FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12328

FusionGeneSummary for EXT1_RSF1

check button Fusion gene summary
Fusion gene informationFusion gene name: EXT1_RSF1
Fusion gene ID: 12328
HgeneTgene
Gene symbol

EXT1

RSF1

Gene ID

2131

51773

Gene nameexostosin glycosyltransferase 1remodeling and spacing factor 1
SynonymsEXT|LGCR|LGS|TRPS2|TTVHBXAP|RSF-1|XAP8|p325
Cytomap

8q24.11

11q14.1

Type of geneprotein-codingprotein-coding
Descriptionexostosin-1Glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N- acetylglucosaminyltransferaseLanger-Giedion syndrome chromosome regionN-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferaseexostoses (multiple) 1glucuronosyl-N-acetylglucremodeling and spacing factor 1HBV pX-associated protein 8hepatitis B virus x-associated proteinp325 subunit of RSF chromatin-remodeling complex
Modification date2018052220180523
UniProtAcc

Q16394

Q96T23

Ensembl transtripts involved in fusion geneENST00000378204, ENST00000308488, 
ENST00000360355, ENST00000480887, 
ENST00000530604, 
Fusion gene scores* DoF score11 X 8 X 12=105610 X 8 X 7=560
# samples 1911
** MAII scorelog2(19/1056*10)=-2.47453851102751
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/560*10)=-2.34792330342031
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EXT1 [Title/Abstract] AND RSF1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEXT1

GO:0006024

glycosaminoglycan biosynthetic process

12907669

HgeneEXT1

GO:0015012

heparan sulfate proteoglycan biosynthetic process

9620772|10639137

HgeneEXT1

GO:0033692

cellular polysaccharide biosynthetic process

12907669

TgeneRSF1

GO:0006334

nucleosome assembly

12972596

TgeneRSF1

GO:0006338

chromatin remodeling

9836642

TgeneRSF1

GO:0006352

DNA-templated transcription, initiation

9836642

TgeneRSF1

GO:0016584

nucleosome positioning

9836642

TgeneRSF1

GO:0043392

negative regulation of DNA binding

12972596

TgeneRSF1

GO:0045892

negative regulation of transcription, DNA-templated

11944984

TgeneRSF1

GO:0045893

positive regulation of transcription, DNA-templated

11788598

TgeneRSF1

GO:0050434

positive regulation of viral transcription

11788598


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-BH-A1EN-01AEXT1chr8

118825111

-RSF1chr11

77451981

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000378204ENST00000308488EXT1chr8

118825111

-RSF1chr11

77451981

-
In-frameENST00000378204ENST00000360355EXT1chr8

118825111

-RSF1chr11

77451981

-
5CDS-intronENST00000378204ENST00000480887EXT1chr8

118825111

-RSF1chr11

77451981

-
5CDS-intronENST00000378204ENST00000530604EXT1chr8

118825111

-RSF1chr11

77451981

-

Top

FusionProtFeatures for EXT1_RSF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EXT1

Q16394

RSF1

Q96T23

Glycosyltransferase required for the biosynthesis ofheparan-sulfate. The EXT1/EXT2 complex possesses substantiallyhigher glycosyltransferase activity than EXT1 or EXT2 alone.Appears to be a tumor suppressor. Required for the exosomalrelease of SDCBP, CD63 and syndecan (PubMed:22660413).{ECO:0000269|PubMed:11518722, ECO:0000269|PubMed:22660413}. Required for assembly of regular nucleosome arrays bythe RSF chromatin-remodeling complex (PubMed:12972596).Facilitates transcription of hepatitis B virus (HBV) genes by thepX transcription activator. In case of infection by HBV, togetherwith pX, it represses TNF-alpha induced NF-kappa-B transcriptionactivation. Represses transcription when artificially recruited tochromatin by fusion to a heterogeneous DNA binding domain(PubMed:11944984, PubMed:11788598). {ECO:0000269|PubMed:11788598,ECO:0000269|PubMed:11944984, ECO:0000269|PubMed:12972596}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEXT1chr8:118825111chr11:77451981ENST00000378204-811544_549574747RegionSubstrate binding
HgeneEXT1chr8:118825111chr11:77451981ENST00000378204-811565_567574747RegionSubstrate binding
HgeneEXT1chr8:118825111chr11:77451981ENST00000378204-8111_7574747Topological domainCytoplasmic
HgeneEXT1chr8:118825111chr11:77451981ENST00000378204-8118_28574747TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneRSF1chr8:118825111chr11:77451981ENST00000308488-216942_10121241442Coiled coilOntology_term=ECO:0000255
TgeneRSF1chr8:118825111chr11:77451981ENST00000360355-115942_1012931411Coiled coilOntology_term=ECO:0000255
TgeneRSF1chr8:118825111chr11:77451981ENST00000480887-011942_1012-3541190Coiled coilOntology_term=ECO:0000255
TgeneRSF1chr8:118825111chr11:77451981ENST00000308488-2161080_10831241442Compositional biasNote=Poly-Ala
TgeneRSF1chr8:118825111chr11:77451981ENST00000308488-2161146_12431241442Compositional biasNote=Arg-rich
TgeneRSF1chr8:118825111chr11:77451981ENST00000308488-2161286_12921241442Compositional biasNote=Poly-Glu
TgeneRSF1chr8:118825111chr11:77451981ENST00000308488-2161419_14241241442Compositional biasNote=Poly-Glu
TgeneRSF1chr8:118825111chr11:77451981ENST00000308488-216226_3721241442Compositional biasNote=Glu-rich
TgeneRSF1chr8:118825111chr11:77451981ENST00000308488-216875_8841241442Compositional biasNote=Poly-Glu
TgeneRSF1chr8:118825111chr11:77451981ENST00000360355-1151080_1083931411Compositional biasNote=Poly-Ala
TgeneRSF1chr8:118825111chr11:77451981ENST00000360355-1151146_1243931411Compositional biasNote=Arg-rich
TgeneRSF1chr8:118825111chr11:77451981ENST00000360355-1151286_1292931411Compositional biasNote=Poly-Glu
TgeneRSF1chr8:118825111chr11:77451981ENST00000360355-1151419_1424931411Compositional biasNote=Poly-Glu
TgeneRSF1chr8:118825111chr11:77451981ENST00000360355-115226_372931411Compositional biasNote=Glu-rich
TgeneRSF1chr8:118825111chr11:77451981ENST00000360355-115875_884931411Compositional biasNote=Poly-Glu
TgeneRSF1chr8:118825111chr11:77451981ENST00000480887-0111080_1083-3541190Compositional biasNote=Poly-Ala
TgeneRSF1chr8:118825111chr11:77451981ENST00000480887-0111146_1243-3541190Compositional biasNote=Arg-rich
TgeneRSF1chr8:118825111chr11:77451981ENST00000480887-0111286_1292-3541190Compositional biasNote=Poly-Glu
TgeneRSF1chr8:118825111chr11:77451981ENST00000480887-0111419_1424-3541190Compositional biasNote=Poly-Glu
TgeneRSF1chr8:118825111chr11:77451981ENST00000480887-011226_372-3541190Compositional biasNote=Glu-rich
TgeneRSF1chr8:118825111chr11:77451981ENST00000480887-011875_884-3541190Compositional biasNote=Poly-Glu
TgeneRSF1chr8:118825111chr11:77451981ENST00000480887-01117_84-3541190DomainNote=DDT
TgeneRSF1chr8:118825111chr11:77451981ENST00000308488-216891_9411241442Zinc fingerPHD-type
TgeneRSF1chr8:118825111chr11:77451981ENST00000360355-115891_941931411Zinc fingerPHD-type
TgeneRSF1chr8:118825111chr11:77451981ENST00000480887-011891_941-3541190Zinc fingerPHD-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEXT1chr8:118825111chr11:77451981ENST00000378204-811650_654574747RegionSubstrate binding
HgeneEXT1chr8:118825111chr11:77451981ENST00000378204-811688_701574747RegionSubstrate binding
HgeneEXT1chr8:118825111chr11:77451981ENST00000378204-81129_746574747Topological domainLumenal
TgeneRSF1chr8:118825111chr11:77451981ENST00000308488-21617_841241442DomainNote=DDT
TgeneRSF1chr8:118825111chr11:77451981ENST00000360355-11517_84931411DomainNote=DDT


