FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12350

FusionGeneSummary for EYA3_POP4

check button Fusion gene summary
Fusion gene informationFusion gene name: EYA3_POP4
Fusion gene ID: 12350
HgeneTgene
Gene symbol

EYA3

POP4

Gene ID

2140

10775

Gene nameEYA transcriptional coactivator and phosphatase 3POP4 homolog, ribonuclease P/MRP subunit
Synonyms-RPP29
Cytomap

1p35.3

19q12

Type of geneprotein-codingprotein-coding
Descriptioneyes absent homolog 3eyes absent 3ribonuclease P protein subunit p29hPOP4
Modification date2018052320180523
UniProtAcc

Q99504

O95707

Ensembl transtripts involved in fusion geneENST00000373871, ENST00000436342, 
ENST00000373864, ENST00000540618, 
ENST00000545175, ENST00000373863, 
ENST00000471498, 
ENST00000585603, 
ENST00000221770, ENST00000392279, 
ENST00000591824, 
Fusion gene scores* DoF score5 X 3 X 4=602 X 2 X 1=4
# samples 62
** MAII scorelog2(6/60*10)=0log2(2/4*10)=2.32192809488736
Context

PubMed: EYA3 [Title/Abstract] AND POP4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEYA3

GO:0010212

response to ionizing radiation

19234442

HgeneEYA3

GO:0016576

histone dephosphorylation

19234442|19351884

TgenePOP4

GO:0001682

tRNA 5'-leader removal

16723659


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A2-A04P-01AEYA3chr1

28315046

-POP4chr19

30104778

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000373871ENST00000585603EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000373871ENST00000221770EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000373871ENST00000392279EYA3chr1

28315046

-POP4chr19

30104778

+
5CDS-3UTRENST00000373871ENST00000591824EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000436342ENST00000585603EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000436342ENST00000221770EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000436342ENST00000392279EYA3chr1

28315046

-POP4chr19

30104778

+
5CDS-3UTRENST00000436342ENST00000591824EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000373864ENST00000585603EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000373864ENST00000221770EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000373864ENST00000392279EYA3chr1

28315046

-POP4chr19

30104778

+
5CDS-3UTRENST00000373864ENST00000591824EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000540618ENST00000585603EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000540618ENST00000221770EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000540618ENST00000392279EYA3chr1

28315046

-POP4chr19

30104778

+
5CDS-3UTRENST00000540618ENST00000591824EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000545175ENST00000585603EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000545175ENST00000221770EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000545175ENST00000392279EYA3chr1

28315046

-POP4chr19

30104778

+
5CDS-3UTRENST00000545175ENST00000591824EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000373863ENST00000585603EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000373863ENST00000221770EYA3chr1

28315046

-POP4chr19

30104778

+
In-frameENST00000373863ENST00000392279EYA3chr1

28315046

-POP4chr19

30104778

+
5CDS-3UTRENST00000373863ENST00000591824EYA3chr1

28315046

-POP4chr19

30104778

+
intron-3CDSENST00000471498ENST00000585603EYA3chr1

28315046

-POP4chr19

30104778

+
intron-3CDSENST00000471498ENST00000221770EYA3chr1

28315046

-POP4chr19

30104778

+
intron-3CDSENST00000471498ENST00000392279EYA3chr1

28315046

-POP4chr19

30104778

+
intron-3UTRENST00000471498ENST00000591824EYA3chr1

28315046

-POP4chr19

30104778

+

Top

FusionProtFeatures for EYA3_POP4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EYA3

Q99504

POP4

O95707

Tyrosine phosphatase that specifically dephosphorylates'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylationof histone H2AX plays a central role in DNA repair and acts as amark that distinguishes between apoptotic and repair responses togenotoxic stress. Promotes efficient DNA repair bydephosphorylating H2AX, promoting the recruitment of DNA repaircomplexes containing MDC1 (PubMed:19234442, PubMed:19351884). Itsfunction as histone phosphatase probably explains its role intranscription regulation during organogenesis. Coactivates SIX1,and seems to coactivate SIX2, SIX4 and SIX5. The repression ofprecursor cell proliferation in myoblasts by SIX1 is switched toactivation through recruitment of EYA3 to the SIX1-DACH1 complexand seems to be dependent on EYA3 phosphatase activity (Bysimilarity). May be involved in development of the eye.{ECO:0000250|UniProtKB:P97480, ECO:0000269|PubMed:19234442,ECO:0000269|PubMed:19351884}. Part of ribonuclease P, a protein complex that generatesmature tRNA molecules by cleaving their 5'-ends. May function withRPP38 to coordinate the nucleolar targeting and/or assembly ofRNase P.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePOP4chr1:28315046chr19:30104778ENST00000585603+4765_74141221Compositional biasNote=Poly-Lys


Top

FusionGeneSequence for EYA3_POP4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EYA3_ENST00000373871_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_593aa
MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDTTSQMTSAKPTAHILSVPVSETAY
PGQTQYQTLQQTQPTAVYPQATQTTGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHTSTPIQASSTNASLISTSST
IANIPAAAVASISNQDTPTTTILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTP
SKDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSTAQKTGKDPTVVIGSGLTMEEMIFEVADTHLFFNDL
EECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYRKVREITDKHKSNVGGLLSPQRKEALQRLRA
EIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLTGLGEIFPIENITSATKIVTKSKCPSTVGITGILLQETKHIFKII

>In-frame_EYA3_ENST00000373871_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_593aa
MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDTTSQMTSAKPTAHILSVPVSETAY
PGQTQYQTLQQTQPTAVYPQATQTTGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHTSTPIQASSTNASLISTSST
IANIPAAAVASISNQDTPTTTILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTP
SKDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSTAQKTGKDPTVVIGSGLTMEEMIFEVADTHLFFNDL
EECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYRKVREITDKHKSNVGGLLSPQRKEALQRLRA
EIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLTGLGEIFPIENITSATKIVTKSKCPSTVGITGILLQETKHIFKII

>In-frame_EYA3_ENST00000373871_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_593aa
MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDTTSQMTSAKPTAHILSVPVSETAY
PGQTQYQTLQQTQPTAVYPQATQTTGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHTSTPIQASSTNASLISTSST
IANIPAAAVASISNQDTPTTTILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTP
SKDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSTAQKTGKDPTVVIGSGLTMEEMIFEVADTHLFFNDL
EECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYRKVREITDKHKSNVGGLLSPQRKEALQRLRA
EIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLTGLGEIFPIENITSATKIVTKSKCPSTVGITGILLQETKHIFKII

>In-frame_EYA3_ENST00000436342_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_79aa

>In-frame_EYA3_ENST00000436342_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_79aa

>In-frame_EYA3_ENST00000436342_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_79aa

>In-frame_EYA3_ENST00000373864_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_79aa

>In-frame_EYA3_ENST00000373864_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_79aa

>In-frame_EYA3_ENST00000373864_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_79aa

>In-frame_EYA3_ENST00000540618_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_547aa
MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDTTSQMTSAKPTAHILSVPVSETAY
PGQTQYQTLQQTQPTAVYPQATQTTGLPPFASSTNASLISTSSTIANIPAAAVASISNQDTPTTTILGQNQYQACYPSSSFGVTGQTNSD
AESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIII
FHSLLTGSTAQKTGKDPTVVIGSGLTMEEMIFEVADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQ
GGVDWMRKLAFRYRKVREITDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLT
GLGEIFPIENITSATKIVTKSKCPSTVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKA

>In-frame_EYA3_ENST00000540618_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_547aa
MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDTTSQMTSAKPTAHILSVPVSETAY
PGQTQYQTLQQTQPTAVYPQATQTTGLPPFASSTNASLISTSSTIANIPAAAVASISNQDTPTTTILGQNQYQACYPSSSFGVTGQTNSD
AESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIII
FHSLLTGSTAQKTGKDPTVVIGSGLTMEEMIFEVADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQ
GGVDWMRKLAFRYRKVREITDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLT
GLGEIFPIENITSATKIVTKSKCPSTVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKA

