTGGACACCTGTTCTGCTGTTGTGTCCTGCCATTCTCCTGAAGAACAGAGGCACACTGTAAAACCCAACA
CTTCCCCTTGCATTCTATAAGATTACAGCAAGATGGAAATACCAAATCCCCCTACCTCCAAATGTATCACTTACTGGAAAAGAAAAGTGA
AATCTGAATACATGCGACTTCGACAACTTAAACGGCTTCAGGCAAATATGGGTGCAAAGGCTTTGTATGTGGCAAATTTTGCAAAGGTTC
AAGAAAAAACCCAGATCCTCAATGAAGAATGGAAGAAGCTTCGTGTCCAACCTGTTCAGTCAATGAAGCCTGTGAGTGGACACCCTTTTC
TCAAAAAGTCAAAGAAGTTTGGCAGAGATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTTG
CAATCATCTGATGGTCCACTGAAAGACATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAAT
GGACTAGCTCTGCTACAGAACACCAAGTCATTTTCATTTAATGGACCTATTGCTATATATCAGATGGGAGACTGTGAGTCAGCCTGGATC
TTGTCTAAACACCCAAGAGCATTGTCATGATGTCACTCCTGGAGGTTGTTCTATTAAGCATTAGTGATTTATACTTCCGGATAACCAGTG
GCACAGATGTACTCTTTACATAGCTGATGTATTTCCTTATGTTAACTTTGTTTTCCTAAAGGCGTAAATATGTTGTTTAAAATGAAGTAT