Top

FusionGeneSequence for EXT1_RSF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EXT1_ENST00000378204_chr8_118825111_-_RSF1_ENST00000308488_chr11_77451981_-_1892aa
MQAKKRTFILLSAGSCLALLFTFGGLQFRASRSHSRREEHSGRNGLHHPSPDHFWPRFPDALRPFVPWDQLENEDSSVHISPRQKRDANS
SIYKGKKCRMESCFDFTLCKKNGFKVYVYPQQKGEKIAESYQNILAAIEGSRFYTSDPSQACLFVLSLDTLDRDQLSPQTVHNLRSKVQS
LHLWNNGRNHLIFNLTSGTWPDYTEDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFKGKR
YLTGIGSDTRNALTHVHNGEDVVLLTTCKHGKDWQKHKDSRCDRDNTETEKTDTREMLHNATFCLVPRGRRLGSFRFLEALQAACVPVML
SNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSIHQDKILALRQQTQFLWEATFSSVEKIVLTTLEIIQDRIFKHISRNSLIWNKHPG
GLFVLPQTSSTLGDFPYYTANLGLKPPSKFTAVIHAVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATAVPVVVIE
GESKVMSSRFLPYDNIITDAVLSLDEDTVLSTTEYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQ
DDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLKNSSQQDNSSRESPSLEDEETKKEEETPKQEEQKESEKMKSEEQPMDLENRSTANV
LEETTVKKEKEDEKELVKLPVIVKLEKPLPENEEKKIIKEESDSFKENVKPIKVEVKECRADPKDTKSSMEKPVAQEPERIEFGGNIKSS
HEITEKSTEETEKLKNDQQAKIPLKKREIKLSDDFDSPVKGPLCKSVTPTKEFLKDEIKQEEETCKRISTITALGHEGKQLVNGEVSDER
VAPNFKTEPIETKFTETKEESTSPSKDRNIITEGNGTESLNSVITSMKTGELEKETAPLRKDADSSISVLEIHSQKAQIEEPDPPEMETS
LDSSEMAKDLSSKTALSSTESCTMKGEEKSPKTKKDKRPPILECLEKLEKSKKTFLDKDAQRLSPIPEEVPKSTLESEKPGSPEAAETSP
PSNIIDHCEKLASEKEVVECQSTSTVGGQSVKKVDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGSMQKSKFKTKLVPEEETTASE
NTEITSERQKEGIKLTIRISSRKKKPDSPPKVLEPENKQEKTEKEEEKTNVGRTLRRSPRISRPTAKVAEIRDQKADKKRGEGEDEVEEE
STALQKTDKKEILKKSEKDTNSKVSKVKPKGKVRWTGSRTRGRWKTSSNDESEGSGSEKSSAASEEEEEKESEEAILADDDEPCKKCGLP
NHPELILLCDSCDSGYHTACLRPPLMIIPDGEWFCPPCQHKLLCEKLEEQLQDLDVALKKKERAERRKERLVTVGISIENIIPPQEPDFS
EDQEEKKKDSKKSKANLLERRSTRTRKCISYRFDEFDEAIDEAIEDDIKEADGGGVGRGKDISTITGHRGKDISTILDEERKENKRPQRA
AAARRKKRRRLNDLDSDSNLDEEESEDEFKISDGSQDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRKTPKKK
TSDDDEEEESEENSRDSESDFSDDFSDDFVETRRRRSRRNQKRQINYKEDSESDGSQKSLRRGKEIRRVHKRRLSSSESEESTLSKNSED
DELAKESKRSVRKRGRSTDETSEADEEEEEEEGKPSRKRLHRIETDEEESCDNAHGDANQPARDSQPRVLPSEQESTKKPYRIESDEEED
FENVGKVGSPLDTSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDTVCNSEQ

>In-frame_EXT1_ENST00000378204_chr8_118825111_-_RSF1_ENST00000360355_chr11_77451981_-_1892aa
MQAKKRTFILLSAGSCLALLFTFGGLQFRASRSHSRREEHSGRNGLHHPSPDHFWPRFPDALRPFVPWDQLENEDSSVHISPRQKRDANS
SIYKGKKCRMESCFDFTLCKKNGFKVYVYPQQKGEKIAESYQNILAAIEGSRFYTSDPSQACLFVLSLDTLDRDQLSPQTVHNLRSKVQS
LHLWNNGRNHLIFNLTSGTWPDYTEDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFKGKR
YLTGIGSDTRNALTHVHNGEDVVLLTTCKHGKDWQKHKDSRCDRDNTETEKTDTREMLHNATFCLVPRGRRLGSFRFLEALQAACVPVML
SNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSIHQDKILALRQQTQFLWEATFSSVEKIVLTTLEIIQDRIFKHISRNSLIWNKHPG
GLFVLPQTSSTLGDFPYYTANLGLKPPSKFTAVIHAVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATAVPVVVIE
GESKVMSSRFLPYDNIITDAVLSLDEDTVLSTTEYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQ
DDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLKNSSQQDNSSRESPSLEDEETKKEEETPKQEEQKESEKMKSEEQPMDLENRSTANV
LEETTVKKEKEDEKELVKLPVIVKLEKPLPENEEKKIIKEESDSFKENVKPIKVEVKECRADPKDTKSSMEKPVAQEPERIEFGGNIKSS
HEITEKSTEETEKLKNDQQAKIPLKKREIKLSDDFDSPVKGPLCKSVTPTKEFLKDEIKQEEETCKRISTITALGHEGKQLVNGEVSDER
VAPNFKTEPIETKFTETKEESTSPSKDRNIITEGNGTESLNSVITSMKTGELEKETAPLRKDADSSISVLEIHSQKAQIEEPDPPEMETS
LDSSEMAKDLSSKTALSSTESCTMKGEEKSPKTKKDKRPPILECLEKLEKSKKTFLDKDAQRLSPIPEEVPKSTLESEKPGSPEAAETSP
PSNIIDHCEKLASEKEVVECQSTSTVGGQSVKKVDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGSMQKSKFKTKLVPEEETTASE
NTEITSERQKEGIKLTIRISSRKKKPDSPPKVLEPENKQEKTEKEEEKTNVGRTLRRSPRISRPTAKVAEIRDQKADKKRGEGEDEVEEE
STALQKTDKKEILKKSEKDTNSKVSKVKPKGKVRWTGSRTRGRWKTSSNDESEGSGSEKSSAASEEEEEKESEEAILADDDEPCKKCGLP
NHPELILLCDSCDSGYHTACLRPPLMIIPDGEWFCPPCQHKLLCEKLEEQLQDLDVALKKKERAERRKERLVTVGISIENIIPPQEPDFS
EDQEEKKKDSKKSKANLLERRSTRTRKCISYRFDEFDEAIDEAIEDDIKEADGGGVGRGKDISTITGHRGKDISTILDEERKENKRPQRA
AAARRKKRRRLNDLDSDSNLDEEESEDEFKISDGSQDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRKTPKKK
TSDDDEEEESEENSRDSESDFSDDFSDDFVETRRRRSRRNQKRQINYKEDSESDGSQKSLRRGKEIRRVHKRRLSSSESEESTLSKNSED
DELAKESKRSVRKRGRSTDETSEADEEEEEEEGKPSRKRLHRIETDEEESCDNAHGDANQPARDSQPRVLPSEQESTKKPYRIESDEEED
FENVGKVGSPLDTSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDTVCNSEQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EXT1_ENST00000378204_chr8_118825111_-_RSF1_ENST00000308488_chr11_77451981_-_5676nt
ATGCAGGCCAAAAAACGCTATTTCATCCTGCTCTCAGCTGGCTCTTGTCTCGCCCTTTTGTTTTATTTCGGAGGCTTGCAGTTTAGGGCA
TCGAGGAGCCACAGCCGGAGAGAAGAACACAGCGGTAGGAATGGCTTGCACCACCCCAGTCCGGATCATTTCTGGCCCCGCTTCCCGGAC
GCTCTGCGCCCCTTCGTTCCTTGGGATCAATTGGAAAACGAGGATTCCAGCGTGCACATTTCCCCCCGGCAGAAGCGAGATGCCAACTCC
AGCATCTACAAAGGCAAGAAGTGCCGCATGGAGTCCTGCTTCGATTTCACCCTTTGCAAGAAAAACGGCTTCAAAGTCTACGTATACCCA
CAGCAAAAAGGGGAGAAAATCGCCGAAAGTTACCAAAACATTCTAGCGGCCATCGAGGGCTCCAGGTTCTACACCTCGGACCCCAGCCAG
GCGTGCCTCTTTGTCCTGAGTCTGGATACTTTAGACAGAGACCAGTTGTCACCTCAGTATGTGCACAATTTGAGATCCAAAGTGCAGAGT
CTCCACTTGTGGAACAATGGTAGGAATCATTTAATTTTTAATTTATATTCCGGCACTTGGCCTGACTACACCGAGGACGTGGGGTTTGAC
ATCGGCCAGGCGATGCTGGCCAAAGCCAGCATCAGTACTGAAAACTTCCGACCCAACTTTGATGTTTCTATTCCCCTCTTTTCTAAGGAT
CATCCCAGGACAGGAGGGGAGAGGGGGTTTTTGAAGTTCAACACCATCCCTCCTCTCAGGAAGTACATGCTGGTATTCAAGGGGAAGAGG