>In-frame_EYA3_ENST00000540618_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_547aa
MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDTTSQMTSAKPTAHILSVPVSETAY
PGQTQYQTLQQTQPTAVYPQATQTTGLPPFASSTNASLISTSSTIANIPAAAVASISNQDTPTTTILGQNQYQACYPSSSFGVTGQTNSD
AESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIII
FHSLLTGSTAQKTGKDPTVVIGSGLTMEEMIFEVADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQ
GGVDWMRKLAFRYRKVREITDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLT
GLGEIFPIENITSATKIVTKSKCPSTVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKA

>In-frame_EYA3_ENST00000545175_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_79aa

>In-frame_EYA3_ENST00000545175_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_79aa

>In-frame_EYA3_ENST00000545175_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_79aa

>In-frame_EYA3_ENST00000373863_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_547aa
MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDTTSQMTSAKPTAHILSVPVSETAY
PGQTQYQTLQQTQPTAVYPQATQTTGLPPFASSTNASLISTSSTIANIPAAAVASISNQDTPTTTILGQNQYQACYPSSSFGVTGQTNSD
AESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIII
FHSLLTGSTAQKTGKDPTVVIGSGLTMEEMIFEVADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQ
GGVDWMRKLAFRYRKVREITDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLT
GLGEIFPIENITSATKIVTKSKCPSTVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKA

>In-frame_EYA3_ENST00000373863_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_547aa
MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDTTSQMTSAKPTAHILSVPVSETAY
PGQTQYQTLQQTQPTAVYPQATQTTGLPPFASSTNASLISTSSTIANIPAAAVASISNQDTPTTTILGQNQYQACYPSSSFGVTGQTNSD
AESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIII
FHSLLTGSTAQKTGKDPTVVIGSGLTMEEMIFEVADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQ
GGVDWMRKLAFRYRKVREITDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLT
GLGEIFPIENITSATKIVTKSKCPSTVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKA

>In-frame_EYA3_ENST00000373863_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_547aa
MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDTTSQMTSAKPTAHILSVPVSETAY
PGQTQYQTLQQTQPTAVYPQATQTTGLPPFASSTNASLISTSSTIANIPAAAVASISNQDTPTTTILGQNQYQACYPSSSFGVTGQTNSD
AESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIII
FHSLLTGSTAQKTGKDPTVVIGSGLTMEEMIFEVADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQ
GGVDWMRKLAFRYRKVREITDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLT
GLGEIFPIENITSATKIVTKSKCPSTVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EYA3_ENST00000373871_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_1779nt
ATGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAAT
CCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATC
CCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTAC
CCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTT
GGTGCATTGTGGCCAGGTATGAAACCTGAAAGTGGTTTAATTCAGACTCCATCTCCAAGTCAACACAGTGTTCTTACCTGCACTACAGGG
TTAACCACAAGCCAGCCAAGCCCAGCACATTATTCTTATCCCATTCAAGCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACA
ATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCC
TGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAG
AAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCA
AGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGT
GAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGA
AAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTA
GAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTC
AGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGG
AAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCA
GAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTG
ATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCT
ACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATC
ACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGC

>In-frame_EYA3_ENST00000373871_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_1779nt
ATGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAAT
CCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATC
CCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTAC
CCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTT
GGTGCATTGTGGCCAGGTATGAAACCTGAAAGTGGTTTAATTCAGACTCCATCTCCAAGTCAACACAGTGTTCTTACCTGCACTACAGGG
TTAACCACAAGCCAGCCAAGCCCAGCACATTATTCTTATCCCATTCAAGCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACA
ATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCC
TGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAG
AAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCA
AGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGT
GAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGA
AAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTA
GAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTC
AGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGG
AAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCA
GAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTG
ATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCT
ACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATC
ACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGC

>In-frame_EYA3_ENST00000373871_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_1779nt
ATGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAAT
CCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATC
CCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTAC
CCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTT
GGTGCATTGTGGCCAGGTATGAAACCTGAAAGTGGTTTAATTCAGACTCCATCTCCAAGTCAACACAGTGTTCTTACCTGCACTACAGGG
TTAACCACAAGCCAGCCAAGCCCAGCACATTATTCTTATCCCATTCAAGCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACA
ATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCC
TGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAG
AAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCA
AGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGT
GAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGA
AAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTA
GAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTC
AGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGG
AAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCA
GAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTG
ATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCT
ACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATC
ACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGC

>In-frame_EYA3_ENST00000436342_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_239nt
TGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAG
ACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGC

>In-frame_EYA3_ENST00000436342_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_239nt
TGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAG
ACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGC

>In-frame_EYA3_ENST00000436342_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_239nt
TGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAG
ACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGC

>In-frame_EYA3_ENST00000373864_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_239nt
TGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAG
ACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGC

>In-frame_EYA3_ENST00000373864_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_239nt
TGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAG
ACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGC

>In-frame_EYA3_ENST00000373864_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_239nt
TGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAG
ACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGC

>In-frame_EYA3_ENST00000540618_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_1641nt
ATGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAAT
CCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATC
CCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTAC
CCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTT
GCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGAT
TATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGAT
GCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCT
GGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAAC
CGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATC
TTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATG
ATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAAT
GGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAG
GGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTC
CTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCC
TTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATAT
GGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACA
GGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTC
ACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCG

>In-frame_EYA3_ENST00000540618_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_1641nt
ATGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAAT
CCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATC
CCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTAC
CCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTT
GCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGAT
TATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGAT
GCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCT
GGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAAC
CGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATC
TTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATG
ATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAAT
GGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAG
GGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTC
CTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCC
TTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATAT
GGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACA
GGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTC
ACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCG

>In-frame_EYA3_ENST00000540618_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_1641nt
ATGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAAT
CCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATC
CCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTAC
CCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTT
GCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGAT
TATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGAT
GCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCT
GGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAAC
CGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATC
TTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATG
ATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAAT
GGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAG
GGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTC
CTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCC
TTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATAT
GGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACA
GGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTC
ACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCG

>In-frame_EYA3_ENST00000545175_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_239nt
TGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAG
ACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGC

>In-frame_EYA3_ENST00000545175_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_239nt
TGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAG
ACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGC

>In-frame_EYA3_ENST00000545175_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_239nt
TGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAG
ACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGC

>In-frame_EYA3_ENST00000373863_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_1641nt
ATGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAAT
CCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATC
CCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTAC
CCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTT
GCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGAT
TATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGAT
GCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCT
GGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAAC
CGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATC
TTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATG
ATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAAT
GGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAG
GGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTC
CTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCC
TTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATAT
GGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACA
GGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTC
ACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCG

>In-frame_EYA3_ENST00000373863_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_1641nt
ATGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAAT
CCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATC
CCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTAC
CCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTT
GCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGAT
TATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGAT
GCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCT
GGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAAC
CGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATC
TTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATG
ATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAAT
GGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAG
GGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTC
CTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCC
TTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATAT
GGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACA
GGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTC
ACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCG

>In-frame_EYA3_ENST00000373863_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_1641nt
ATGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAAT
CCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATC
CCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTAC
CCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTT
GCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGAT
TATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGAT
GCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCT
GGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAAC
CGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATC
TTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATG
ATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAAT
GGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAG
GGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTC
CTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCC
TTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATAT
GGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACA
GGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTC
ACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCG


* Fusion transcript sequences (Full-length transcript).
>In-frame_EYA3_ENST00000373871_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_2440nt
AGGTTTCTAGTGGAACGAGGTGTGGATTGTGAGGTGACTCTGGCCGCTTACTTCCGGTTCCTAGCGATGCGCATCCGGGTCACGCTAACG
CCGCGGTTTCCTCCGCTCGATTGGTTCTACTGTGGGTCTGGACTGATCTCCATGTCCTGTTGTGGGGCTTTTACAGCCTTTGGATTGTGA
AAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCATGGAAGAAGAGCAAGATTTACCAGAGCA
ACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAATCCAGATGTCAGTGATCAGAAGCCTGAAAC
ATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATCCCTCGCTCATCCAATGATTATACCTCACA
AATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTACCCTGGACAGACTCAATACCAGACACTACA
GCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTTGGTGCATTGTGGCCAGGTATGAAACCTGA
AAGTGGTTTAATTCAGACTCCATCTCCAAGTCAACACAGTGTTCTTACCTGCACTACAGGGTTAACCACAAGCCAGCCAAGCCCAGCACA
TTATTCTTATCCCATTCAAGCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGC
CAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCAC
AGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGC
AGCACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAA
AAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTT
GGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGG
TTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGA
TGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGG
TTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAA
AAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTT
AGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCT
GGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCC
CTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCC
CAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTC
TGCGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGTCTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACT
CCCTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATAGACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGT
TGAACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGAGGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGAC
TCCCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTTGACTTGAATAGGATTATTCGATTTTTAAAAATACTTTT
CCATGTTTTCTGAGTGCTCTATGATAAATCAGTTGCATCTGTGATAATACAGTACATATGTGGACATAAACAGGGATCAAATAAAGGAGG

>In-frame_EYA3_ENST00000373871_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_3877nt
AGGTTTCTAGTGGAACGAGGTGTGGATTGTGAGGTGACTCTGGCCGCTTACTTCCGGTTCCTAGCGATGCGCATCCGGGTCACGCTAACG
CCGCGGTTTCCTCCGCTCGATTGGTTCTACTGTGGGTCTGGACTGATCTCCATGTCCTGTTGTGGGGCTTTTACAGCCTTTGGATTGTGA
AAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCATGGAAGAAGAGCAAGATTTACCAGAGCA
ACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAATCCAGATGTCAGTGATCAGAAGCCTGAAAC
ATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATCCCTCGCTCATCCAATGATTATACCTCACA
AATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTACCCTGGACAGACTCAATACCAGACACTACA
GCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTTGGTGCATTGTGGCCAGGTATGAAACCTGA
AAGTGGTTTAATTCAGACTCCATCTCCAAGTCAACACAGTGTTCTTACCTGCACTACAGGGTTAACCACAAGCCAGCCAAGCCCAGCACA
TTATTCTTATCCCATTCAAGCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGC
CAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCAC
AGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGC
AGCACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAA
AAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTT
GGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGG
TTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGA
TGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGG
TTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAA
AAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTT
AGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCT
GGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCC
CTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCC
CAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTC
TGCGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGTCTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACT
CCCTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATAGACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGT
TGAACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGAGGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGAC
TCCCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTTGACTTGAATAGGATTATTCGATTTTTAAAAATACTTTT
CCATGTTTTCTGAGTGCTCTATGATAAATCAGTTGCATCTGTGATAATACAGTACATATGTGGACATAAACAGGGATCAAATAAAGGAGG
TATTGCTGCAGTCCAGCCAGGTTGAAAGGGAAGGGGGGTCCCCAAAGGTCCATTGGATGGCAGGTGTCTACAGAGGCTCGCCTTTGGGTG
GAACTCTGACCCACCTAAGGTTTACTTTGCTATTTCAGGAAGGTTGAAGAGGATTGAAGGGTGAGTTGCTAAGTGACTTAGGGTTTATTC
ACTTCAGGAATCATAGCTGGGGTGGACCCCAGGAGCAGAGTACTGCATGCAGCTGTGCCCATGCATGGTTGCCCCAGCGTAGTGAGATGG
GACCTGCCGCAGCATGCCCACTCCTGAGCTGCCAGGCTGAGCCATGGAGGACTGAAAGGAGGTCGCCCGGCATCACCTCCCGAGGTGAGA
CCTGCTGCAAAAGCCAAGCCAGCAGCATTGACGCCCTTTGATATCTTCGCCATTTTTGCTGCTGAAAGACTTGGCTTTTCAGTCTGACCC
TGGCCCTCTGTGACCATGTGTCTGTAAAGCCAGTGGGTCAGGCCCTTCCATGCAGGGCCAGAGGAAAAGCGGGCCCAGGGCTGCAGTGAG
AGCGGGGCAGGGGACCAGCCTACCAGATGGGTTGGAAACATGGCTCAGAAGGACCAACTACCCCTTCCCTTTGAGGAGCAAGTCTCTGCC
GATCAGCAAGGCAAGGCCAGGAGCCCTCCTGGCGAAAGGCAGGCCACAAATCTGTTCTCCCCCAGGAGAAGTAGCAGTGCCAGGGCTTTG
CGTTTCTGGTAACTTCCACCCAAACCACACCAGAGAGAAACACCGTAGTGGAGAAGGGAAGTGGGAGCGCTGACTGCTGTGTGCCAGGAG
AGTAGAAAGGCCCAGGTCTGTGCCACCACCCCTCCCCAAAGCTCAGTGCACCCAGAGTCTCACAGGGACCAACACGGTGCCTCGGTCCTG
CTTCCATCCATGCAAGTGTCCTCCGCTCACCAGGGTGTTCTGAGGCAGCTCAAGTGCTCTCCCCCAAGCAGCACGCAGTCACCGCTGCCA
GTGATGAACACACGCACGGGCTAGGCACATGGAGCCCAAGCACACTGCCACCTCGGACACGGGCCCCGGCCCAGCGACTGCCTTGTGGTG
TGGCCGTCCTCATCTGCCACAGGAAGACAGACTTCGAGGGACCTCTTGCCTAAGGCCTCGCTGACTCAAGGGTAGATTGAGATTTGGACC
TAATAGGCTCCAGAACTGTGCTTTGAGCTACAGGGTGGCTGCAGGATGAGACGGATGCAGTTCAAAGTGCAGGATGTGCTGCCTTTATTA
CCTGCTTTCCCGCTGAGCAAATCCCTGTCTTGAGTGGGAAGTGGCATCTATTCCCCCAGCCATCTGAAAATGCTGTGTTCATAACCAAAT
AGGTGCTGTAGCTTCCTAGCCATCCCGCTCTTACCCGCCCCTCTGCAATGTAAAAGGCGTCCACTGTTGTGTAAATACACAGTTGCTTTC

>In-frame_EYA3_ENST00000373871_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_2414nt
AGGTTTCTAGTGGAACGAGGTGTGGATTGTGAGGTGACTCTGGCCGCTTACTTCCGGTTCCTAGCGATGCGCATCCGGGTCACGCTAACG
CCGCGGTTTCCTCCGCTCGATTGGTTCTACTGTGGGTCTGGACTGATCTCCATGTCCTGTTGTGGGGCTTTTACAGCCTTTGGATTGTGA
AAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCATGGAAGAAGAGCAAGATTTACCAGAGCA
ACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAATCCAGATGTCAGTGATCAGAAGCCTGAAAC
ATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATCCCTCGCTCATCCAATGATTATACCTCACA
AATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTACCCTGGACAGACTCAATACCAGACACTACA
GCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTTGGTGCATTGTGGCCAGGTATGAAACCTGA
AAGTGGTTTAATTCAGACTCCATCTCCAAGTCAACACAGTGTTCTTACCTGCACTACAGGGTTAACCACAAGCCAGCCAAGCCCAGCACA
TTATTCTTATCCCATTCAAGCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGC
CAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCAC
AGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGC
AGCACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAA
AAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTT
GGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGG
TTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGA
TGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGG
TTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAA
AAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTT
AGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCT
GGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCC
CTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCC
CAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTC
TGCGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGTCTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACT
CCCTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATAGACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGT
TGAACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGAGGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGAC
TCCCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTTGACTTGAATAGGATTATTCGATTTTTAAAAATACTTTT

