FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12242

FusionGeneSummary for EWSR1_WT1

check button Fusion gene summary
Fusion gene informationFusion gene name: EWSR1_WT1
Fusion gene ID: 12242
HgeneTgene
Gene symbol

EWSR1

WT1

Gene ID

2130

7490

Gene nameEWS RNA binding protein 1Wilms tumor 1
SynonymsEWS|EWS-FLI1|bK984G1.4AWT1|GUD|NPHS4|WAGR|WIT-2|WT33
Cytomap

22q12.2

11p13

Type of geneprotein-codingprotein-coding
DescriptionRNA-binding protein EWSEWS RNA-binding protein variant 6Ewing sarcoma breakpoint region 1Ewings sarcoma EWS-Fli1 (type 1) oncogeneWilms tumor protein
Modification date2018052720180523
UniProtAcc

Q01844

P19544

Ensembl transtripts involved in fusion geneENST00000332050, ENST00000397938, 
ENST00000406548, ENST00000331029, 
ENST00000414183, ENST00000333395, 
ENST00000332035, 
ENST00000379079, 
ENST00000332351, ENST00000530998, 
ENST00000448076, 
Fusion gene scores* DoF score17 X 31 X 5=26352 X 2 X 2=8
# samples 533
** MAII scorelog2(53/2635*10)=-2.31373869707402
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/8*10)=1.90689059560852
Context

PubMed: EWSR1 [Title/Abstract] AND WT1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneWT1

GO:0000122

negative regulation of transcription by RNA polymerase II

7585606

TgeneWT1

GO:0007530

sex determination

9815658

TgeneWT1

GO:0008285

negative regulation of cell proliferation

9553041|9765217

TgeneWT1

GO:0030308

negative regulation of cell growth

9553041|9765217

TgeneWT1

GO:0045892

negative regulation of transcription, DNA-templated

1332065|7585606|7720589|8119964|12802290|14701728|19050011

TgeneWT1

GO:0045893

positive regulation of transcription, DNA-templated

8132626|9178767|9553041|9765217|12802290|14701728|16467207|21390327

TgeneWT1

GO:0071371

cellular response to gonadotropin stimulus

15961562


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1S74529EWSR1chr22

29683128

+WT1chr11

32414301

-
ChiTaRS3.1S79672EWSR1chr22

29683128

+WT1chr11

32414301

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000332050ENST00000379079EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000332050ENST00000332351EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000332050ENST00000530998EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000332050ENST00000448076EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000397938ENST00000379079EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000397938ENST00000332351EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000397938ENST00000530998EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000397938ENST00000448076EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000406548ENST00000379079EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000406548ENST00000332351EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000406548ENST00000530998EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000406548ENST00000448076EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000331029ENST00000379079EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000331029ENST00000332351EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000331029ENST00000530998EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000331029ENST00000448076EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000414183ENST00000379079EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000414183ENST00000332351EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000414183ENST00000530998EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000414183ENST00000448076EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000333395ENST00000379079EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000333395ENST00000332351EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000333395ENST00000530998EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000333395ENST00000448076EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000332035ENST00000379079EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000332035ENST00000332351EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000332035ENST00000530998EWSR1chr22

29683128

+WT1chr11

32414301

-
In-frameENST00000332035ENST00000448076EWSR1chr22

29683128

+WT1chr11

32414301

-

Top

FusionProtFeatures for EWSR1_WT1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EWSR1