TACCTGACAGGGATAGGATCAGACACCAGGAATGCCTTATATCACGTCCATAACGGGGAGGACGTTGTGCTCCTCACCACCTGCAAGCAT
GGCAAAGACTGGCAAAAGCACAAGGATTCTCGCTGTGACAGAGACAACACCGAGTATGAGAAGTATGATTATCGGGAAATGCTGCACAAT
GCCACTTTCTGTCTGGTTCCTCGTGGTCGCAGGCTTGGGTCCTTCAGATTCCTGGAGGCTTTGCAGGCTGCCTGCGTCCCTGTGATGCTC
AGCAATGGATGGGAGTTGCCATTCTCTGAAGTGATTAATTGGAACCAAGCTGCCGTCATAGGCGATGAGAGATTGTTATTACAGATTCCT
TCTACAATCAGGTCTATTCATCAGGATAAAATCCTAGCACTTAGACAGCAGACACAATTCTTGTGGGAGGCTTATTTTTCTTCAGTTGAG
AAGATTGTATTAACTACACTAGAGATTATTCAGGACAGAATATTCAAGCACATATCACGTAACAGTTTAATATGGAACAAACATCCTGGA
GGATTGTTCGTACTACCACAGTATTCATCTTATCTGGGAGATTTTCCTTACTACTATGCTAATTTAGGTTTAAAGCCCCCCTCCAAATTC
ACTGCAGTCATCCATGCGGTGACCCCCCTGGTCTCTCAGTCCCAGCCAGTGTTGAAGCTTCTCGTGGCTGCAGCCAAGTCCCAGTACTGT
GCCCAGATCATAGTTCTATGGAATTGTGACAAGCCCCTACCAGCCAAACACCGCTGGCCTGCCACTGCTGTGCCTGTCGTCGTCATTGAA
GGAGAGAGCAAGGTTATGAGCAGCCGTTTTCTGCCCTACGACAACATCATCACAGACGCCGTGCTCAGCCTTGACGAGGACACGGTGCTT
TCAACAACAGAGTACCTCTGTGAGTGTCAGTTTGATGACAATCTCAAATTCAAGAATATTATTAATGAGGAGGATGCCGATACTATGCGT
CTCCAGCCAATTGGTCGAGACAAAGATGGCCTCATGTACTGGTACCAATTGGATCAAGATCACAATGTCAGAATGTACATAGAAGAACAA
GATGATCAAGATGGCTCTTCATGGAAATGCATTGTCAGAAATCGAAACGAGTTGGCTGAGACTCTTGCACTCCTGAAAGCACAAATTGAT
CCTGTACTATTGAAAAACTCTAGCCAACAAGACAACTCTTCTCGGGAAAGTCCCAGCTTAGAGGATGAGGAGACTAAAAAAGAGGAAGAA
ACACCTAAACAAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGCCTATGGATTTAGAAAACCGTTCTACAGCCAATGTT
CTAGAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAACTGCCAGTCATAGTGAAGCTAGAAAAACCTTTGCCA
GAAAATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATGTCAAACCCATTAAAGTTGAGGTGAAGGAATGTAGA
GCAGATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTGAAAGGATCGAATTTGGTGGCAATATTAAATCTTCT
CACGAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGCAGGCCAAGATACCACTAAAAAAACGAGAAATTAAA
CTGAGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTCCAACAAAAGAGTTTTTGAAAGATGAAATAAAACAA
GAGGAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGAAACAGCTGGTAAATGGAGAAGTTAGTGATGAAAGG
GTAGCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGGAAGAGAGCTATAGCCCCTCTAAGGACAGAAATATC
ATCACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAACAGGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGG
AAAGATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAATAGAGGAACCCGATCCTCCAGAAATGGAAACTTCT
CTTGATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCACCGAGTCGTGTACCATGAAAGGTGAAGAGAAGTCT
CCCAAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAGAGAAGTCCAAAAAGACTTTTCTTGATAAGGACGCA
CAAAGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAAAGCCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCA
CCATCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAGAATGCCAGAGTACAAGTACTGTTGGTGGCCAGTCT
GTGAAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAGAAATGGATAATCTGGACAATGCCCAGACCTCTGGC
ATAGAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATAAGTTGGTTCCTGAAGAAGAAACCACTGCCTCAGAA
AATACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGATATCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCC
AAAGTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAACAAATGTGGGTCGTACTTTAAGAAGATCTCCAAGA
ATATCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAAAAAGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAG
TCAACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAGATACAAATTCTAAAGTAAGCAAGGTAAAACCCAAA
GGCAAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCAATGATGAAAGTGAAGGGTCTGGCAGTGAAAAATCA
TCTGCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAGATGATGATGAACCATGCAAAAAATGTGGCCTTCCA
AACCATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTGCCTGCCTTCGCCCTCCTCTGATGATCATCCCAGAT
GGAGAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGGAACAGTTGCAGGATTTGGATGTTGCCTTAAAGAAG
AAAGAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTGAAAACATCATTCCTCCACAAGAGCCAGACTTTTCT
GAAGATCAAGAAGAAAAGAAAAAAGATTCAAAAAAATCCAAAGCAAACTTGCTTGAAAGGAGGTCAACAAGAACAAGGAAATGTATAAGC
TACAGATTTGATGAGTTTGATGAAGCAATTGATGAAGCTATTGAAGATGACATCAAAGAAGCCGATGGAGGAGGAGTTGGCCGAGGAAAA
GATATCTCCACCATCACAGGTCATCGTGGGAAAGACATCTCTACTATTTTGGATGAAGAAAGAAAAGAAAATAAACGACCCCAGAGGGCA
GCTGCTGCTCGAAGGAAGAAACGCCGGCGATTAAATGATCTGGACAGTGATAGCAACCTGGATGAAGAAGAGAGCGAGGATGAATTCAAG
ATCAGTGATGGATCTCAAGATGAGTTTGTTGTGTCTGATGAAAACCCAGATGAAAGTGAAGAAGATCCGCCATCTAATGATGACAGTGAC
ACTGACTTTTGTAGCCGTAGACTGAGGCGACACCCCTCTCGGCCAATGAGGCAGAGCAGGCGTTTGCGAAGAAAGACCCCAAAGAAAAAA
TATTCCGATGATGATGAAGAGGAGGAATCTGAGGAGAATAGTAGAGACTCTGAAAGTGACTTCAGTGATGATTTTAGTGATGATTTTGTA
GAAACTCGGCGAAGGCGGTCAAGGAGAAATCAGAAAAGACAAATTAACTACAAAGAAGACTCAGAAAGTGACGGTTCCCAGAAGAGTTTG
CGACGTGGTAAAGAAATAAGGCGAGTACACAAGCGAAGACTTTCCAGCTCAGAGAGTGAAGAGAGCTATTTGTCCAAGAACTCTGAAGAT
GATGAGCTAGCTAAAGAATCAAAGCGGTCAGTTCGAAAGCGGGGCCGAAGCACAGACGAGTATTCAGAAGCAGATGAGGAGGAGGAGGAA
GAGGAAGGCAAACCATCCCGCAAACGGCTACACCGGATTGAGACGGATGAGGAGGAGAGTTGTGACAATGCTCATGGAGATGCAAATCAG
CCTGCCCGTGACAGCCAGCCTAGGGTCCTGCCCTCAGAACAAGAGAGCACCAAGAAGCCCTACCGGATAGAAAGTGATGAGGAAGAGGAC
TTTGAAAATGTAGGCAAAGTGGGGAGCCCATTGGACTATAGCTTAGTGGACTTACCTTCAACCAATGGACAGAGCCCTGGCAAAGCCATT
GAGAACTTGATTGGCAAGCCTACTGAGAAGTCTCAGACCCCCAAGGACAACAGCACAGCCAGTGCAAGCCTAGCCTCCAATGGGACAAGT
GGTGGGCAGGAGGCAGGAGCACCAGAAGAGGAGGAAGATGAGCTTTTGAGAGTGACTGACCTTGTTGATTATGTCTGTAACAGTGAACAG