>In-frame_EZH1_ENST00000585893_chr17_40879653_-_PDSS2_ENST00000369037_chr6_107595431_-_3200nt
ACCCGCGGCTCGGGATGGAGGCTGGACACCTGTTCTGCTGTTGTGTCCTGCCATTCTCCTGAAGAACAGAGGCACACTGTAAAACCCAAC
ACTTCCCCTTGCATTCTATAAGATTACAGCAAGATGGAAATACCAAATCCCCCTACCTCCAAATGTATCACTTACTGGAAAAGAAAAGTG
AAATCTGAATACATGCGACTTCGACAACTTAAACGGCTTCAGGCAAATATGGGTGCAAAGGCTTTGTATGTGGCAAATTTTGCAAAGGTT
CAAGAAAAAACCCAGATCCTCAATGAAGAATGGAAGAAGCTTCGTGTCCAACCTGTTCAGTCAATGAAGCCTGTGAGTGGACACCCTTTT
CTCAAAAAGTCAAAGAAGTTTGGCAGAGATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTT
GCAATCATCTGATGGTCCACTGAAAGACATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAA
TGGACTAGCTCTGCTACAGAACACCAAGGTTGTGGAACTTTTAGCAAGTGCTCTTATGGACTTGGTACAAGGAGTATATCATGAAAATTC
TACTTCAAAGGAAAGTTATATCACAGATGATATTGGAATATCGACTTGGAAGGAGCAGACTTTTCTCTCCCATGGTGCCTTACTAGCAAA
GAGCTGCCAAGCTGCAATGGAATTAGCAAAGCATGATGCTGAGGTTCAGAATATGGCATTTCAGTATGGGAAGCACATGGCCATGAGTCA
TAAGATAAATTCTGATGTCCAGCCTTTTATTAAAGAAAAGACCAGTGACTCCATGACTTTTAATCTAAACTCAGCTCCTGTAGTCTTACA
TCAGGAATTTCTTGGAAGAGATTTGTGGATTAAACAGATCGGAGAGGCTCAAGAAAAAGGAAGATTGGACTATGCTAAGTTGCGAGAAAG
AATCAAAGCTGGCAAAGGTGTGACTTCAGCTATTGACCTGTGTCGTTACCATGGAAACAAGGCACTGGAGGCCCTGGAGAGCTTTCCTCC
CTCGGAGGCCAGATCTGCTTTAGAAAACATTGTGTTTGCTGTGACCAGATTTTCATGACATCAAATTAAAAAGACACTATTGTTAGTTAG
CTGAAAATCCTAGGGAATGAGGTTGATTGGGAGCGCTTTCACGATGCGTTAATGACTTTTAAAACATATGCATTTTTCCTTCCTTTTATC
ACATTGCTAAATGAGTTCTGCTTTCTTTTTGGAACTGCTACAAACAAAATTAGAAGAAAAAAAGGTCAAGCAGTTTTCACTTGTCACGCC
AGAAGCACACTTGAGGCTGCAGTCGCAGAAATAATTAATGAGATTCGCTCCTGTGACCTCAGCAAATGGACAGGAAATAAGTCCTTATTG
ATTGGACCGAGCCAGGGATGGCGCCAGGGCGGTGGCCTGTGGTTTTTCCTGCTAGAGAGGACAAAGCAAGTTGGAAGCTGCAGGTGTCAA
GAGAAATGCTCTCAATACCAACCAGGGAGGATTGTCTAATCAAAAACTAGTGACCAATTTGTCATAATGGAGAGTAGTTCAATGGATTGA
GAAAAATATGTTTTATTTGTTGGCTTGTAATTATGTCTCTGGATTATTATTATTTTTTTTTTAGATGTAGTTTTGCTCTTGTTGCCCAGG
CTGGAGTGCAATGGTGCAGTTTTGACTCACTGCAACCTCCGCCTCCTGGGTTCAAGTGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGA
ATTACAGGCACCTGCCACCACGCCTGGCTAATTTTGTATTTTTAGTAGAGATGGGGTTTCACTATGTTGGTCAGGCTAGTCTCGAACTCC
TGACCTCAGGTGATCCGCCTGCCTCGGCCTCCCAAAGTGCTGGGATTAGAGGCTTGAGCCACTGCACCTGGCCTCATGTCTCTGGATTTA
TAATGCAGTATGAATATACTTTGTGCTTTATGGTTTTTATAATGTCTTTTTGGAGAAATTGCCGAAAAGTTGCCAAATACTTGAAGTAGG
AGATTAAAATGTTATCAAATGTTAAATTGGTTATATTAGGAATAGTCTGTTTTTCTTTCCTGAAGATCAGTTTTTTTATTCAAACACATT
TCAAAGAACCAAATTTTTTTTTTCTTTAAGGAAAAAGGAGCTTTTTTTCAAGTGAAATGTATTCATTTGTAATACTTTGGTTTAAGGCAT
ACTTTAATTTTTACGAGTTTCAGAAACAGAATTTTTGTACTAGGGAATTCATTGGTGAGAGTGTTCTTTTAACCTCAGAATGTCAAATTT
TGGTCTTGAACCACAGACATCCAATTACAGAAAGAATATAAGCAATCTCACAGGCCTGCAATCGGACACTGTCTCTGTGTGGTTCATAGG
AGATGATTTTTGAGGTTTGCACTCATGCAATTTGAGAACACCGTTGACAAGAAGGCTGAGTTTACATAAATGATCTAGATTGAAACTCAG
CTACCTTTCTTCCTCATGTGGTGTAATTACAGCCCTATCTGGAGACAGCGAATACAGCAAACAGATTTTATTACCTAGTTCGCTCAAACA
CTACATGAAGTTATTTTAGTTAAAGCCCTCCCCCAAAAGTTATAAAACCATTTTATCAGGGCCCAACATGTGGCATGCAATGAAGAGAAA
ATGTAAAGCTACAGAGGTTAATGTATTGTATTATAAAATATTTTAAGTGTACTCAAAATATCATAATTGTACAGTTTATGCCACCATAAT
TTGAGGCCTATAGATTTAGCTTAAGAGAACACTGTTCTGTTTGAAATGCTTTCTGTCACTGAAATTGGCTTAATTAGTAACCATGGATAA
GATGCTTTAGATCAGACTAGGTTTTAATCATTAACTTCCACAAAGAAGTCATACTTTGCGTTAGGTGTGCTGGTTGGATGTGCAGGAACT
TCAGCAAGCAGTAGGTTTTACTAAGCAGATGGTCGGGCACTGCAGGGCACCAGGCAGGATCCTAGGGCGCCTCTTATTCTGCGTTAGCAT
CTGGTTTGCTGTATGACCTTGCACAAGTCACTTCCTTCTGAGCCTCAATTTTCTCATCTGTACAATGAGATTCAAAAGTTGACCTGAAAG