Q01844

WT1

P19544

Might normally function as a transcriptional repressor.EWS-fusion-proteins (EFPS) may play a role in the tumorigenicprocess. They may disturb gene expression by mimicking, orinterfering with the normal function of CTD-POLII within thetranscription initiation complex. They may also contribute to anaberrant activation of the fusion protein target genes.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616111_116208601RepeatNote=12
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616117_125208601RepeatNote=13
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616126_156208601RepeatNote=14
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616157_163208601RepeatNote=15
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616164_170208601RepeatNote=16
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616171_177208601RepeatNote=17
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616178_188208601RepeatNote=18
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+61617_27208601RepeatNote=2
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616189_193208601RepeatNote=19
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616194_201208601RepeatNote=20
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616202_206208601RepeatNote=21
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+61628_34208601RepeatNote=3
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+61635_42208601RepeatNote=4
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+61643_50208601RepeatNote=5
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+61651_59208601RepeatNote=6
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+61660_68208601RepeatNote=7
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+61669_75208601RepeatNote=8
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+61676_84208601RepeatNote=9
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+61685_91208601RepeatNote=10
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+6168_16208601RepeatNote=1
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+61692_110208601RepeatNote=11
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79111_116264355RepeatNote=12
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79117_125264355RepeatNote=13
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79126_156264355RepeatNote=14
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79157_163264355RepeatNote=15
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79164_170264355RepeatNote=16
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79171_177264355RepeatNote=17
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79178_188264355RepeatNote=18
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+7917_27264355RepeatNote=2
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79189_193264355RepeatNote=19
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79194_201264355RepeatNote=20
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79202_206264355RepeatNote=21
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79207_212264355RepeatNote=22
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79213_218264355RepeatNote=23
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79219_224264355RepeatNote=24
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79225_230264355RepeatNote=25
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79231_238264355RepeatNote=26
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79239_245264355RepeatNote=27
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79246_252264355RepeatNote=28
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79253_259264355RepeatNote=29
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+7928_34264355RepeatNote=3
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+7935_42264355RepeatNote=4
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+7943_50264355RepeatNote=5
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+7951_59264355RepeatNote=6
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+7960_68264355RepeatNote=7
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+7969_75264355RepeatNote=8
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+7976_84264355RepeatNote=9
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+7985_91264355RepeatNote=10
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+798_16264355RepeatNote=1
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+7992_110264355RepeatNote=11
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717111_116264657RepeatNote=12
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717117_125264657RepeatNote=13
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717126_156264657RepeatNote=14
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717157_163264657RepeatNote=15
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717164_170264657RepeatNote=16
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717171_177264657RepeatNote=17
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717178_188264657RepeatNote=18
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+71717_27264657RepeatNote=2
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717189_193264657RepeatNote=19
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717194_201264657RepeatNote=20
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717202_206264657RepeatNote=21
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717207_212264657RepeatNote=22
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717213_218264657RepeatNote=23
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717219_224264657RepeatNote=24
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717225_230264657RepeatNote=25
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717231_238264657RepeatNote=26
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717239_245264657RepeatNote=27
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717246_252264657RepeatNote=28
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717253_259264657RepeatNote=29
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+71728_34264657RepeatNote=3
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+71735_42264657RepeatNote=4
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+71743_50264657RepeatNote=5
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+71751_59264657RepeatNote=6
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+71760_68264657RepeatNote=7
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+71769_75264657RepeatNote=8
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+71776_84264657RepeatNote=9
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+71785_91264657RepeatNote=10
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+7178_16264657RepeatNote=1
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+71792_110264657RepeatNote=11
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717111_116264656RepeatNote=12
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717117_125264656RepeatNote=13
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717126_156264656RepeatNote=14
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717157_163264656RepeatNote=15
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717164_170264656RepeatNote=16
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717171_177264656RepeatNote=17
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717178_188264656RepeatNote=18
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+71717_27264656RepeatNote=2
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717189_193264656RepeatNote=19
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717194_201264656RepeatNote=20
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717202_206264656RepeatNote=21
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717207_212264656RepeatNote=22
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717213_218264656RepeatNote=23
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717219_224264656RepeatNote=24
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717225_230264656RepeatNote=25
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717231_238264656RepeatNote=26
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717239_245264656RepeatNote=27
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717246_252264656RepeatNote=28
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717253_259264656RepeatNote=29
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+71728_34264656RepeatNote=3
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+71735_42264656RepeatNote=4
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+71743_50264656RepeatNote=5
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+71751_59264656RepeatNote=6
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+71760_68264656RepeatNote=7
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+71769_75264656RepeatNote=8
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+71776_84264656RepeatNote=9
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+71785_91264656RepeatNote=10
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+7178_16264656RepeatNote=1
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+71792_110264656RepeatNote=11
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818111_116270662RepeatNote=12
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818117_125270662RepeatNote=13
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818126_156270662RepeatNote=14
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818157_163270662RepeatNote=15
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818164_170270662RepeatNote=16
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818171_177270662RepeatNote=17
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818178_188270662RepeatNote=18
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+81817_27270662RepeatNote=2
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818189_193270662RepeatNote=19
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818194_201270662RepeatNote=20
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818202_206270662RepeatNote=21
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818207_212270662RepeatNote=22
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818213_218270662RepeatNote=23
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818219_224270662RepeatNote=24
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818225_230270662RepeatNote=25
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818231_238270662RepeatNote=26
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818239_245270662RepeatNote=27
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818246_252270662RepeatNote=28
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818253_259270662RepeatNote=29
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+81828_34270662RepeatNote=3
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+81835_42270662RepeatNote=4
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+81843_50270662RepeatNote=5
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+81851_59270662RepeatNote=6
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+81860_68270662RepeatNote=7
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+81869_75270662RepeatNote=8
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+81876_84270662RepeatNote=9
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+81885_91270662RepeatNote=10
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+8188_16270662RepeatNote=1
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+81892_110270662RepeatNote=11
TgeneWT1chr22:29683128chr11:32414301ENST00000379079-610323_347204303Zinc fingerC2H2-type 1
TgeneWT1chr22:29683128chr11:32414301ENST00000379079-610353_377204303Zinc fingerC2H2-type 2
TgeneWT1chr22:29683128chr11:32414301ENST00000379079-610383_405204303Zinc fingerC2H2-type 3
TgeneWT1chr22:29683128chr11:32414301ENST00000379079-610414_438204303Zinc fingerC2H2-type 4
TgeneWT1chr22:29683128chr11:32414301ENST00000530998-59323_347187289Zinc fingerC2H2-type 1
TgeneWT1chr22:29683128chr11:32414301ENST00000530998-59353_377187289Zinc fingerC2H2-type 2
TgeneWT1chr22:29683128chr11:32414301ENST00000530998-59383_405187289Zinc fingerC2H2-type 3
TgeneWT1chr22:29683128chr11:32414301ENST00000530998-59414_438187289Zinc fingerC2H2-type 4