>In-frame_EYA3_ENST00000436342_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_2348nt
GCGGTTTCCTCCGCTCGATTGGTTCTACTGTGGGTCTGGACTGATCTCCATGTCCTGTTGTGGGGCTTTTACAGCCTTTGGATTGTGAAA
ACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCATGGAAGAAGAGCAAGATTTACCAGAGCAAC
CAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAATCCAGATGTCAGTGATCAGAAGCCTGAAACAT
CAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATCCCTCGCTCATCCAATGATTATACCTCACAAA
TGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTACCCTGGACAGACTCAATACCAGACACTACAGC
AGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTTGGTGCATTGTGGCCAGGTATGAAACCTGAAA
GTGGTTTAATTCAGACTCCATCTCCAAGTCAACACAGTGTTCTTACCTGCACTACAGGGTTAACCACAAGCCAGCCAAGCCCAGCACATT
ATTCTTATCCCATTCAAGCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCA
GCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAG
GTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAG
CACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAA
ACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGG
ATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTT
TAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATG
TGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTT
CATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAA
GCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAG
GAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGG
CCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCT
CTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCA
AGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTG
CGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGTCTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACTCC
CTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATAGACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGTTG
AACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGAGGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGACTC
CCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTTGACTTGAATAGGATTATTCGATTTTTAAAAATACTTTTCC
ATGTTTTCTGAGTGCTCTATGATAAATCAGTTGCATCTGTGATAATACAGTACATATGTGGACATAAACAGGGATCAAATAAAGGAGGTA

>In-frame_EYA3_ENST00000436342_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_3785nt
GCGGTTTCCTCCGCTCGATTGGTTCTACTGTGGGTCTGGACTGATCTCCATGTCCTGTTGTGGGGCTTTTACAGCCTTTGGATTGTGAAA
ACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCATGGAAGAAGAGCAAGATTTACCAGAGCAAC
CAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAATCCAGATGTCAGTGATCAGAAGCCTGAAACAT
CAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATCCCTCGCTCATCCAATGATTATACCTCACAAA
TGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTACCCTGGACAGACTCAATACCAGACACTACAGC
AGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTTGGTGCATTGTGGCCAGGTATGAAACCTGAAA
GTGGTTTAATTCAGACTCCATCTCCAAGTCAACACAGTGTTCTTACCTGCACTACAGGGTTAACCACAAGCCAGCCAAGCCCAGCACATT
ATTCTTATCCCATTCAAGCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCA
GCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAG
GTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAG
CACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAA
ACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGG
ATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTT
TAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATG
TGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTT
CATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAA
GCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAG
GAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGG
CCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCT
CTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCA
AGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTG
CGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGTCTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACTCC
CTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATAGACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGTTG
AACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGAGGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGACTC
CCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTTGACTTGAATAGGATTATTCGATTTTTAAAAATACTTTTCC
ATGTTTTCTGAGTGCTCTATGATAAATCAGTTGCATCTGTGATAATACAGTACATATGTGGACATAAACAGGGATCAAATAAAGGAGGTA
TTGCTGCAGTCCAGCCAGGTTGAAAGGGAAGGGGGGTCCCCAAAGGTCCATTGGATGGCAGGTGTCTACAGAGGCTCGCCTTTGGGTGGA
ACTCTGACCCACCTAAGGTTTACTTTGCTATTTCAGGAAGGTTGAAGAGGATTGAAGGGTGAGTTGCTAAGTGACTTAGGGTTTATTCAC
TTCAGGAATCATAGCTGGGGTGGACCCCAGGAGCAGAGTACTGCATGCAGCTGTGCCCATGCATGGTTGCCCCAGCGTAGTGAGATGGGA
CCTGCCGCAGCATGCCCACTCCTGAGCTGCCAGGCTGAGCCATGGAGGACTGAAAGGAGGTCGCCCGGCATCACCTCCCGAGGTGAGACC
TGCTGCAAAAGCCAAGCCAGCAGCATTGACGCCCTTTGATATCTTCGCCATTTTTGCTGCTGAAAGACTTGGCTTTTCAGTCTGACCCTG
GCCCTCTGTGACCATGTGTCTGTAAAGCCAGTGGGTCAGGCCCTTCCATGCAGGGCCAGAGGAAAAGCGGGCCCAGGGCTGCAGTGAGAG
CGGGGCAGGGGACCAGCCTACCAGATGGGTTGGAAACATGGCTCAGAAGGACCAACTACCCCTTCCCTTTGAGGAGCAAGTCTCTGCCGA
TCAGCAAGGCAAGGCCAGGAGCCCTCCTGGCGAAAGGCAGGCCACAAATCTGTTCTCCCCCAGGAGAAGTAGCAGTGCCAGGGCTTTGCG
TTTCTGGTAACTTCCACCCAAACCACACCAGAGAGAAACACCGTAGTGGAGAAGGGAAGTGGGAGCGCTGACTGCTGTGTGCCAGGAGAG
TAGAAAGGCCCAGGTCTGTGCCACCACCCCTCCCCAAAGCTCAGTGCACCCAGAGTCTCACAGGGACCAACACGGTGCCTCGGTCCTGCT
TCCATCCATGCAAGTGTCCTCCGCTCACCAGGGTGTTCTGAGGCAGCTCAAGTGCTCTCCCCCAAGCAGCACGCAGTCACCGCTGCCAGT
GATGAACACACGCACGGGCTAGGCACATGGAGCCCAAGCACACTGCCACCTCGGACACGGGCCCCGGCCCAGCGACTGCCTTGTGGTGTG
GCCGTCCTCATCTGCCACAGGAAGACAGACTTCGAGGGACCTCTTGCCTAAGGCCTCGCTGACTCAAGGGTAGATTGAGATTTGGACCTA
ATAGGCTCCAGAACTGTGCTTTGAGCTACAGGGTGGCTGCAGGATGAGACGGATGCAGTTCAAAGTGCAGGATGTGCTGCCTTTATTACC
TGCTTTCCCGCTGAGCAAATCCCTGTCTTGAGTGGGAAGTGGCATCTATTCCCCCAGCCATCTGAAAATGCTGTGTTCATAACCAAATAG
GTGCTGTAGCTTCCTAGCCATCCCGCTCTTACCCGCCCCTCTGCAATGTAAAAGGCGTCCACTGTTGTGTAAATACACAGTTGCTTTCCA

>In-frame_EYA3_ENST00000436342_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_2322nt
GCGGTTTCCTCCGCTCGATTGGTTCTACTGTGGGTCTGGACTGATCTCCATGTCCTGTTGTGGGGCTTTTACAGCCTTTGGATTGTGAAA
ACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCATGGAAGAAGAGCAAGATTTACCAGAGCAAC
CAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAATCCAGATGTCAGTGATCAGAAGCCTGAAACAT
CAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATCCCTCGCTCATCCAATGATTATACCTCACAAA
TGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTACCCTGGACAGACTCAATACCAGACACTACAGC
AGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTTGGTGCATTGTGGCCAGGTATGAAACCTGAAA
GTGGTTTAATTCAGACTCCATCTCCAAGTCAACACAGTGTTCTTACCTGCACTACAGGGTTAACCACAAGCCAGCCAAGCCCAGCACATT
ATTCTTATCCCATTCAAGCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCA
GCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAG
GTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAG
CACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAA
ACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGG
ATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTT
TAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATG
TGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTT
CATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAA
GCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAG
GAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGG
CCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCT
CTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCA
AGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTG
CGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGTCTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACTCC
CTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATAGACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGTTG
AACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGAGGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGACTC
CCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTTGACTTGAATAGGATTATTCGATTTTTAAAAATACTTTTCC

>In-frame_EYA3_ENST00000373864_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_1938nt
AAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCATGGAAGAAGAGCAAGATTTACCAGAGCA
ACCATCAAGTAAGCAATCCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGA
CATGCACCGATTACATCCCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAACTTCAAGCACAAATGCCAGCCTGATATCT
ACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAAT
CAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACA
TACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCTGACCCTTCTACAAGTCCATCTTTGTCCCAG
ACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCC
CAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAG
AAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTC
AATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACA
GATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTC
CGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGA
TTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTG
AATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATC
TATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTC
AAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATT
TACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGT
CTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACTCCCTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATA
GACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGTTGAACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGA
GGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGACTCCCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTT
GACTTGAATAGGATTATTCGATTTTTAAAAATACTTTTCCATGTTTTCTGAGTGCTCTATGATAAATCAGTTGCATCTGTGATAATACAG