>In-frame_EZH1_ENST00000585893_chr17_40879653_-_PDSS2_ENST00000453874_chr6_107595431_-_1005nt
ACCCGCGGCTCGGGATGGAGGCTGGACACCTGTTCTGCTGTTGTGTCCTGCCATTCTCCTGAAGAACAGAGGCACACTGTAAAACCCAAC
ACTTCCCCTTGCATTCTATAAGATTACAGCAAGATGGAAATACCAAATCCCCCTACCTCCAAATGTATCACTTACTGGAAAAGAAAAGTG
AAATCTGAATACATGCGACTTCGACAACTTAAACGGCTTCAGGCAAATATGGGTGCAAAGGCTTTGTATGTGGCAAATTTTGCAAAGGTT
CAAGAAAAAACCCAGATCCTCAATGAAGAATGGAAGAAGCTTCGTGTCCAACCTGTTCAGTCAATGAAGCCTGTGAGTGGACACCCTTTT
CTCAAAAAGTCAAAGAAGTTTGGCAGAGATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTT
GCAATCATCTGATGGTCCACTGAAAGACATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAA
TGGACTAGCTCTGCTACAGAACACCAAGGTTGTGGAACTTTTAGCAAGTGCTCTTATGGACTTGGTACAAGGAGTATATCATGAAAATTC
TACTTCAAAGGCTCAAGAAAAAGGAAGATTGGACTATGCTAAGTTGCGAGAAAGAATCAAAGCTGGCAAAGGTGTGACTTCAGCTATTGA
CCTGTGTCGTTACCATGGAAACAAGGCACTGGAGGCCCTGGAGAGCTTTCCTCCCTCGGAGGCCAGATCTGCTTTAGAAAACATTGTGTT
TGCTGTGACCAGATTTTCATGACATCAAATTAAAAAGACACTATTGTTAGTTAGCTGAAAATCCTAGGGAATGAGGTTGATTGGGAGCGC
TTTCACGATGCGTTAATGACTTTTAAAACATATGCATTTTTCCTTCCTTTTATCACATTGCTAAATGAGTTCTGCTTTCTTTTTGGAACT

>In-frame_EZH1_ENST00000585893_chr17_40879653_-_PDSS2_ENST00000369031_chr6_107595431_-_895nt
ACCCGCGGCTCGGGATGGAGGCTGGACACCTGTTCTGCTGTTGTGTCCTGCCATTCTCCTGAAGAACAGAGGCACACTGTAAAACCCAAC
ACTTCCCCTTGCATTCTATAAGATTACAGCAAGATGGAAATACCAAATCCCCCTACCTCCAAATGTATCACTTACTGGAAAAGAAAAGTG
AAATCTGAATACATGCGACTTCGACAACTTAAACGGCTTCAGGCAAATATGGGTGCAAAGGCTTTGTATGTGGCAAATTTTGCAAAGGTT
CAAGAAAAAACCCAGATCCTCAATGAAGAATGGAAGAAGCTTCGTGTCCAACCTGTTCAGTCAATGAAGCCTGTGAGTGGACACCCTTTT
CTCAAAAAGTCAAAGAAGTTTGGCAGAGATCACGGAGCTAATTCATATTGCTCTCCTTGTACATCGTGGGATAGTAAATTTAAATGAGTT
GCAATCATCTGATGGTCCACTGAAAGACATGCAATTTGGAAATAAAATTGCTATCCTGAGTGGAGACTTTCTTCTAGCAAATGCCTGCAA
TGGACTAGCTCTGCTACAGAACACCAAGTCATTTTCATTTAATGGACCTATTGCTATATATCAGATGGGAGACTGTGAGTCAGCCTGGAT
CTTGTCTAAACACCCAAGAGCATTGTCATGATGTCACTCCTGGAGGTTGTTCTATTAAGCATTAGTGATTTATACTTCCGGATAACCAGT
GGCACAGATGTACTCTTTACATAGCTGATGTATTTCCTTATGTTAACTTTGTTTTCCTAAAGGCGTAAATATGTTGTTTAAAATGAAGTA


Top

FusionGenePPI for EZH1_PDSS2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EZH1ZMYND11, E2F6, EZH1, EZH2, SUZ12, EED, GATA4, JARID2, PHF1, PHF19PDSS2ELAVL1, APP, OXLD1, ACAD9, SDHA, THEM4, FDPS


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EZH1_PDSS2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EZH1_PDSS2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePDSS2C3553358COENZYME Q10 DEFICIENCY, PRIMARY, 31UNIPROT