>In-frame_EXT1_ENST00000378204_chr8_118825111_-_RSF1_ENST00000360355_chr11_77451981_-_5676nt
ATGCAGGCCAAAAAACGCTATTTCATCCTGCTCTCAGCTGGCTCTTGTCTCGCCCTTTTGTTTTATTTCGGAGGCTTGCAGTTTAGGGCA
TCGAGGAGCCACAGCCGGAGAGAAGAACACAGCGGTAGGAATGGCTTGCACCACCCCAGTCCGGATCATTTCTGGCCCCGCTTCCCGGAC
GCTCTGCGCCCCTTCGTTCCTTGGGATCAATTGGAAAACGAGGATTCCAGCGTGCACATTTCCCCCCGGCAGAAGCGAGATGCCAACTCC
AGCATCTACAAAGGCAAGAAGTGCCGCATGGAGTCCTGCTTCGATTTCACCCTTTGCAAGAAAAACGGCTTCAAAGTCTACGTATACCCA
CAGCAAAAAGGGGAGAAAATCGCCGAAAGTTACCAAAACATTCTAGCGGCCATCGAGGGCTCCAGGTTCTACACCTCGGACCCCAGCCAG
GCGTGCCTCTTTGTCCTGAGTCTGGATACTTTAGACAGAGACCAGTTGTCACCTCAGTATGTGCACAATTTGAGATCCAAAGTGCAGAGT
CTCCACTTGTGGAACAATGGTAGGAATCATTTAATTTTTAATTTATATTCCGGCACTTGGCCTGACTACACCGAGGACGTGGGGTTTGAC
ATCGGCCAGGCGATGCTGGCCAAAGCCAGCATCAGTACTGAAAACTTCCGACCCAACTTTGATGTTTCTATTCCCCTCTTTTCTAAGGAT
CATCCCAGGACAGGAGGGGAGAGGGGGTTTTTGAAGTTCAACACCATCCCTCCTCTCAGGAAGTACATGCTGGTATTCAAGGGGAAGAGG
TACCTGACAGGGATAGGATCAGACACCAGGAATGCCTTATATCACGTCCATAACGGGGAGGACGTTGTGCTCCTCACCACCTGCAAGCAT
GGCAAAGACTGGCAAAAGCACAAGGATTCTCGCTGTGACAGAGACAACACCGAGTATGAGAAGTATGATTATCGGGAAATGCTGCACAAT
GCCACTTTCTGTCTGGTTCCTCGTGGTCGCAGGCTTGGGTCCTTCAGATTCCTGGAGGCTTTGCAGGCTGCCTGCGTCCCTGTGATGCTC
AGCAATGGATGGGAGTTGCCATTCTCTGAAGTGATTAATTGGAACCAAGCTGCCGTCATAGGCGATGAGAGATTGTTATTACAGATTCCT
TCTACAATCAGGTCTATTCATCAGGATAAAATCCTAGCACTTAGACAGCAGACACAATTCTTGTGGGAGGCTTATTTTTCTTCAGTTGAG
AAGATTGTATTAACTACACTAGAGATTATTCAGGACAGAATATTCAAGCACATATCACGTAACAGTTTAATATGGAACAAACATCCTGGA
GGATTGTTCGTACTACCACAGTATTCATCTTATCTGGGAGATTTTCCTTACTACTATGCTAATTTAGGTTTAAAGCCCCCCTCCAAATTC
ACTGCAGTCATCCATGCGGTGACCCCCCTGGTCTCTCAGTCCCAGCCAGTGTTGAAGCTTCTCGTGGCTGCAGCCAAGTCCCAGTACTGT
GCCCAGATCATAGTTCTATGGAATTGTGACAAGCCCCTACCAGCCAAACACCGCTGGCCTGCCACTGCTGTGCCTGTCGTCGTCATTGAA
GGAGAGAGCAAGGTTATGAGCAGCCGTTTTCTGCCCTACGACAACATCATCACAGACGCCGTGCTCAGCCTTGACGAGGACACGGTGCTT
TCAACAACAGAGTACCTCTGTGAGTGTCAGTTTGATGACAATCTCAAATTCAAGAATATTATTAATGAGGAGGATGCCGATACTATGCGT
CTCCAGCCAATTGGTCGAGACAAAGATGGCCTCATGTACTGGTACCAATTGGATCAAGATCACAATGTCAGAATGTACATAGAAGAACAA
GATGATCAAGATGGCTCTTCATGGAAATGCATTGTCAGAAATCGAAACGAGTTGGCTGAGACTCTTGCACTCCTGAAAGCACAAATTGAT
CCTGTACTATTGAAAAACTCTAGCCAACAAGACAACTCTTCTCGGGAAAGTCCCAGCTTAGAGGATGAGGAGACTAAAAAAGAGGAAGAA
ACACCTAAACAAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGCCTATGGATTTAGAAAACCGTTCTACAGCCAATGTT
CTAGAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAACTGCCAGTCATAGTGAAGCTAGAAAAACCTTTGCCA
GAAAATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATGTCAAACCCATTAAAGTTGAGGTGAAGGAATGTAGA
GCAGATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTGAAAGGATCGAATTTGGTGGCAATATTAAATCTTCT
CACGAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGCAGGCCAAGATACCACTAAAAAAACGAGAAATTAAA
CTGAGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTCCAACAAAAGAGTTTTTGAAAGATGAAATAAAACAA
GAGGAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGAAACAGCTGGTAAATGGAGAAGTTAGTGATGAAAGG
GTAGCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGGAAGAGAGCTATAGCCCCTCTAAGGACAGAAATATC
ATCACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAACAGGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGG
AAAGATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAATAGAGGAACCCGATCCTCCAGAAATGGAAACTTCT
CTTGATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCACCGAGTCGTGTACCATGAAAGGTGAAGAGAAGTCT
CCCAAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAGAGAAGTCCAAAAAGACTTTTCTTGATAAGGACGCA
CAAAGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAAAGCCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCA
CCATCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAGAATGCCAGAGTACAAGTACTGTTGGTGGCCAGTCT
GTGAAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAGAAATGGATAATCTGGACAATGCCCAGACCTCTGGC
ATAGAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATAAGTTGGTTCCTGAAGAAGAAACCACTGCCTCAGAA
AATACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGATATCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCC
AAAGTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAACAAATGTGGGTCGTACTTTAAGAAGATCTCCAAGA
ATATCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAAAAAGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAG
TCAACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAGATACAAATTCTAAAGTAAGCAAGGTAAAACCCAAA
GGCAAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCAATGATGAAAGTGAAGGGTCTGGCAGTGAAAAATCA
TCTGCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAGATGATGATGAACCATGCAAAAAATGTGGCCTTCCA
AACCATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTGCCTGCCTTCGCCCTCCTCTGATGATCATCCCAGAT
GGAGAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGGAACAGTTGCAGGATTTGGATGTTGCCTTAAAGAAG
AAAGAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTGAAAACATCATTCCTCCACAAGAGCCAGACTTTTCT
GAAGATCAAGAAGAAAAGAAAAAAGATTCAAAAAAATCCAAAGCAAACTTGCTTGAAAGGAGGTCAACAAGAACAAGGAAATGTATAAGC
TACAGATTTGATGAGTTTGATGAAGCAATTGATGAAGCTATTGAAGATGACATCAAAGAAGCCGATGGAGGAGGAGTTGGCCGAGGAAAA
GATATCTCCACCATCACAGGTCATCGTGGGAAAGACATCTCTACTATTTTGGATGAAGAAAGAAAAGAAAATAAACGACCCCAGAGGGCA