>In-frame_EYA3_ENST00000373864_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_3375nt
AAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCATGGAAGAAGAGCAAGATTTACCAGAGCA
ACCATCAAGTAAGCAATCCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGA
CATGCACCGATTACATCCCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAACTTCAAGCACAAATGCCAGCCTGATATCT
ACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAAT
CAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACA
TACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCTGACCCTTCTACAAGTCCATCTTTGTCCCAG
ACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCC
CAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAG
AAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTC
AATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACA
GATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTC
CGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGA
TTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTG
AATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATC
TATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTC
AAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATT
TACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGT
CTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACTCCCTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATA
GACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGTTGAACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGA
GGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGACTCCCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTT
GACTTGAATAGGATTATTCGATTTTTAAAAATACTTTTCCATGTTTTCTGAGTGCTCTATGATAAATCAGTTGCATCTGTGATAATACAG
TACATATGTGGACATAAACAGGGATCAAATAAAGGAGGTATTGCTGCAGTCCAGCCAGGTTGAAAGGGAAGGGGGGTCCCCAAAGGTCCA
TTGGATGGCAGGTGTCTACAGAGGCTCGCCTTTGGGTGGAACTCTGACCCACCTAAGGTTTACTTTGCTATTTCAGGAAGGTTGAAGAGG
ATTGAAGGGTGAGTTGCTAAGTGACTTAGGGTTTATTCACTTCAGGAATCATAGCTGGGGTGGACCCCAGGAGCAGAGTACTGCATGCAG
CTGTGCCCATGCATGGTTGCCCCAGCGTAGTGAGATGGGACCTGCCGCAGCATGCCCACTCCTGAGCTGCCAGGCTGAGCCATGGAGGAC
TGAAAGGAGGTCGCCCGGCATCACCTCCCGAGGTGAGACCTGCTGCAAAAGCCAAGCCAGCAGCATTGACGCCCTTTGATATCTTCGCCA
TTTTTGCTGCTGAAAGACTTGGCTTTTCAGTCTGACCCTGGCCCTCTGTGACCATGTGTCTGTAAAGCCAGTGGGTCAGGCCCTTCCATG
CAGGGCCAGAGGAAAAGCGGGCCCAGGGCTGCAGTGAGAGCGGGGCAGGGGACCAGCCTACCAGATGGGTTGGAAACATGGCTCAGAAGG
ACCAACTACCCCTTCCCTTTGAGGAGCAAGTCTCTGCCGATCAGCAAGGCAAGGCCAGGAGCCCTCCTGGCGAAAGGCAGGCCACAAATC
TGTTCTCCCCCAGGAGAAGTAGCAGTGCCAGGGCTTTGCGTTTCTGGTAACTTCCACCCAAACCACACCAGAGAGAAACACCGTAGTGGA
GAAGGGAAGTGGGAGCGCTGACTGCTGTGTGCCAGGAGAGTAGAAAGGCCCAGGTCTGTGCCACCACCCCTCCCCAAAGCTCAGTGCACC
CAGAGTCTCACAGGGACCAACACGGTGCCTCGGTCCTGCTTCCATCCATGCAAGTGTCCTCCGCTCACCAGGGTGTTCTGAGGCAGCTCA
AGTGCTCTCCCCCAAGCAGCACGCAGTCACCGCTGCCAGTGATGAACACACGCACGGGCTAGGCACATGGAGCCCAAGCACACTGCCACC
TCGGACACGGGCCCCGGCCCAGCGACTGCCTTGTGGTGTGGCCGTCCTCATCTGCCACAGGAAGACAGACTTCGAGGGACCTCTTGCCTA
AGGCCTCGCTGACTCAAGGGTAGATTGAGATTTGGACCTAATAGGCTCCAGAACTGTGCTTTGAGCTACAGGGTGGCTGCAGGATGAGAC
GGATGCAGTTCAAAGTGCAGGATGTGCTGCCTTTATTACCTGCTTTCCCGCTGAGCAAATCCCTGTCTTGAGTGGGAAGTGGCATCTATT
CCCCCAGCCATCTGAAAATGCTGTGTTCATAACCAAATAGGTGCTGTAGCTTCCTAGCCATCCCGCTCTTACCCGCCCCTCTGCAATGTA

>In-frame_EYA3_ENST00000373864_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_1912nt
AAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCATGGAAGAAGAGCAAGATTTACCAGAGCA
ACCATCAAGTAAGCAATCCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGA
CATGCACCGATTACATCCCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAACTTCAAGCACAAATGCCAGCCTGATATCT
ACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAAT
CAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACA
TACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCTGACCCTTCTACAAGTCCATCTTTGTCCCAG
ACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCC
CAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAG
AAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTC
AATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACA
GATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTC
CGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGA
TTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTG
AATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATC
TATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTC
AAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATT
TACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGT
CTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACTCCCTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATA
GACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGTTGAACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGA
GGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGACTCCCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTT
GACTTGAATAGGATTATTCGATTTTTAAAAATACTTTTCCATGTTTTCTGAGTGCTCTATGATAAATCAGTTGCATCTGTGATAATACAG

>In-frame_EYA3_ENST00000540618_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_2237nt
GATGCGCATCCGGGTCACGCTAACGCCGCGGTTTCCTCCGCTCGATTGGTTCTACTGTGGGTCTGGACTGATCTCCATGTCCTGTTGTGG
GGCTTTTACAGCCTTTGGATTGTGAAAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCATGG
AAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAATCCAG
ATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATCCCTC
GCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTACCCTG
GACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTTGCTT
CAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGATTATC
CCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGATGCAG
AGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCTGGAG
ACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAACCGGG
GCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATCTTCC
ACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATGATTT
TTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAATGGCC
AAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAGGGAG
GTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTCCTCA
GTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCCTTAC
TTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATATGGAC
TAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAA
TCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTG
TGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCGAAGG
GAACGATTGACCTGTGAATTCTTTGCCGTCTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACTCCCTAAATGTCCACCTTTCAGTG
AAGAGATAGTTAAGCCAATTCCATTTATAGACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGTTGAACAACATGGGAAGGTCGCAG
CGTACTAAGTGAAGAAGTCAGAGGACAGAGGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGACTCCCATGGGGAGGAACAGACTGG
CAGGAAGCACACCGGGGTTAACACTGGTTGACTTGAATAGGATTATTCGATTTTTAAAAATACTTTTCCATGTTTTCTGAGTGCTCTATG