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616300_340208601Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616454_513208601Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616559_640208601Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79300_340264355Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79454_513264355Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79559_640264355Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717300_340264657Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717454_513264657Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717559_640264657Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717300_340264656Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717454_513264656Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717559_640264656Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818300_340270662Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818454_513270662Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818559_640270662Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616256_285208601DomainNote=IQ
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616361_447208601DomainRRM
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79256_285264355DomainNote=IQ
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79361_447264355DomainRRM
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717256_285264657DomainNote=IQ
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717361_447264657DomainRRM
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717256_285264656DomainNote=IQ
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717361_447264656DomainRRM
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818256_285270662DomainNote=IQ
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818361_447270662DomainRRM
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616639_656208601MotifNuclear localization signal
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79639_656264355MotifNuclear localization signal
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717639_656264657MotifNuclear localization signal
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717639_656264656MotifNuclear localization signal
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818639_656270662MotifNuclear localization signal
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+6161_285208601RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+6168_285208601RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+791_285264355RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+798_285264355RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+7171_285264657RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+7178_285264657RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+7171_285264656RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+7178_285264656RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+8181_285270662RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+8188_285270662RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616207_212208601RepeatNote=22
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616213_218208601RepeatNote=23
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616219_224208601RepeatNote=24
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616225_230208601RepeatNote=25
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616231_238208601RepeatNote=26
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616239_245208601RepeatNote=27
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616246_252208601RepeatNote=28
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616253_259208601RepeatNote=29
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616260_276208601RepeatNote=30
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616277_285208601RepeatNote=31
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79260_276264355RepeatNote=30
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79277_285264355RepeatNote=31
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717260_276264657RepeatNote=30
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717277_285264657RepeatNote=31
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717260_276264656RepeatNote=30
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717277_285264656RepeatNote=31
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818260_276270662RepeatNote=30
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818277_285270662RepeatNote=31
HgeneEWSR1chr22:29683128chr11:32414301ENST00000332035+616518_549208601Zinc fingerRanBP2-type
HgeneEWSR1chr22:29683128chr11:32414301ENST00000333395+79518_549264355Zinc fingerRanBP2-type
HgeneEWSR1chr22:29683128chr11:32414301ENST00000397938+717518_549264657Zinc fingerRanBP2-type
HgeneEWSR1chr22:29683128chr11:32414301ENST00000406548+717518_549264656Zinc fingerRanBP2-type
HgeneEWSR1chr22:29683128chr11:32414301ENST00000414183+818518_549270662Zinc fingerRanBP2-type
TgeneWT1chr22:29683128chr11:32414301ENST00000379079-61027_83204303Compositional biasNote=Pro-rich
TgeneWT1chr22:29683128chr11:32414301ENST00000530998-5927_83187289Compositional biasNote=Pro-rich