GCTGCTGCTCGAAGGAAGAAACGCCGGCGATTAAATGATCTGGACAGTGATAGCAACCTGGATGAAGAAGAGAGCGAGGATGAATTCAAG
ATCAGTGATGGATCTCAAGATGAGTTTGTTGTGTCTGATGAAAACCCAGATGAAAGTGAAGAAGATCCGCCATCTAATGATGACAGTGAC
ACTGACTTTTGTAGCCGTAGACTGAGGCGACACCCCTCTCGGCCAATGAGGCAGAGCAGGCGTTTGCGAAGAAAGACCCCAAAGAAAAAA
TATTCCGATGATGATGAAGAGGAGGAATCTGAGGAGAATAGTAGAGACTCTGAAAGTGACTTCAGTGATGATTTTAGTGATGATTTTGTA
GAAACTCGGCGAAGGCGGTCAAGGAGAAATCAGAAAAGACAAATTAACTACAAAGAAGACTCAGAAAGTGACGGTTCCCAGAAGAGTTTG
CGACGTGGTAAAGAAATAAGGCGAGTACACAAGCGAAGACTTTCCAGCTCAGAGAGTGAAGAGAGCTATTTGTCCAAGAACTCTGAAGAT
GATGAGCTAGCTAAAGAATCAAAGCGGTCAGTTCGAAAGCGGGGCCGAAGCACAGACGAGTATTCAGAAGCAGATGAGGAGGAGGAGGAA
GAGGAAGGCAAACCATCCCGCAAACGGCTACACCGGATTGAGACGGATGAGGAGGAGAGTTGTGACAATGCTCATGGAGATGCAAATCAG
CCTGCCCGTGACAGCCAGCCTAGGGTCCTGCCCTCAGAACAAGAGAGCACCAAGAAGCCCTACCGGATAGAAAGTGATGAGGAAGAGGAC
TTTGAAAATGTAGGCAAAGTGGGGAGCCCATTGGACTATAGCTTAGTGGACTTACCTTCAACCAATGGACAGAGCCCTGGCAAAGCCATT
GAGAACTTGATTGGCAAGCCTACTGAGAAGTCTCAGACCCCCAAGGACAACAGCACAGCCAGTGCAAGCCTAGCCTCCAATGGGACAAGT
GGTGGGCAGGAGGCAGGAGCACCAGAAGAGGAGGAAGATGAGCTTTTGAGAGTGACTGACCTTGTTGATTATGTCTGTAACAGTGAACAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_EXT1_ENST00000378204_chr8_118825111_-_RSF1_ENST00000308488_chr11_77451981_-_13404nt
GTGTAAGTGTAACATTCAGAACCGGGTAACATTCGGCGACCGAACGCGGCGGTCGGCAGCGTTCGCGCGGGGGCCTGCGAAGCGCTGCTC
GGGGCCGGCACTGCCCGCGGGGAGGACGCGCCGCCGCCGCCACCCAGCGCCGCCGCCGCCGCCGCCTCCAGCCGGGCCGCCGCGCGTCCC
GGGGGCCGGCCCCGCGAGCGCAGGAGTAAACACCGCCGGAGTCTTGGAGCCGCTGCAGAAGGGAATAAAGAGAGATGCAGGGATTTGTGA
GGTTACGGCGCCCCAGCTGCAAGATGCACTAGCCGGCTGAACCCGGGATCGGCTGACTTGTTGGAACCGGAGTGCTCTGCACGGAGAGTG
GTGGATGAGTTGAAGTTGCCTTCCCGGGGCTCATTTTCCACGCTGCCGAGAGGAATCCGAGAGGCAAGGCAATCACTTCGTCTTGCCATT
GATTGGGTATCGGGAGCTTTTTTTTTCTCCCCTCTCTCTTTCTTTTCCTCCGTCTTGTTGCATGCAAGAAAATTACAGTCCGCTGCTCGC
CCGCCCTGGGTGCGAGATATTCAGCCCCGCTCTCTCCCGTGCATTGTGCAACCCAAAGATGAAAGACCGAAGGGGAGAAAGTTAAAGAAA
TCGCCCACATGCGCTGGATCAGTCCACGGCTTGGGGAAAGGCATCCAGAGAAGGTGGGAGCGGAGAGTTTGAAGTCTTTACAGGCGGGAA
GATGGCGGACTGGAGCTGAAAGTGTTGATTGGGAAACTTGGGTGATTCTTGTGTTTATTTACAATCCTCTTGACCCAGGCAGGACACATG
CAGGCCAAAAAACGCTATTTCATCCTGCTCTCAGCTGGCTCTTGTCTCGCCCTTTTGTTTTATTTCGGAGGCTTGCAGTTTAGGGCATCG
AGGAGCCACAGCCGGAGAGAAGAACACAGCGGTAGGAATGGCTTGCACCACCCCAGTCCGGATCATTTCTGGCCCCGCTTCCCGGACGCT
CTGCGCCCCTTCGTTCCTTGGGATCAATTGGAAAACGAGGATTCCAGCGTGCACATTTCCCCCCGGCAGAAGCGAGATGCCAACTCCAGC
ATCTACAAAGGCAAGAAGTGCCGCATGGAGTCCTGCTTCGATTTCACCCTTTGCAAGAAAAACGGCTTCAAAGTCTACGTATACCCACAG
CAAAAAGGGGAGAAAATCGCCGAAAGTTACCAAAACATTCTAGCGGCCATCGAGGGCTCCAGGTTCTACACCTCGGACCCCAGCCAGGCG
TGCCTCTTTGTCCTGAGTCTGGATACTTTAGACAGAGACCAGTTGTCACCTCAGTATGTGCACAATTTGAGATCCAAAGTGCAGAGTCTC
CACTTGTGGAACAATGGTAGGAATCATTTAATTTTTAATTTATATTCCGGCACTTGGCCTGACTACACCGAGGACGTGGGGTTTGACATC
GGCCAGGCGATGCTGGCCAAAGCCAGCATCAGTACTGAAAACTTCCGACCCAACTTTGATGTTTCTATTCCCCTCTTTTCTAAGGATCAT
CCCAGGACAGGAGGGGAGAGGGGGTTTTTGAAGTTCAACACCATCCCTCCTCTCAGGAAGTACATGCTGGTATTCAAGGGGAAGAGGTAC
CTGACAGGGATAGGATCAGACACCAGGAATGCCTTATATCACGTCCATAACGGGGAGGACGTTGTGCTCCTCACCACCTGCAAGCATGGC
AAAGACTGGCAAAAGCACAAGGATTCTCGCTGTGACAGAGACAACACCGAGTATGAGAAGTATGATTATCGGGAAATGCTGCACAATGCC
ACTTTCTGTCTGGTTCCTCGTGGTCGCAGGCTTGGGTCCTTCAGATTCCTGGAGGCTTTGCAGGCTGCCTGCGTCCCTGTGATGCTCAGC
AATGGATGGGAGTTGCCATTCTCTGAAGTGATTAATTGGAACCAAGCTGCCGTCATAGGCGATGAGAGATTGTTATTACAGATTCCTTCT
ACAATCAGGTCTATTCATCAGGATAAAATCCTAGCACTTAGACAGCAGACACAATTCTTGTGGGAGGCTTATTTTTCTTCAGTTGAGAAG
ATTGTATTAACTACACTAGAGATTATTCAGGACAGAATATTCAAGCACATATCACGTAACAGTTTAATATGGAACAAACATCCTGGAGGA
TTGTTCGTACTACCACAGTATTCATCTTATCTGGGAGATTTTCCTTACTACTATGCTAATTTAGGTTTAAAGCCCCCCTCCAAATTCACT
GCAGTCATCCATGCGGTGACCCCCCTGGTCTCTCAGTCCCAGCCAGTGTTGAAGCTTCTCGTGGCTGCAGCCAAGTCCCAGTACTGTGCC
CAGATCATAGTTCTATGGAATTGTGACAAGCCCCTACCAGCCAAACACCGCTGGCCTGCCACTGCTGTGCCTGTCGTCGTCATTGAAGGA
GAGAGCAAGGTTATGAGCAGCCGTTTTCTGCCCTACGACAACATCATCACAGACGCCGTGCTCAGCCTTGACGAGGACACGGTGCTTTCA
ACAACAGAGTACCTCTGTGAGTGTCAGTTTGATGACAATCTCAAATTCAAGAATATTATTAATGAGGAGGATGCCGATACTATGCGTCTC
CAGCCAATTGGTCGAGACAAAGATGGCCTCATGTACTGGTACCAATTGGATCAAGATCACAATGTCAGAATGTACATAGAAGAACAAGAT
GATCAAGATGGCTCTTCATGGAAATGCATTGTCAGAAATCGAAACGAGTTGGCTGAGACTCTTGCACTCCTGAAAGCACAAATTGATCCT
GTACTATTGAAAAACTCTAGCCAACAAGACAACTCTTCTCGGGAAAGTCCCAGCTTAGAGGATGAGGAGACTAAAAAAGAGGAAGAAACA
CCTAAACAAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGCCTATGGATTTAGAAAACCGTTCTACAGCCAATGTTCTA
GAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAACTGCCAGTCATAGTGAAGCTAGAAAAACCTTTGCCAGAA
AATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATGTCAAACCCATTAAAGTTGAGGTGAAGGAATGTAGAGCA
GATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTGAAAGGATCGAATTTGGTGGCAATATTAAATCTTCTCAC
GAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGCAGGCCAAGATACCACTAAAAAAACGAGAAATTAAACTG
AGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTCCAACAAAAGAGTTTTTGAAAGATGAAATAAAACAAGAG
GAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGAAACAGCTGGTAAATGGAGAAGTTAGTGATGAAAGGGTA
GCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGGAAGAGAGCTATAGCCCCTCTAAGGACAGAAATATCATC
ACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAACAGGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGGAAA
GATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAATAGAGGAACCCGATCCTCCAGAAATGGAAACTTCTCTT
GATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCACCGAGTCGTGTACCATGAAAGGTGAAGAGAAGTCTCCC
AAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAGAGAAGTCCAAAAAGACTTTTCTTGATAAGGACGCACAA
AGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAAAGCCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCACCA
TCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAGAATGCCAGAGTACAAGTACTGTTGGTGGCCAGTCTGTG
AAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAGAAATGGATAATCTGGACAATGCCCAGACCTCTGGCATA
GAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATAAGTTGGTTCCTGAAGAAGAAACCACTGCCTCAGAAAAT
ACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGATATCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCCAAA
GTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAACAAATGTGGGTCGTACTTTAAGAAGATCTCCAAGAATA
TCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAAAAAGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAGTCA
ACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAGATACAAATTCTAAAGTAAGCAAGGTAAAACCCAAAGGC
AAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCAATGATGAAAGTGAAGGGTCTGGCAGTGAAAAATCATCT
GCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAGATGATGATGAACCATGCAAAAAATGTGGCCTTCCAAAC
CATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTGCCTGCCTTCGCCCTCCTCTGATGATCATCCCAGATGGA
GAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGGAACAGTTGCAGGATTTGGATGTTGCCTTAAAGAAGAAA
GAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTGAAAACATCATTCCTCCACAAGAGCCAGACTTTTCTGAA
GATCAAGAAGAAAAGAAAAAAGATTCAAAAAAATCCAAAGCAAACTTGCTTGAAAGGAGGTCAACAAGAACAAGGAAATGTATAAGCTAC
AGATTTGATGAGTTTGATGAAGCAATTGATGAAGCTATTGAAGATGACATCAAAGAAGCCGATGGAGGAGGAGTTGGCCGAGGAAAAGAT
ATCTCCACCATCACAGGTCATCGTGGGAAAGACATCTCTACTATTTTGGATGAAGAAAGAAAAGAAAATAAACGACCCCAGAGGGCAGCT
GCTGCTCGAAGGAAGAAACGCCGGCGATTAAATGATCTGGACAGTGATAGCAACCTGGATGAAGAAGAGAGCGAGGATGAATTCAAGATC
AGTGATGGATCTCAAGATGAGTTTGTTGTGTCTGATGAAAACCCAGATGAAAGTGAAGAAGATCCGCCATCTAATGATGACAGTGACACT
GACTTTTGTAGCCGTAGACTGAGGCGACACCCCTCTCGGCCAATGAGGCAGAGCAGGCGTTTGCGAAGAAAGACCCCAAAGAAAAAATAT
TCCGATGATGATGAAGAGGAGGAATCTGAGGAGAATAGTAGAGACTCTGAAAGTGACTTCAGTGATGATTTTAGTGATGATTTTGTAGAA
ACTCGGCGAAGGCGGTCAAGGAGAAATCAGAAAAGACAAATTAACTACAAAGAAGACTCAGAAAGTGACGGTTCCCAGAAGAGTTTGCGA
CGTGGTAAAGAAATAAGGCGAGTACACAAGCGAAGACTTTCCAGCTCAGAGAGTGAAGAGAGCTATTTGTCCAAGAACTCTGAAGATGAT
GAGCTAGCTAAAGAATCAAAGCGGTCAGTTCGAAAGCGGGGCCGAAGCACAGACGAGTATTCAGAAGCAGATGAGGAGGAGGAGGAAGAG
GAAGGCAAACCATCCCGCAAACGGCTACACCGGATTGAGACGGATGAGGAGGAGAGTTGTGACAATGCTCATGGAGATGCAAATCAGCCT
GCCCGTGACAGCCAGCCTAGGGTCCTGCCCTCAGAACAAGAGAGCACCAAGAAGCCCTACCGGATAGAAAGTGATGAGGAAGAGGACTTT
GAAAATGTAGGCAAAGTGGGGAGCCCATTGGACTATAGCTTAGTGGACTTACCTTCAACCAATGGACAGAGCCCTGGCAAAGCCATTGAG
AACTTGATTGGCAAGCCTACTGAGAAGTCTCAGACCCCCAAGGACAACAGCACAGCCAGTGCAAGCCTAGCCTCCAATGGGACAAGTGGT
GGGCAGGAGGCAGGAGCACCAGAAGAGGAGGAAGATGAGCTTTTGAGAGTGACTGACCTTGTTGATTATGTCTGTAACAGTGAACAGTTA
TAAGACTTTTTTTCCATTTTTGTGCTAATTTATTCCACGGTAGCTCTCACACCAGCGGGCCAGTTATTAAAAGCTGTTTAATTTTTCCTA
GAAAACTCCACTACAGAATGACTTTTAGAAGAAAAATTTCAACAAATCCTGAAGTCTTTCTGTGAAGTGACCAGTTCTGAACTTTGAAGA
TAAATAATTGCTGTAAATTCCTTTTGATTTTCTTTTTCCAGGTTCATGGTCCTTGGTAATTTCATTCATGGAAAAAAATCTTATTATAAT
AACAACAAAGATTTGTATATTTTTGACTTTATATTTCCTGAGCTCTCCTGACTTTGTGAAAAAGGGTGGATGAAAATGCATTCCGAATCT
GTGAGGGCCCAAAACAGAATTTAGGGGTGGGTGAAAGCACTTGTGCTTTAGCTTTTTCATATTAAATATATATTATATTTAAACATTCAT
GGCATAGATGATGATTTACAGACAATTTAAAAGTTCAAGTCTGTACTGTTACAGTTTGAGAATTGTAGATAACATCATACATAAGTCATT
TAGTAACAGCCTTTGTGAAATGAACTTGTTTACTATTGGAGATAACCACACTTAATAAAGAAGAGACAGTGAAAGTACCATCATAATTAA
CCTAAATTTTTGTTATAGCAGAGTTTCTTGTTTAAAAAAAAATAAAATCATCTGAAAAGCATTTGTACAGTAAAATGTATAATGAAGCTT
TGCCAACCAGACTGTGCTAGCAACAAATTTTTTTAAATAAGCTTTATGCAGTGGTAATAAGGTGGCCTCAAATATATTGTGTCTGATGGA
GAGTTATTAGTGAAATGAATGTGGTCTTTCTTAAGGCCTGGGTGGACTGTAAACTTTGCCAATAGTATAACTCTTGTCTTCTGGCCACTT
GATGTTTAAATATCTGAAATATCATTTTGAAAAAAATACATCTATATATAACATACATGAAGAGATGCTAAGCTGACAGTGATATTTTAG
CACATTTGAAGACTGGGAAGAGATTTTCAGGTGAATTTTAACTGGTCTATTCTTGCCCTTAGTATCTACTTCAAATTGAAGTCTACAAAC
AAAGCAGTTCCTTTGGGAGGTTTTTAGTTTGAGTTTTAGCGTGTGTGTGTGTTTGTGTGTGTGCGTGTGCGTGTGTGTGTGTGTTGGAAT
TTCCTATCTGCCTGGATATATTAGCAGAGTTTGAATGTAGTTTTGGCCTTTGGCCATTAGACTTCTATTAAAATTCATTAATAGTCATAC
AACCAACATAGAGTTGAATGAGAACTGCCGATGTAATTAATAGGCATGACATCCATTTCAAACATCTCAACACTTTAAAGAAAAGCCCTT
TGTTTCAAGAAAAAAGGGTTTGTAACTAACTAAATACCTAACATGTAATTGACACTAAAATATGAACTTTGTCTTATTTAGTTTCTGTTA
TAGCTGTAAAATTTCAGGCAGAGCCATAACATTGTACAGAGTGTAGCACTTGTGATTAAACCTAGCCTGTTAAATCCTGAAACCTTCAAC
CATTACTTCTGTGAATACTTTAGCCCTGGGATTTGGGTTTTTCTGTTCCGGTGTTGTGTCTGTTGCCGGCAATGGACACACCATATCTGC
TGCTGGCCCAAGGAACGTCATTAATTTTTCTTTCCAAATTAAGTATTATGTGCTAGTCAGTGTATAGTAAAGCACTTCTCTTTTTTATTA
CTAAAAAGCTGGCATTAGATTTGCATTATAAATACCTCTCTAGGAACTTTATACTCCTTTTCCTTCTTCAACAGGTATTGCCCTTAAATC
TTATCTTTTGGCCTTGAAAGTTTATAGCTATTGTTTTTCAGTTGTTCGTTGTTTTGTTTTGTTTCACTTTAGTTCTGTAGTACCTGCCCA