>In-frame_EYA3_ENST00000540618_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_3674nt
GATGCGCATCCGGGTCACGCTAACGCCGCGGTTTCCTCCGCTCGATTGGTTCTACTGTGGGTCTGGACTGATCTCCATGTCCTGTTGTGG
GGCTTTTACAGCCTTTGGATTGTGAAAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCATGG
AAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAATCCAG
ATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATCCCTC
GCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTACCCTG
GACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTTGCTT
CAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGATTATC
CCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGATGCAG
AGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCTGGAG
ACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAACCGGG
GCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATCTTCC
ACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATGATTT
TTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAATGGCC
AAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAGGGAG
GTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTCCTCA
GTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCCTTAC
TTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATATGGAC
TAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAA
TCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTG
TGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCGAAGG
GAACGATTGACCTGTGAATTCTTTGCCGTCTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACTCCCTAAATGTCCACCTTTCAGTG
AAGAGATAGTTAAGCCAATTCCATTTATAGACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGTTGAACAACATGGGAAGGTCGCAG
CGTACTAAGTGAAGAAGTCAGAGGACAGAGGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGACTCCCATGGGGAGGAACAGACTGG
CAGGAAGCACACCGGGGTTAACACTGGTTGACTTGAATAGGATTATTCGATTTTTAAAAATACTTTTCCATGTTTTCTGAGTGCTCTATG
ATAAATCAGTTGCATCTGTGATAATACAGTACATATGTGGACATAAACAGGGATCAAATAAAGGAGGTATTGCTGCAGTCCAGCCAGGTT
GAAAGGGAAGGGGGGTCCCCAAAGGTCCATTGGATGGCAGGTGTCTACAGAGGCTCGCCTTTGGGTGGAACTCTGACCCACCTAAGGTTT
ACTTTGCTATTTCAGGAAGGTTGAAGAGGATTGAAGGGTGAGTTGCTAAGTGACTTAGGGTTTATTCACTTCAGGAATCATAGCTGGGGT
GGACCCCAGGAGCAGAGTACTGCATGCAGCTGTGCCCATGCATGGTTGCCCCAGCGTAGTGAGATGGGACCTGCCGCAGCATGCCCACTC
CTGAGCTGCCAGGCTGAGCCATGGAGGACTGAAAGGAGGTCGCCCGGCATCACCTCCCGAGGTGAGACCTGCTGCAAAAGCCAAGCCAGC
AGCATTGACGCCCTTTGATATCTTCGCCATTTTTGCTGCTGAAAGACTTGGCTTTTCAGTCTGACCCTGGCCCTCTGTGACCATGTGTCT
GTAAAGCCAGTGGGTCAGGCCCTTCCATGCAGGGCCAGAGGAAAAGCGGGCCCAGGGCTGCAGTGAGAGCGGGGCAGGGGACCAGCCTAC
CAGATGGGTTGGAAACATGGCTCAGAAGGACCAACTACCCCTTCCCTTTGAGGAGCAAGTCTCTGCCGATCAGCAAGGCAAGGCCAGGAG
CCCTCCTGGCGAAAGGCAGGCCACAAATCTGTTCTCCCCCAGGAGAAGTAGCAGTGCCAGGGCTTTGCGTTTCTGGTAACTTCCACCCAA
ACCACACCAGAGAGAAACACCGTAGTGGAGAAGGGAAGTGGGAGCGCTGACTGCTGTGTGCCAGGAGAGTAGAAAGGCCCAGGTCTGTGC
CACCACCCCTCCCCAAAGCTCAGTGCACCCAGAGTCTCACAGGGACCAACACGGTGCCTCGGTCCTGCTTCCATCCATGCAAGTGTCCTC
CGCTCACCAGGGTGTTCTGAGGCAGCTCAAGTGCTCTCCCCCAAGCAGCACGCAGTCACCGCTGCCAGTGATGAACACACGCACGGGCTA
GGCACATGGAGCCCAAGCACACTGCCACCTCGGACACGGGCCCCGGCCCAGCGACTGCCTTGTGGTGTGGCCGTCCTCATCTGCCACAGG
AAGACAGACTTCGAGGGACCTCTTGCCTAAGGCCTCGCTGACTCAAGGGTAGATTGAGATTTGGACCTAATAGGCTCCAGAACTGTGCTT
TGAGCTACAGGGTGGCTGCAGGATGAGACGGATGCAGTTCAAAGTGCAGGATGTGCTGCCTTTATTACCTGCTTTCCCGCTGAGCAAATC
CCTGTCTTGAGTGGGAAGTGGCATCTATTCCCCCAGCCATCTGAAAATGCTGTGTTCATAACCAAATAGGTGCTGTAGCTTCCTAGCCAT

>In-frame_EYA3_ENST00000540618_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_2211nt
GATGCGCATCCGGGTCACGCTAACGCCGCGGTTTCCTCCGCTCGATTGGTTCTACTGTGGGTCTGGACTGATCTCCATGTCCTGTTGTGG
GGCTTTTACAGCCTTTGGATTGTGAAAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCATGG
AAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTCAAGTAAGCAATCCAG
ATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTATGACATGCACCGATTACATCCCTC
GCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAAACTGCTTACCCTG
GACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTACCTCCTTTTGCTT
CAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGATTATC
CCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGATGCAG
AGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCTGGAG
ACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAACCGGG
GCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATCTTCC
ACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATGATTT
TTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAATGGCC
AAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAGGGAG
GTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTCCTCA
GTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCCTTAC
TTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATATGGAC
TAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAA
TCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTG
TGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCGAAGG
GAACGATTGACCTGTGAATTCTTTGCCGTCTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACTCCCTAAATGTCCACCTTTCAGTG
AAGAGATAGTTAAGCCAATTCCATTTATAGACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGTTGAACAACATGGGAAGGTCGCAG
CGTACTAAGTGAAGAAGTCAGAGGACAGAGGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGACTCCCATGGGGAGGAACAGACTGG
CAGGAAGCACACCGGGGTTAACACTGGTTGACTTGAATAGGATTATTCGATTTTTAAAAATACTTTTCCATGTTTTCTGAGTGCTCTATG

>In-frame_EYA3_ENST00000545175_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_2298nt
AGCGATGCGCATCCGGGTCACGCTAACGCCGCGGTTTCCTCCGCTCGATTGGTTCTACTGTGGGTCTGGACTGATCTCCATGTCCTGTTG
TGGGGCTTTTACAGCCTTTGGATTGTGAAAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCA
TGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTTATGACATGCACC
GATTACATCCCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAA
ACTGCTTACCCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTA
CCTCCTTTTGGTGCATTGTGGCCAGGTATGAAACCTGAAAGTGGTTTAATTCAGACTCCATCTCCAAGTCAACACAGTGTTCTTACCTGC
ACTACAGGGTTAACCACAAGCCAGCCAAGCCCAGCACATTATTCTTATCCCATTCAAGCTTCAAGCACAAATGCCAGCCTGATATCTACT
TCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAG
TACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATAC
CAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAG
ACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCC
CAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAG
AAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTC
AATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACA
GATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTC
CGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGA
TTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTG
AATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATC
TATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTC
AAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATT
TACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGT
CTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACTCCCTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATA
GACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGTTGAACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGA
GGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGACTCCCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTT
GACTTGAATAGGATTATTCGATTTTTAAAAATACTTTTCCATGTTTTCTGAGTGCTCTATGATAAATCAGTTGCATCTGTGATAATACAG