Top

FusionGeneSequence for EWSR1_WT1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EWSR1_ENST00000332050_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_363aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQL

>In-frame_EWSR1_ENST00000332050_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTK

>In-frame_EWSR1_ENST00000332050_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTK

>In-frame_EWSR1_ENST00000332050_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_363aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQL

>In-frame_EWSR1_ENST00000397938_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_363aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQL

>In-frame_EWSR1_ENST00000397938_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTK

>In-frame_EWSR1_ENST00000397938_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTK

>In-frame_EWSR1_ENST00000397938_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_363aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQL

>In-frame_EWSR1_ENST00000406548_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_363aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQL

>In-frame_EWSR1_ENST00000406548_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTK

>In-frame_EWSR1_ENST00000406548_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTK

>In-frame_EWSR1_ENST00000406548_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_363aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQL

>In-frame_EWSR1_ENST00000331029_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_363aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQL

>In-frame_EWSR1_ENST00000331029_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTK

>In-frame_EWSR1_ENST00000331029_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTK

>In-frame_EWSR1_ENST00000331029_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_363aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQL

>In-frame_EWSR1_ENST00000414183_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_369aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTGTTTPTAPQ
AYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQ
VPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQ
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRN

>In-frame_EWSR1_ENST00000414183_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_372aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTGTTTPTAPQ
AYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQ
VPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQ
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMH

>In-frame_EWSR1_ENST00000414183_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_372aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTGTTTPTAPQ
AYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQ
VPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQ
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMH

>In-frame_EWSR1_ENST00000414183_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_369aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTGTTTPTAPQ
AYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQ
VPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQ
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRN

>In-frame_EWSR1_ENST00000333395_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_363aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQL

>In-frame_EWSR1_ENST00000333395_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTK

>In-frame_EWSR1_ENST00000333395_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTK

>In-frame_EWSR1_ENST00000333395_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_363aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQ
CDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQL

>In-frame_EWSR1_ENST00000332035_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_307aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQP
PTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKP

>In-frame_EWSR1_ENST00000332035_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_310aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQP
PTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTS

>In-frame_EWSR1_ENST00000332035_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_310aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQP
PTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTS

>In-frame_EWSR1_ENST00000332035_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_307aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQP
PTSYPPQTGSYSQAPSQTSQQSSSYGQQSEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EWSR1_ENST00000332050_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_1089nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGG
TGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTG

>In-frame_EWSR1_ENST00000332050_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTC
AGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAA

>In-frame_EWSR1_ENST00000332050_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTC
AGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAA

>In-frame_EWSR1_ENST00000332050_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_1089nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGG
TGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTG

>In-frame_EWSR1_ENST00000397938_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_1089nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGG
TGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTG

>In-frame_EWSR1_ENST00000397938_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTC
AGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAA

>In-frame_EWSR1_ENST00000397938_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTC
AGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAA

>In-frame_EWSR1_ENST00000397938_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_1089nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGG
TGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTG

>In-frame_EWSR1_ENST00000406548_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_1089nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGG
TGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTG

>In-frame_EWSR1_ENST00000406548_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTC
AGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAA

>In-frame_EWSR1_ENST00000406548_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTC
AGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAA

>In-frame_EWSR1_ENST00000406548_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_1089nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGG
TGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTG

>In-frame_EWSR1_ENST00000331029_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_1089nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGG
TGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTG

>In-frame_EWSR1_ENST00000331029_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTC
AGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAA

>In-frame_EWSR1_ENST00000331029_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTC
AGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAA

>In-frame_EWSR1_ENST00000331029_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_1089nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGG
TGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTG

>In-frame_EWSR1_ENST00000414183_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_1107nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAG
GCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCT
CAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAG
CCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAG
GTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGAT
CAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAG
CAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAG
AGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACA
GGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAA
AAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAAC

>In-frame_EWSR1_ENST00000414183_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_1116nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAG
GCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCT
CAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAG
CCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAG
GTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGAT
CAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAG
CAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAG
AGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACA
GGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAA
ACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCAT

>In-frame_EWSR1_ENST00000414183_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_1116nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAG
GCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCT
CAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAG
CCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAG
GTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGAT
CAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAG
CAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAG
AGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACA
GGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAA
ACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCAT

>In-frame_EWSR1_ENST00000414183_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_1107nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAG
GCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCT
CAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAG
CCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAG
GTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGAT
CAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAG
CAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAG
AGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACA
GGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAA
AAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAAC

>In-frame_EWSR1_ENST00000333395_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_1089nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGG
TGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTG

>In-frame_EWSR1_ENST00000333395_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTC
AGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAA

>In-frame_EWSR1_ENST00000333395_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTC
AGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAA

>In-frame_EWSR1_ENST00000333395_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_1089nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAG
TGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAG
TGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGG
TGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTG

>In-frame_EWSR1_ENST00000332035_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_921nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGC
AGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCT
CCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAG
AAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTG
AAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCC
TTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACC

>In-frame_EWSR1_ENST00000332035_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_930nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGC
AGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCT
CCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAG
AAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTG
AAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGT
GAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGA

>In-frame_EWSR1_ENST00000332035_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_930nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGC
AGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCT
CCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAG
AAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTG
AAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGT
GAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGA

>In-frame_EWSR1_ENST00000332035_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_921nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGC
AGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCT
CCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAG
AAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTG
AAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCC
TTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACC


* Fusion transcript sequences (Full-length transcript).
>In-frame_EWSR1_ENST00000332050_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_2700nt
AGAGCCAGCGGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTG
GCCCCTTAGATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAA
GCGGTGGTTCATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCG
CCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCA
AGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTA
TGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGG
ACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCAC
CACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCC
AGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCC
CAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCC
TCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGG
ACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCC
AAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTC
TCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTC
CGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTC
AGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTC
AGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTC
ATCCAACTTCCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGA
CTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCA
TAGCTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAA
TATTTATAGGCCAGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCA
GAGAGCAAGGCATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGC
AACTTTTAAAGCTCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCAT
TCAGTTAATTCAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAG
TGGTAATCATATGTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTA
TAAAAACCATGCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAA
GACTGTTTTTAAGTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAA
GATGGTCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGC
TTGAAATTACTGTGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGG
TGTTGATCTTACAAGATATTGATGATAACACTTAAAATTGTAACCTGCATTTTTCACTTTGCTCTCAATTAAAGTCTATTCAAAAGGAAA

>In-frame_EWSR1_ENST00000332050_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_2709nt
AGAGCCAGCGGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTG
GCCCCTTAGATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAA
GCGGTGGTTCATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCG
CCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCA
AGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTA
TGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGG
ACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCAC
CACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCC
AGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCC
CAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCC
TCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGG
ACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCC
AAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTC
TCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTC
CGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTT
TGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGG
GGACCGTTCAGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTG
ATCTTCTTCATCCAACTTCCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACT
TTTAGTTGACTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAA
GAAGAGCCATAGCTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCT
ATCATGGAATATTTATAGGCCAGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGA
AATAAATCAGAGAGCAAGGCATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTT
CTGCCAGGCAACTTTTAAAGCTCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAA
TTTTACCATTCAGTTAATTCAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGAC
TCTTTTGAGTGGTAATCATATGTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTC
CTTAGTGTATAAAAACCATGCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTC
CACTGATAAGACTGTTTTTAAGTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCA
TTGTTTAAAGATGGTCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATT
TACCGTTGCTTGAAATTACTGTGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGC
ATCACTGGGTGTTGATCTTACAAGATATTGATGATAACACTTAAAATTGTAACCTGCATTTTTCACTTTGCTCTCAATTAAAGTCTATTC