TTAATATTTTTGCTTTGATTCTAGCAATGTGTATGTATCTGTATAAAAAATAAAATAATGAAAGCAACCTAAAAATAGGATGCACCAATA
GCATGTGGTTCCAAGTAAGTTGTGATTTTTATTTTGAGACAGTGTTCCACTGGAAGGGAGGGAAGGGCTTACATTCACAGACAGTAAAGC
AGGGCTGTGTAAGGAGCTACATTTACTTAACAGTCTCCTTTCCAGCTAGGTTTGTTTTATTTATTTGCAAGTCAGCTAAGAATTAACCTT
TTAAACCATCTAAAACAGGCAAGCAATATAAAGATTTCTACTAGTGCAAGGTAAGTGGTTTGAATATACAAGTGCCCTTTCCTGCCACCC
AGTCTCACTACCGTTTTAGTCCTGCAGCTGGGTAAAGCCACTATTGTGTGGAAACTCTCCCATGTGCCCTGTCTCTACCTCTGGACACAC
CAGCTCCTTCTTCCACCTATTCTATTCCTCAGTTAAGCCAAGTGATCAGAAGTAGTATTAAATGGGTAGATAATTTTAACAGGATGCCTA
ATGTGAAATAAGGAGTTATTTTTACTCTTCTACTATAGAAAGCCTAAGGTAATTCTTACCATCTCAAAGACTGAGTATTCCATTTAGGTT
TGGAGACCACTTGTGCTGTGCTGCCTGATATTTACCAAACTTGAATAAGTGTTCGTCAACTTGATAGTGAATGTACCCCTTCTCACCTTA
TATTTTGATTAAATCAATTAACTATAGGTCATCTACCAAGAATGTAATCCAAGCGGTTGATAAAACATTATTAGGCAGATAGATTATTGA
TTATTAAATTTTGAGCAGTGCAAAAACGGTTTTGCTGCTTGGAGTTCAGATTCAGTCCCTCAAAGAGTTTATGATCACTGAAATACACTC
TGAAGGTATTCTGAAGAAGTTAAAAAATTTTAGAAAACGAAATGTTCTGTATACAAAGACAATACAGTCACTACGAACTGCAGAAAGTAT
AGGAAAGCAGTAATTGATGTAGAGTTTAGACAGTCTTGGATCTTTTTTAGAGCACTAACCATGGATTTAGACTCAAAATAGCTGCTACAT
AATAGAGCCCTTTAATAATTTAAACCCCCCTTGTTGAAATACAAGTTGGACTCCCAGTGTCAAACTCTAGACTGTAGCTAATGTATTAAA
GGGAGATGTAGATTAATATTCAGTATATTTAGTTTGCAATTTCTGAAAAGGTTTGAAAACTAGTCAGCTTTTCACACAGCAGAAGCTTTG
AACTGAAATATGTGTGAAAAGGACGCAGACTGAAAACGTTTTGGTTTTGTACATCAGTGCTGATGAAATTAGTGTAAAACATTTTCCATC
ATTGGCACATTACTGCAAAATGATGGCAGAGATATTTTCAAGAATGTACATCAAGTTATATTTCCTTGACATCCTTTTTTCAATTGGTCA
AGGTTACAGATTCAGAGGATAAAGGGTAGTTTCATTTAGAATAAATTCATGTCTACTGGCAATCTATATATAAAAGTGACCTGCCCAAGA
ACCAAAAACTTTAAATGCTAATGAAGCTTTTGAAAAATAATTTTTAAACAAATTAATTTTAAAAGGGTGTTACACGTACCCAGTTTTTAC
TTTTTAGTTGATGAAACCCATCCTATAATATACATTTGAGCAAAGTACACATATTAAGAAAAACATGGACATTTACTTGTTTAATAGTCA
AAATGATGAGGAAATGTTAGCTGTTTTTAAGTGGGACTGGTGGGGTGTCCTTTGTCACAAGGAATGCTTTTTTAGCTTGTTTGTGGGCAT
AAGAGATGTTAACCCTTTGCTGATTCTACCACACAACTGTAAAGAACCTAATGAATCTACAAGTTTAATATTCAGAAAAAGCTAGGAACT
CCGCTCTTTACCAGTACAGTGGAACAGGCCCGTTATTCAAGGTGATGCCTCACAGCTATAGAACAACTATTCAAAGACCCAGAGTTAAAT
GGTACATGTGTATATGTGTGTGTGTGTGTGCACACGCACACACTTCAGATAAGTATCAGAAAAAATAAAAATGAATCCATCATTAACTTG
AAAGAAATAAGATGGCTGCATTGCAACAGATACAAATATTATGAACATCATTTAATTACAGAAAATCTAGACAACAGTTTCTCCTGATGT
TTGACATTCTCAAAATATATTCCTCATTCTCGAAGAAGCAGAGAATGCCAAGGCTGCATATCTGCTGTAATCTACCTAGCCCTCTTCTGC
TTAATATGATCCATTATTGAATCTTCTCAGATTAAAATCCATTCCTATATCATCTACCTTTCCCAAAGTGTGTGCCTGTAAACCTACCTT
GGAAGTGGCAAGTTAACTGATTTTTTTGTGTCATTTTTATACCAATCCTTAAGGTCAAAGCCTTTTGCTATCAATGTATTTAAACTGAGT
TGCTATATGTTCACTAATTTGTTTTCAAAATGTTTTGCTCCAACTTAAATTATCTTTTAACATCTTTTGAGTGCCAAGAATTGCTAAGTA
ACTGTAATATGTTGAAGAGAGTAATTGCCAAGCAAGCAGTCATAAGCCAAAATGTAATGAGCTTAGTATATAACCACTTTAGAGTATACA
CTCACCACTTTTTGTATTCATTCATGCAAACCCTCCTGGAAGTCGATTAGAAGAGGATCCAATTTGTGGACCTTTTTTCCTCCTTTTGGA
CACCTGAGCACAATTTTTTTTTTCCTTTCATATTTATACCACTTTGGAAAATTCAGTAAACCCAATTCTGGCACATCATAATGGTTTCAG
TTAGTGAAGATGTTTATTTTAATAACTTTAAAATATGACTATCCTATACATAAGTTATATAAGAGGGCATAACAATAGATGAGTAGAAAT
TTATAAAATTTCTTGGATATTTTGAATGAGAAAAAAACATTTTTAAAGGAATTTTGTTTTTTCCTTTTTTGGCCAAACCGGTACAAGTTA
GAAAGTGTGCTAAGGACTGAATACTTGCCTCGTGCTTTTTGCCACTGGATGATGTAAGTTAAGAATGGAATTGTTAATCCTAAGTATATA
TTTTCTTGACTTTCATCAGTTTCTAAAGAAATCTAATTTAAGTGTTTTGCGGTTTTGTTTGATCTGTATTTATTGAGTTCTGGTCATAGA
CCAGCAGCTTGCACGTCATGCTCATGAACAGCCAGAACATAGTTATTGGGGAACTTCATGGCTCAAAACCTTCTGAATCATTTAACTTAT
TTTGTATGTTGCAAAAAAAAAAAAAAAGTTTATTTTGCTTGAGAGTCACCTTTTTTTAAAAAAAATAACTGTACAGCTTTTAAGGGATGG
GAGGTGGGAAAATACCCTAAAATAGGATGTAGATTTTTTACAATTGTGTTTATGCTAGATCATCTACAGGTGCATTATGTAATTAAACCT
AAAATTGTTTAAAAATTTGTGCCATGTCTTTTTCATTCTCCTGCCCTTTAGCAGAATTGGTGCATGTCAACTGCTATGTGGACAAGCCTT
GAAATTAGAGTAACAAGCCCTGTCTCCAAAGCTTTAAGGTCACTGCATGAAAATTGCACACACACACACACACACACACACATCTAGCTT
ATATTAGTAAATGGATTTTCAGGATCAGAACAGCTACAGTAGCCCAGATTTGGCTGTTAACAGCATATTCTTACAGCACATGATTTTTGT
GATGCCTAACTAGGGTATTCTCAATGTTAGTCTGGTGTTCTATTCTCTTTCAAAGTAGCTTCTTGAGATGGTATCTGTTGTAGCTTGCCC
AAACCTGCCATGAGGTTGTGTGTACACTTTGAAAGGGTATGTCCTATGCTAAGATGGTGGTAGAGCAGGGCTTGATTTTAATCTATTCAT
ATAAAAGAAGGAAAAAACTAGAATTGGTCTATTTGGTTATTCAGTGGACTTAATTCCACAGGAATAGTTGTCTGCTGAAGCGTGGCAGCA
AGAGAAGTCAAATTCAAGTTTCAGTTCCTTCCTTATTCACTAAGTATTTTGAAATCTTGTAGAACTTCTGATTCTAGCACAGTCTTTTAC
ATGGCACATTTTACCATGGTATATTCACAGCTTCGTTTAAATGTCAGTACTTTTTCCCATCTGATAATTTTGCCATTCTAATTTCTCACC
TTTGTAGTACAAGTGTATTCTTGAAAATAATTAAATTCATCTAAGTGTGTCATAATTTCAATCAAAGCTATATTCATGTGTTGCCAGCGT
CAGTTTTTTGCTATCCTCATTCAGAAGGGAAGCCTGCAGATCATGAGTTTCCATATGAAGAATACAAATTCCACATAAAAATTTATAAAT
GGTATCTTTAGAATTTTGATTTAAAGTAATAGCTGGAATTCAGGGACTGATCAGAATGCCTCTTGAATTTTCCAACATGCTTATATGAAA
TGCTTTATTTTCCTATGCGTTAAAAAAAATATTCCTGGAATAGGTTCTCAGAATGTTTTATTTGGTTTCTAGGAGATGAGATTTAAAGCA
GAAGCTCCAAGATTGGCATAAAACTAACTCTTGAGGTAATCAGGACCATGCTGTTAGTCAAATAGAAGCTGGAGTGCTCTCTGTCACATA
ATGTACTGCATGTGTGTGGGGGTGGGGGGGCAGGGAAGATCAGAAAACTGGAAATGTAATTCTGATAACACGCAAAGTAAATTGTGCATT
AAAAGTATGGGAATTCTTGGTAGCTTAAAGCTTCAGGGGTTAACTTCAGTGTATGAACACCTAGTGTGTTAGAATTGCAGTGCATAGTTG
TTTAAATACAATATTCCTTGTAAGTGACAACCAAAATATGTTGTGGCTGGTGCCAGTATTTTTGTTAATGAAATGTTCAGTGTCTCACTA
CAGTCTGATCAGAACTCTTGGTGTTATAAGCCAGGCCTAAAGCCATTTTATAGCTATTGGCCTAATTGTGTAACTTTTTCTTTCAAAATG