>In-frame_EYA3_ENST00000545175_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_3735nt
AGCGATGCGCATCCGGGTCACGCTAACGCCGCGGTTTCCTCCGCTCGATTGGTTCTACTGTGGGTCTGGACTGATCTCCATGTCCTGTTG
TGGGGCTTTTACAGCCTTTGGATTGTGAAAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCA
TGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTTATGACATGCACC
GATTACATCCCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAA
ACTGCTTACCCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTA
CCTCCTTTTGGTGCATTGTGGCCAGGTATGAAACCTGAAAGTGGTTTAATTCAGACTCCATCTCCAAGTCAACACAGTGTTCTTACCTGC
ACTACAGGGTTAACCACAAGCCAGCCAAGCCCAGCACATTATTCTTATCCCATTCAAGCTTCAAGCACAAATGCCAGCCTGATATCTACT
TCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAG
TACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATAC
CAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAG
ACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCC
CAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAG
AAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTC
AATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACA
GATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTC
CGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGA
TTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTG
AATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATC
TATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTC
AAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATT
TACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGT
CTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACTCCCTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATA
GACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGTTGAACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGA
GGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGACTCCCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTT
GACTTGAATAGGATTATTCGATTTTTAAAAATACTTTTCCATGTTTTCTGAGTGCTCTATGATAAATCAGTTGCATCTGTGATAATACAG
TACATATGTGGACATAAACAGGGATCAAATAAAGGAGGTATTGCTGCAGTCCAGCCAGGTTGAAAGGGAAGGGGGGTCCCCAAAGGTCCA
TTGGATGGCAGGTGTCTACAGAGGCTCGCCTTTGGGTGGAACTCTGACCCACCTAAGGTTTACTTTGCTATTTCAGGAAGGTTGAAGAGG
ATTGAAGGGTGAGTTGCTAAGTGACTTAGGGTTTATTCACTTCAGGAATCATAGCTGGGGTGGACCCCAGGAGCAGAGTACTGCATGCAG
CTGTGCCCATGCATGGTTGCCCCAGCGTAGTGAGATGGGACCTGCCGCAGCATGCCCACTCCTGAGCTGCCAGGCTGAGCCATGGAGGAC
TGAAAGGAGGTCGCCCGGCATCACCTCCCGAGGTGAGACCTGCTGCAAAAGCCAAGCCAGCAGCATTGACGCCCTTTGATATCTTCGCCA
TTTTTGCTGCTGAAAGACTTGGCTTTTCAGTCTGACCCTGGCCCTCTGTGACCATGTGTCTGTAAAGCCAGTGGGTCAGGCCCTTCCATG
CAGGGCCAGAGGAAAAGCGGGCCCAGGGCTGCAGTGAGAGCGGGGCAGGGGACCAGCCTACCAGATGGGTTGGAAACATGGCTCAGAAGG
ACCAACTACCCCTTCCCTTTGAGGAGCAAGTCTCTGCCGATCAGCAAGGCAAGGCCAGGAGCCCTCCTGGCGAAAGGCAGGCCACAAATC
TGTTCTCCCCCAGGAGAAGTAGCAGTGCCAGGGCTTTGCGTTTCTGGTAACTTCCACCCAAACCACACCAGAGAGAAACACCGTAGTGGA
GAAGGGAAGTGGGAGCGCTGACTGCTGTGTGCCAGGAGAGTAGAAAGGCCCAGGTCTGTGCCACCACCCCTCCCCAAAGCTCAGTGCACC
CAGAGTCTCACAGGGACCAACACGGTGCCTCGGTCCTGCTTCCATCCATGCAAGTGTCCTCCGCTCACCAGGGTGTTCTGAGGCAGCTCA
AGTGCTCTCCCCCAAGCAGCACGCAGTCACCGCTGCCAGTGATGAACACACGCACGGGCTAGGCACATGGAGCCCAAGCACACTGCCACC
TCGGACACGGGCCCCGGCCCAGCGACTGCCTTGTGGTGTGGCCGTCCTCATCTGCCACAGGAAGACAGACTTCGAGGGACCTCTTGCCTA
AGGCCTCGCTGACTCAAGGGTAGATTGAGATTTGGACCTAATAGGCTCCAGAACTGTGCTTTGAGCTACAGGGTGGCTGCAGGATGAGAC
GGATGCAGTTCAAAGTGCAGGATGTGCTGCCTTTATTACCTGCTTTCCCGCTGAGCAAATCCCTGTCTTGAGTGGGAAGTGGCATCTATT
CCCCCAGCCATCTGAAAATGCTGTGTTCATAACCAAATAGGTGCTGTAGCTTCCTAGCCATCCCGCTCTTACCCGCCCCTCTGCAATGTA

>In-frame_EYA3_ENST00000545175_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_2272nt
AGCGATGCGCATCCGGGTCACGCTAACGCCGCGGTTTCCTCCGCTCGATTGGTTCTACTGTGGGTCTGGACTGATCTCCATGTCCTGTTG
TGGGGCTTTTACAGCCTTTGGATTGTGAAAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAATAAAGAAATATTGGTCCTCA
TGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAACTATAAGTTATGACATGCACC
GATTACATCCCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCCTGTTTCGGAA
ACTGCTTACCCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAACGTATGGACTA
CCTCCTTTTGGTGCATTGTGGCCAGGTATGAAACCTGAAAGTGGTTTAATTCAGACTCCATCTCCAAGTCAACACAGTGTTCTTACCTGC
ACTACAGGGTTAACCACAAGCCAGCCAAGCCCAGCACATTATTCTTATCCCATTCAAGCTTCAAGCACAAATGCCAGCCTGATATCTACT
TCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGCCAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAG
TACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCACAGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATAC
CAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGCAGCACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAG
ACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAAAAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCC
CAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTTGGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAG
AAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGGTTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTC
AATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGATGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACA
GATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGGTTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTC
CGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAAAAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGA
TTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTTAGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTG
AATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCTGGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATC
TATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCCCTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTC
AAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCCCAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATT
TACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTCTGCGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGT
CTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACTCCCTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATA
GACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGTTGAACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGA
GGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGACTCCCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTT
GACTTGAATAGGATTATTCGATTTTTAAAAATACTTTTCCATGTTTTCTGAGTGCTCTATGATAAATCAGTTGCATCTGTGATAATACAG

>In-frame_EYA3_ENST00000373863_chr1_28315046_-_POP4_ENST00000585603_chr19_30104778_+_2170nt
CTGATCTCCATGTCCTGTTGTGGGGCTTTTACAGCCTTTGGATTGTGAAAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAA
TAAAGAAATATTGGTCCTCATGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAAC
TATAAGTCAAGTAAGCAATCCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTAT
GACATGCACCGATTACATCCCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCC
TGTTTCGGAAACTGCTTACCCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAAC
GTATGGACTACCTCCTTTTGCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGC
CAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCAC
AGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGC
AGCACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAA
AAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTT
GGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGG
TTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGA
TGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGG
TTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAA
AAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTT
AGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCT
GGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCC
CTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCC
CAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTC
TGCGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGTCTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACT
CCCTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATAGACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGT
TGAACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGAGGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGAC
TCCCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTTGACTTGAATAGGATTATTCGATTTTTAAAAATACTTTT
CCATGTTTTCTGAGTGCTCTATGATAAATCAGTTGCATCTGTGATAATACAGTACATATGTGGACATAAACAGGGATCAAATAAAGGAGG

>In-frame_EYA3_ENST00000373863_chr1_28315046_-_POP4_ENST00000221770_chr19_30104778_+_3607nt
CTGATCTCCATGTCCTGTTGTGGGGCTTTTACAGCCTTTGGATTGTGAAAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAA
TAAAGAAATATTGGTCCTCATGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAAC
TATAAGTCAAGTAAGCAATCCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTAT
GACATGCACCGATTACATCCCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCC
TGTTTCGGAAACTGCTTACCCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAAC
GTATGGACTACCTCCTTTTGCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGC
CAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCAC
AGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGC
AGCACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAA
AAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTT
GGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGG
TTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGA
TGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGG
TTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAA
AAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTT
AGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCT
GGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCC
CTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCC
CAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTC
TGCGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGTCTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACT
CCCTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATAGACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGT
TGAACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGAGGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGAC
TCCCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTTGACTTGAATAGGATTATTCGATTTTTAAAAATACTTTT
CCATGTTTTCTGAGTGCTCTATGATAAATCAGTTGCATCTGTGATAATACAGTACATATGTGGACATAAACAGGGATCAAATAAAGGAGG
TATTGCTGCAGTCCAGCCAGGTTGAAAGGGAAGGGGGGTCCCCAAAGGTCCATTGGATGGCAGGTGTCTACAGAGGCTCGCCTTTGGGTG
GAACTCTGACCCACCTAAGGTTTACTTTGCTATTTCAGGAAGGTTGAAGAGGATTGAAGGGTGAGTTGCTAAGTGACTTAGGGTTTATTC
ACTTCAGGAATCATAGCTGGGGTGGACCCCAGGAGCAGAGTACTGCATGCAGCTGTGCCCATGCATGGTTGCCCCAGCGTAGTGAGATGG
GACCTGCCGCAGCATGCCCACTCCTGAGCTGCCAGGCTGAGCCATGGAGGACTGAAAGGAGGTCGCCCGGCATCACCTCCCGAGGTGAGA
CCTGCTGCAAAAGCCAAGCCAGCAGCATTGACGCCCTTTGATATCTTCGCCATTTTTGCTGCTGAAAGACTTGGCTTTTCAGTCTGACCC
TGGCCCTCTGTGACCATGTGTCTGTAAAGCCAGTGGGTCAGGCCCTTCCATGCAGGGCCAGAGGAAAAGCGGGCCCAGGGCTGCAGTGAG
AGCGGGGCAGGGGACCAGCCTACCAGATGGGTTGGAAACATGGCTCAGAAGGACCAACTACCCCTTCCCTTTGAGGAGCAAGTCTCTGCC
GATCAGCAAGGCAAGGCCAGGAGCCCTCCTGGCGAAAGGCAGGCCACAAATCTGTTCTCCCCCAGGAGAAGTAGCAGTGCCAGGGCTTTG
CGTTTCTGGTAACTTCCACCCAAACCACACCAGAGAGAAACACCGTAGTGGAGAAGGGAAGTGGGAGCGCTGACTGCTGTGTGCCAGGAG
AGTAGAAAGGCCCAGGTCTGTGCCACCACCCCTCCCCAAAGCTCAGTGCACCCAGAGTCTCACAGGGACCAACACGGTGCCTCGGTCCTG
CTTCCATCCATGCAAGTGTCCTCCGCTCACCAGGGTGTTCTGAGGCAGCTCAAGTGCTCTCCCCCAAGCAGCACGCAGTCACCGCTGCCA
GTGATGAACACACGCACGGGCTAGGCACATGGAGCCCAAGCACACTGCCACCTCGGACACGGGCCCCGGCCCAGCGACTGCCTTGTGGTG
TGGCCGTCCTCATCTGCCACAGGAAGACAGACTTCGAGGGACCTCTTGCCTAAGGCCTCGCTGACTCAAGGGTAGATTGAGATTTGGACC
TAATAGGCTCCAGAACTGTGCTTTGAGCTACAGGGTGGCTGCAGGATGAGACGGATGCAGTTCAAAGTGCAGGATGTGCTGCCTTTATTA
CCTGCTTTCCCGCTGAGCAAATCCCTGTCTTGAGTGGGAAGTGGCATCTATTCCCCCAGCCATCTGAAAATGCTGTGTTCATAACCAAAT
AGGTGCTGTAGCTTCCTAGCCATCCCGCTCTTACCCGCCCCTCTGCAATGTAAAAGGCGTCCACTGTTGTGTAAATACACAGTTGCTTTC

>In-frame_EYA3_ENST00000373863_chr1_28315046_-_POP4_ENST00000392279_chr19_30104778_+_2144nt
CTGATCTCCATGTCCTGTTGTGGGGCTTTTACAGCCTTTGGATTGTGAAAACTGCTGAGAGAGACTTGCAATCCAGTCACATAAGTATAA
TAAAGAAATATTGGTCCTCATGGAAGAAGAGCAAGATTTACCAGAGCAACCAGTGAAAAAAGCCAAGATGCAGGAATCAGGAGAGCAAAC
TATAAGTCAAGTAAGCAATCCAGATGTCAGTGATCAGAAGCCTGAAACATCAAGCCTTGCTTCAAACCTTCCCATGTCAGAGGAAATTAT
GACATGCACCGATTACATCCCTCGCTCATCCAATGATTATACCTCACAAATGTATTCTGCAAAACCTTATGCACATATTCTCTCAGTTCC
TGTTTCGGAAACTGCTTACCCTGGACAGACTCAATACCAGACACTACAGCAGACTCAACCCTATGCTGTCTACCCTCAGGCAACCCAAAC
GTATGGACTACCTCCTTTTGCTTCAAGCACAAATGCCAGCCTGATATCTACTTCTTCTACAATTGCCAATATTCCAGCAGCAGCAGTAGC
CAGCATCTCAAACCAGGATTATCCCACCTATACTATTCTTGGTCAGAATCAGTACCAGGCCTGCTACCCCAGCTCCAGCTTTGGAGTCAC
AGGTCAGACTAACAGTGATGCAGAGAGCACCACATTAGCAGCAACCACATACCAGTCGGAGAAGCCTAGTGTCATGGCGCCTGCACCTGC
AGCACAGAGACTTTCCTCTGGAGACCCTTCTACAAGTCCATCTTTGTCCCAGACTACACCAAGTAAAGATACTGATGATCAGTCCAGGAA
AAACATGACTAGCAAGAACCGGGGCAAGAGGAAAGCTGATGCCACTTCTTCCCAAGACAGTGAATTAGAACGGGTATTTCTGTGGGACTT
GGATGAAACCATCATCATCTTCCACTCACTTCTTACTGGATCCTATGCCCAGAAATATGGAAAGGACCCAACAGTAGTGATTGGCTCAGG
TTTAACAATGGAAGAAATGATTTTTGAAGTGGCTGATACTCATCTATTTTTCAATGACTTAGAGGAGTGTGACCAGGTACATGTGGAAGA
TGTGGCTTCTGATGACAATGGCCAAGACTTGAGCAACTACAGTTTCTCAACAGATGGTTTCAGTGGCTCAGGAGGTAGTGGCAGCCATGG
TTCATCTGTGGGTGTTCAGGGAGGTGTGGACTGGATGAGGAAACTAGCTTTCCGCTACCGGAAAGTGAGAGAAATCTATGATAAGCATAA
AAGCAACGTGGGTGGTCTCCTCAGTCCCCAGAGGAAGGAAGCACTGCAGAGATTAAGAGCAGAAATTGAAGTTTTAACAGATTCCTGGTT
AGGAACTGCATTAAAGTCCTTACTTCTCATCCAGTCCAGAAAGAATTGTGTGAATGTTCTGATCACTACCACCCAGCTGGTTCCAGCCCT
GGCCAAGGTTCTCCTATATGGACTAGGAGAAATATTTCCTATTGAGAACATCTATAGTGCTACCAAAATTGTGACAAAATCCAAATGCCC
CTCTTATGTGGGTATTACAGGAATCCTTCTACAGGAAACAAAGCACATTTTCAAAATTATCACCAAAGAAGACCGCCTGAAAGTTATCCC
CAAGCTAAACTGCGTGTTCACTGTGGAAACCGATGGCTTTATTTCCTACATTTACGGGAGCAAATTCCAGCTTCGGTCAAGTGAACGGTC
TGCGAAGAAGTTCAAAGCGAAGGGAACGATTGACCTGTGAATTCTTTGCCGTCTAAGGCAGTTGTTTATGACAGCTGAAAACTGGACACT
CCCTAAATGTCCACCTTTCAGTGAAGAGATAGTTAAGCCAATTCCATTTATAGACCACCTCCAGCCAGTGACGCTCCGAGTTGAGGATGT
TGAACAACATGGGAAGGTCGCAGCGTACTAAGTGAAGAAGTCAGAGGACAGAGGAATTTCTCTTTCTAGGAGATTTTCATTTTGTGTGAC
TCCCATGGGGAGGAACAGACTGGCAGGAAGCACACCGGGGTTAACACTGGTTGACTTGAATAGGATTATTCGATTTTTAAAAATACTTTT


Top

FusionGenePPI for EYA3_POP4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EYA3SIX5, H2AFX, SKI, ZDHHC17, TCEAL1, CRK, EWSR1, EYA3, MTMR3, SOAT1, PTRH2, MTMR2, GRPEL1, FHL2, TMEM126A, TSEN34, STIP1, NPPC, TIMM21, CACYBP, NME1, THTPA, TBP, DIS3L, CCDC28A, STX17, SIX2, TRIM25POP4POP1, POP4, POP5, RPP38, RPP25, RMRP, RPP25L, C3orf17, PRKCSH, NPM1, RPP40, C18orf21, POP7, RPP14, RPP30, RBM4B, VSIG4, CBWD1, IFI16, RPL10, S100A4, PRPF4, RPP21, OSTF1, RBM4, VTN, CDH5, AMD1, PCDH20, PCDHA3, PPP1R15A, IL20RA, RPL18A, IL13RA2, NME2P1, PPP1R9B, TOR1AIP2, PCDHGB4


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EYA3_POP4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EYA3_POP4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePOP4C0919267ovarian neoplasm1CTD_human