>In-frame_EXT1_ENST00000378204_chr8_118825111_-_RSF1_ENST00000360355_chr11_77451981_-_7170nt
GTGTAAGTGTAACATTCAGAACCGGGTAACATTCGGCGACCGAACGCGGCGGTCGGCAGCGTTCGCGCGGGGGCCTGCGAAGCGCTGCTC
GGGGCCGGCACTGCCCGCGGGGAGGACGCGCCGCCGCCGCCACCCAGCGCCGCCGCCGCCGCCGCCTCCAGCCGGGCCGCCGCGCGTCCC
GGGGGCCGGCCCCGCGAGCGCAGGAGTAAACACCGCCGGAGTCTTGGAGCCGCTGCAGAAGGGAATAAAGAGAGATGCAGGGATTTGTGA
GGTTACGGCGCCCCAGCTGCAAGATGCACTAGCCGGCTGAACCCGGGATCGGCTGACTTGTTGGAACCGGAGTGCTCTGCACGGAGAGTG
GTGGATGAGTTGAAGTTGCCTTCCCGGGGCTCATTTTCCACGCTGCCGAGAGGAATCCGAGAGGCAAGGCAATCACTTCGTCTTGCCATT
GATTGGGTATCGGGAGCTTTTTTTTTCTCCCCTCTCTCTTTCTTTTCCTCCGTCTTGTTGCATGCAAGAAAATTACAGTCCGCTGCTCGC
CCGCCCTGGGTGCGAGATATTCAGCCCCGCTCTCTCCCGTGCATTGTGCAACCCAAAGATGAAAGACCGAAGGGGAGAAAGTTAAAGAAA
TCGCCCACATGCGCTGGATCAGTCCACGGCTTGGGGAAAGGCATCCAGAGAAGGTGGGAGCGGAGAGTTTGAAGTCTTTACAGGCGGGAA
GATGGCGGACTGGAGCTGAAAGTGTTGATTGGGAAACTTGGGTGATTCTTGTGTTTATTTACAATCCTCTTGACCCAGGCAGGACACATG
CAGGCCAAAAAACGCTATTTCATCCTGCTCTCAGCTGGCTCTTGTCTCGCCCTTTTGTTTTATTTCGGAGGCTTGCAGTTTAGGGCATCG
AGGAGCCACAGCCGGAGAGAAGAACACAGCGGTAGGAATGGCTTGCACCACCCCAGTCCGGATCATTTCTGGCCCCGCTTCCCGGACGCT
CTGCGCCCCTTCGTTCCTTGGGATCAATTGGAAAACGAGGATTCCAGCGTGCACATTTCCCCCCGGCAGAAGCGAGATGCCAACTCCAGC
ATCTACAAAGGCAAGAAGTGCCGCATGGAGTCCTGCTTCGATTTCACCCTTTGCAAGAAAAACGGCTTCAAAGTCTACGTATACCCACAG
CAAAAAGGGGAGAAAATCGCCGAAAGTTACCAAAACATTCTAGCGGCCATCGAGGGCTCCAGGTTCTACACCTCGGACCCCAGCCAGGCG
TGCCTCTTTGTCCTGAGTCTGGATACTTTAGACAGAGACCAGTTGTCACCTCAGTATGTGCACAATTTGAGATCCAAAGTGCAGAGTCTC
CACTTGTGGAACAATGGTAGGAATCATTTAATTTTTAATTTATATTCCGGCACTTGGCCTGACTACACCGAGGACGTGGGGTTTGACATC
GGCCAGGCGATGCTGGCCAAAGCCAGCATCAGTACTGAAAACTTCCGACCCAACTTTGATGTTTCTATTCCCCTCTTTTCTAAGGATCAT
CCCAGGACAGGAGGGGAGAGGGGGTTTTTGAAGTTCAACACCATCCCTCCTCTCAGGAAGTACATGCTGGTATTCAAGGGGAAGAGGTAC
CTGACAGGGATAGGATCAGACACCAGGAATGCCTTATATCACGTCCATAACGGGGAGGACGTTGTGCTCCTCACCACCTGCAAGCATGGC
AAAGACTGGCAAAAGCACAAGGATTCTCGCTGTGACAGAGACAACACCGAGTATGAGAAGTATGATTATCGGGAAATGCTGCACAATGCC
ACTTTCTGTCTGGTTCCTCGTGGTCGCAGGCTTGGGTCCTTCAGATTCCTGGAGGCTTTGCAGGCTGCCTGCGTCCCTGTGATGCTCAGC
AATGGATGGGAGTTGCCATTCTCTGAAGTGATTAATTGGAACCAAGCTGCCGTCATAGGCGATGAGAGATTGTTATTACAGATTCCTTCT
ACAATCAGGTCTATTCATCAGGATAAAATCCTAGCACTTAGACAGCAGACACAATTCTTGTGGGAGGCTTATTTTTCTTCAGTTGAGAAG
ATTGTATTAACTACACTAGAGATTATTCAGGACAGAATATTCAAGCACATATCACGTAACAGTTTAATATGGAACAAACATCCTGGAGGA
TTGTTCGTACTACCACAGTATTCATCTTATCTGGGAGATTTTCCTTACTACTATGCTAATTTAGGTTTAAAGCCCCCCTCCAAATTCACT
GCAGTCATCCATGCGGTGACCCCCCTGGTCTCTCAGTCCCAGCCAGTGTTGAAGCTTCTCGTGGCTGCAGCCAAGTCCCAGTACTGTGCC
CAGATCATAGTTCTATGGAATTGTGACAAGCCCCTACCAGCCAAACACCGCTGGCCTGCCACTGCTGTGCCTGTCGTCGTCATTGAAGGA
GAGAGCAAGGTTATGAGCAGCCGTTTTCTGCCCTACGACAACATCATCACAGACGCCGTGCTCAGCCTTGACGAGGACACGGTGCTTTCA
ACAACAGAGTACCTCTGTGAGTGTCAGTTTGATGACAATCTCAAATTCAAGAATATTATTAATGAGGAGGATGCCGATACTATGCGTCTC
CAGCCAATTGGTCGAGACAAAGATGGCCTCATGTACTGGTACCAATTGGATCAAGATCACAATGTCAGAATGTACATAGAAGAACAAGAT
GATCAAGATGGCTCTTCATGGAAATGCATTGTCAGAAATCGAAACGAGTTGGCTGAGACTCTTGCACTCCTGAAAGCACAAATTGATCCT
GTACTATTGAAAAACTCTAGCCAACAAGACAACTCTTCTCGGGAAAGTCCCAGCTTAGAGGATGAGGAGACTAAAAAAGAGGAAGAAACA
CCTAAACAAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGCCTATGGATTTAGAAAACCGTTCTACAGCCAATGTTCTA
GAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAACTGCCAGTCATAGTGAAGCTAGAAAAACCTTTGCCAGAA
AATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATGTCAAACCCATTAAAGTTGAGGTGAAGGAATGTAGAGCA
GATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTGAAAGGATCGAATTTGGTGGCAATATTAAATCTTCTCAC
GAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGCAGGCCAAGATACCACTAAAAAAACGAGAAATTAAACTG
AGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTCCAACAAAAGAGTTTTTGAAAGATGAAATAAAACAAGAG
GAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGAAACAGCTGGTAAATGGAGAAGTTAGTGATGAAAGGGTA
GCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGGAAGAGAGCTATAGCCCCTCTAAGGACAGAAATATCATC
ACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAACAGGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGGAAA
GATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAATAGAGGAACCCGATCCTCCAGAAATGGAAACTTCTCTT
GATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCACCGAGTCGTGTACCATGAAAGGTGAAGAGAAGTCTCCC
AAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAGAGAAGTCCAAAAAGACTTTTCTTGATAAGGACGCACAA
AGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAAAGCCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCACCA
TCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAGAATGCCAGAGTACAAGTACTGTTGGTGGCCAGTCTGTG
AAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAGAAATGGATAATCTGGACAATGCCCAGACCTCTGGCATA
GAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATAAGTTGGTTCCTGAAGAAGAAACCACTGCCTCAGAAAAT
ACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGATATCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCCAAA
GTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAACAAATGTGGGTCGTACTTTAAGAAGATCTCCAAGAATA
TCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAAAAAGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAGTCA
ACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAGATACAAATTCTAAAGTAAGCAAGGTAAAACCCAAAGGC
AAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCAATGATGAAAGTGAAGGGTCTGGCAGTGAAAAATCATCT
GCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAGATGATGATGAACCATGCAAAAAATGTGGCCTTCCAAAC
CATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTGCCTGCCTTCGCCCTCCTCTGATGATCATCCCAGATGGA
GAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGGAACAGTTGCAGGATTTGGATGTTGCCTTAAAGAAGAAA
GAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTGAAAACATCATTCCTCCACAAGAGCCAGACTTTTCTGAA
GATCAAGAAGAAAAGAAAAAAGATTCAAAAAAATCCAAAGCAAACTTGCTTGAAAGGAGGTCAACAAGAACAAGGAAATGTATAAGCTAC
AGATTTGATGAGTTTGATGAAGCAATTGATGAAGCTATTGAAGATGACATCAAAGAAGCCGATGGAGGAGGAGTTGGCCGAGGAAAAGAT
ATCTCCACCATCACAGGTCATCGTGGGAAAGACATCTCTACTATTTTGGATGAAGAAAGAAAAGAAAATAAACGACCCCAGAGGGCAGCT
GCTGCTCGAAGGAAGAAACGCCGGCGATTAAATGATCTGGACAGTGATAGCAACCTGGATGAAGAAGAGAGCGAGGATGAATTCAAGATC
AGTGATGGATCTCAAGATGAGTTTGTTGTGTCTGATGAAAACCCAGATGAAAGTGAAGAAGATCCGCCATCTAATGATGACAGTGACACT
GACTTTTGTAGCCGTAGACTGAGGCGACACCCCTCTCGGCCAATGAGGCAGAGCAGGCGTTTGCGAAGAAAGACCCCAAAGAAAAAATAT
TCCGATGATGATGAAGAGGAGGAATCTGAGGAGAATAGTAGAGACTCTGAAAGTGACTTCAGTGATGATTTTAGTGATGATTTTGTAGAA
ACTCGGCGAAGGCGGTCAAGGAGAAATCAGAAAAGACAAATTAACTACAAAGAAGACTCAGAAAGTGACGGTTCCCAGAAGAGTTTGCGA
CGTGGTAAAGAAATAAGGCGAGTACACAAGCGAAGACTTTCCAGCTCAGAGAGTGAAGAGAGCTATTTGTCCAAGAACTCTGAAGATGAT
GAGCTAGCTAAAGAATCAAAGCGGTCAGTTCGAAAGCGGGGCCGAAGCACAGACGAGTATTCAGAAGCAGATGAGGAGGAGGAGGAAGAG
GAAGGCAAACCATCCCGCAAACGGCTACACCGGATTGAGACGGATGAGGAGGAGAGTTGTGACAATGCTCATGGAGATGCAAATCAGCCT
GCCCGTGACAGCCAGCCTAGGGTCCTGCCCTCAGAACAAGAGAGCACCAAGAAGCCCTACCGGATAGAAAGTGATGAGGAAGAGGACTTT
GAAAATGTAGGCAAAGTGGGGAGCCCATTGGACTATAGCTTAGTGGACTTACCTTCAACCAATGGACAGAGCCCTGGCAAAGCCATTGAG
AACTTGATTGGCAAGCCTACTGAGAAGTCTCAGACCCCCAAGGACAACAGCACAGCCAGTGCAAGCCTAGCCTCCAATGGGACAAGTGGT
GGGCAGGAGGCAGGAGCACCAGAAGAGGAGGAAGATGAGCTTTTGAGAGTGACTGACCTTGTTGATTATGTCTGTAACAGTGAACAGTTA
TAAGACTTTTTTTCCATTTTTGTGCTAATTTATTCCACGGTAGCTCTCACACCAGCGGGCCAGTTATTAAAAGCTGTTTAATTTTTCCTA
GAAAACTCCACTACAGAATGACTTTTAGAAGAAAAATTTCAACAAATCCTGAAGTCTTTCTGTGAAGTGACCAGTTCTGAACTTTGAAGA
TAAATAATTGCTGTAAATTCCTTTTGATTTTCTTTTTCCAGGTTCATGGTCCTTGGTAATTTCATTCATGGAAAAAAATCTTATTATAAT
AACAACAAAGATTTGTATATTTTTGACTTTATATTTCCTGAGCTCTCCTGACTTTGTGAAAAAGGGTGGATGAAAATGCATTCCGAATCT
GTGAGGGCCCAAAACAGAATTTAGGGGTGGGTGAAAGCACTTGTGCTTTAGCTTTTTCATATTAAATATATATTATATTTAAACATTCAT
GGCATAGATGATGATTTACAGACAATTTAAAAGTTCAAGTCTGTACTGTTACAGTTTGAGAATTGTAGATAACATCATACATAAGTCATT
TAGTAACAGCCTTTGTGAAATGAACTTGTTTACTATTGGAGATAACCACACTTAATAAAGAAGAGACAGTGAAAGTACCATCATAATTAA


Top

FusionGenePPI for EXT1_RSF1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EXT1CNTF, OSTF1, EXT1, EXT2, TRAP1, PEX19, SYNE4, PLAUR, PTCH1, ERGIC3, NAAA, SCGB2A2, B4GAT1, MPPE1, CRP, SYP, GAA, SLC39A5, TFR2, NRROS, TOR1AIP2, CD79B, FBXW7, NOTCH1RSF1NFKB1, SMARCA5, CENPA, SIRT7, SP1, COPS6, CSNK2A1, HIST1H2BG, HIST1H3A, EWSR1, MARK2, ATXN3, KAT6A, MCM2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EXT1_RSF1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EXT1_RSF1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEXT1C0015306Hereditary Multiple Exostoses8CTD_human;HPO;ORPHANET;UNIPROT
HgeneEXT1C0004352Autistic Disorder1CTD_human
HgeneEXT1C0008479Chondrosarcoma1CTD_human;HPO;ORPHANET;UNIPROT