>In-frame_EWSR1_ENST00000332050_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_2706nt
AGAGCCAGCGGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTG
GCCCCTTAGATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAA
GCGGTGGTTCATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCG
CCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCA
AGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTA
TGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGG
ACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCAC
CACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCC
AGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCC
CAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCC
TCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGG
ACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCC
AAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTC
TCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTC
CGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTT
TGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGG
GGACCGTTCAGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTG
ATCTTCTTCATCCAACTTCCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACT
TTTAGTTGACTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAA
GAAGAGCCATAGCTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCT
ATCATGGAATATTTATAGGCCAGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGA
AATAAATCAGAGAGCAAGGCATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTT
CTGCCAGGCAACTTTTAAAGCTCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAA
TTTTACCATTCAGTTAATTCAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGAC
TCTTTTGAGTGGTAATCATATGTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTC
CTTAGTGTATAAAAACCATGCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTC
CACTGATAAGACTGTTTTTAAGTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCA
TTGTTTAAAGATGGTCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATT
TACCGTTGCTTGAAATTACTGTGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGC
ATCACTGGGTGTTGATCTTACAAGATATTGATGATAACACTTAAAATTGTAACCTGCATTTTTCACTTTGCTCTCAATTAAAGTCTATTC

>In-frame_EWSR1_ENST00000332050_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_1796nt
AGAGCCAGCGGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTG
GCCCCTTAGATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAA
GCGGTGGTTCATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCG
CCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCA
AGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTA
TGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGG
ACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCAC
CACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCC
AGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCC
CAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCC
TCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGG
ACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCC
AAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTC
TCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTC
CGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTC
AGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTC
AGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTC
ATCCAACTTCCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGA
CTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCA

>In-frame_EWSR1_ENST00000397938_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_2691nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGA
CCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCT
GAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATT
AGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCA
GGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTT
CCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGC
CCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATC
ATGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAATATTTATAG
GCCAGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAGAGCAAG
GCATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGCAACTTTTAA
AGCTCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCAGTTAAT
TCAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAGTGGTAATCA
TATGTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAAAAACCA
TGCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAAGACTGTTTT
TAAGTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGATGGTCGT
GTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGCTTGAAATTA
CTGTGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGTTGATCT

>In-frame_EWSR1_ENST00000397938_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_2700nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGA
CCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCT
GAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTC
AGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTC
AGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTC
ATCCAACTTCCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGA
CTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCA
TAGCTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAA
TATTTATAGGCCAGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCA
GAGAGCAAGGCATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGC
AACTTTTAAAGCTCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCAT
TCAGTTAATTCAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAG
TGGTAATCATATGTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTA
TAAAAACCATGCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAA
GACTGTTTTTAAGTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAA
GATGGTCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGC
TTGAAATTACTGTGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGG
TGTTGATCTTACAAGATATTGATGATAACACTTAAAATTGTAACCTGCATTTTTCACTTTGCTCTCAATTAAAGTCTATTCAAAAGGAAA

>In-frame_EWSR1_ENST00000397938_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_2697nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGA
CCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCT
GAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTC
AGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTC
AGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTC
ATCCAACTTCCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGA
CTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCA
TAGCTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAA
TATTTATAGGCCAGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCA
GAGAGCAAGGCATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGC
AACTTTTAAAGCTCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCAT
TCAGTTAATTCAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAG
TGGTAATCATATGTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTA
TAAAAACCATGCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAA
GACTGTTTTTAAGTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAA
GATGGTCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGC
TTGAAATTACTGTGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGG

>In-frame_EWSR1_ENST00000397938_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_1787nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGA
CCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCT
GAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATT
AGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCA
GGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTT
CCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGC
CCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATC

>In-frame_EWSR1_ENST00000406548_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_2436nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAG
GTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTC
CCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGC
CCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGA
CCGTTCAGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATC
TTCTTCATCCAACTTCCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTT
AGTTGACTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAA
GAGCCATAGCTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATC
ATGGAATATTTATAGGCCAGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAAT
AAATCAGAGAGCAAGGCATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTG
CCAGGCAACTTTTAAAGCTCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTT
TACCATTCAGTTAATTCAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCT
TTTGAGTGGTAATCATATGTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTT
AGTGTATAAAAACCATGCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCAC
TGATAAGACTGTTTTTAAGTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTG
TTTAAAGATGGTCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTAC
CGTTGCTTGAAATTACTGTGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATC
ACTGGGTGTTGATCTTACAAGATATTGATGATAACACTTAAAATTGTAACCTGCATTTTTCACTTTGCTCTCAATTAAAGTCTATTCAAA

>In-frame_EWSR1_ENST00000406548_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_2445nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAG
GTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTC
CCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAA
AAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTC
CCTCGGGGACCGTTCAGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTT
CAGTTGATCTTCTTCATCCAACTTCCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTG
CCTACTTTTAGTTGACTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTA
CTGTAAGAAGAGCCATAGCTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCA
TTTTCTATCATGGAATATTTATAGGCCAGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACA
GCAAGAAATAAATCAGAGAGCAAGGCATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGAT
GTAGTTCTGCCAGGCAACTTTTAAAGCTCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTA
AAAGAATTTTACCATTCAGTTAATTCAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTT
TTTGACTCTTTTGAGTGGTAATCATATGTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGG
AGTGTCCTTAGTGTATAAAAACCATGCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAG
GATCTCCACTGATAAGACTGTTTTTAAGTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGA
AATCCATTGTTTAAAGATGGTCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTT
ATTATTTACCGTTGCTTGAAATTACTGTGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACT
AGATGCATCACTGGGTGTTGATCTTACAAGATATTGATGATAACACTTAAAATTGTAACCTGCATTTTTCACTTTGCTCTCAATTAAAGT

>In-frame_EWSR1_ENST00000406548_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_2442nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAG
GTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTC
CCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAA
AAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTC
CCTCGGGGACCGTTCAGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTT
CAGTTGATCTTCTTCATCCAACTTCCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTG
CCTACTTTTAGTTGACTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTA
CTGTAAGAAGAGCCATAGCTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCA
TTTTCTATCATGGAATATTTATAGGCCAGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACA
GCAAGAAATAAATCAGAGAGCAAGGCATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGAT
GTAGTTCTGCCAGGCAACTTTTAAAGCTCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTA
AAAGAATTTTACCATTCAGTTAATTCAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTT
TTTGACTCTTTTGAGTGGTAATCATATGTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGG
AGTGTCCTTAGTGTATAAAAACCATGCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAG
GATCTCCACTGATAAGACTGTTTTTAAGTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGA
AATCCATTGTTTAAAGATGGTCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTT
ATTATTTACCGTTGCTTGAAATTACTGTGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACT
AGATGCATCACTGGGTGTTGATCTTACAAGATATTGATGATAACACTTAAAATTGTAACCTGCATTTTTCACTTTGCTCTCAATTAAAGT

>In-frame_EWSR1_ENST00000406548_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_1532nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAG
GTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTC
CCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGC
CCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGA
CCGTTCAGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATC
TTCTTCATCCAACTTCCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTT
AGTTGACTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAA
GAGCCATAGCTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATC

>In-frame_EWSR1_ENST00000331029_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_2418nt
GCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCA
GCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGG
ACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCAC
TGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGT
CACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGC
ACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATA
TGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTA
TTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAG
CTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAG
CCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCA
GCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAA
GACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGT
CCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAGGC
AGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTCCA
AGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCCCT
GGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCATG
TCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAATATTTATAGGCC
AGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAGAGCAAGGCA
TCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGCAACTTTTAAAGC
TCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCAGTTAATTCA
ATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAGTGGTAATCATAT
GTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAAAAACCATGC
TGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAAGACTGTTTTTAA
GTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGATGGTCGTGTG
TGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGCTTGAAATTACTG
TGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGTTGATCTTAC

>In-frame_EWSR1_ENST00000331029_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_2427nt
GCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCA
GCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGG
ACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCAC
TGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGT
CACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGC
ACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATA
TGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTA
TTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAG
CTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAG
CCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCA
GCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAA
GACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGA
TGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGT
GTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATC
CAACTTCCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTC
ACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAG
CTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAATAT
TTATAGGCCAGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAG
AGCAAGGCATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGCAAC
TTTTAAAGCTCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCA
GTTAATTCAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAGTGG
TAATCATATGTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAA
AAACCATGCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAAGAC
TGTTTTTAAGTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGAT
GGTCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGCTTG
AAATTACTGTGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGT

>In-frame_EWSR1_ENST00000331029_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_2424nt
GCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCA
GCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGG
ACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCAC
TGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGT
CACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGC
ACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATA
TGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTA
TTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAG
CTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAG
CCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCA
GCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAA
GACCCACACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGA
TGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGT
GTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATC
CAACTTCCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTC
ACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAG
CTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAATAT
TTATAGGCCAGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAG
AGCAAGGCATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGCAAC
TTTTAAAGCTCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCA
GTTAATTCAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAGTGG
TAATCATATGTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAA
AAACCATGCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAAGAC
TGTTTTTAAGTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGAT
GGTCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGCTTG
AAATTACTGTGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGT

>In-frame_EWSR1_ENST00000331029_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_1514nt
GCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCA
GCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGG
ACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCAC
TGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGT
CACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGC
ACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATA
TGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTA
TTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAG
CTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAG
CCAACAGAGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCA
GCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAA
GACCCACACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGT
CCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAGGC
AGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTCCA
AGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCCCT
GGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCATG

>In-frame_EWSR1_ENST00000414183_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_2411nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAA
AGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCAC
ACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCAT
CACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAGGCAGCACAG
TGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTCCAAGACAAG
ATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCCCTGGAGAAG
CAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCATGTCCCCCT
GACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAATATTTATAGGCCAGGGCAT
GTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAGAGCAAGGCATCGGGGG
TGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGCAACTTTTAAAGCTCATGCA
TTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCAGTTAATTCAATGTGAA
CACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAGTGGTAATCATATGTGTCTT
TATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAAAAACCATGCTGGTATA
TGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAAGACTGTTTTTAAGTAACTT
AAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGATGGTCGTGTGTGTGTGT
GTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGCTTGAAATTACTGTGTAAAT
ATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGTTGATCTTACAAGATAT

>In-frame_EWSR1_ENST00000414183_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_2420nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAA
AGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCAC
ACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTA
GTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAG
GCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTC
CAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCC
CTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCA
TGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAATATTTATAGG
CCAGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAGAGCAAGG
CATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGCAACTTTTAAA
GCTCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCAGTTAATT
CAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAGTGGTAATCAT
ATGTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAAAAACCAT
GCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAAGACTGTTTTT
AAGTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGATGGTCGTG
TGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGCTTGAAATTAC
TGTGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGTTGATCTT

>In-frame_EWSR1_ENST00000414183_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_2417nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAA
AGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCAC
ACCAGGACTCATACAGGTAAAACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTA
GTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAG
GCAGCACAGTGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTC
CAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCC
CTGGAGAAGCAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCA
TGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAATATTTATAGG
CCAGGGCATGTGTATGTGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAGAGCAAGG
CATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGCAACTTTTAAA
GCTCATGCATTTCAAGCAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCAGTTAATT
CAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAGTGGTAATCAT
ATGTGTCTTTATAGATGTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAAAAACCAT
GCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAAGACTGTTTTT
AAGTAACTTAAGGACCTTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGATGGTCGTG
TGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGCTTGAAATTAC
TGTGTAAATATATGTCTGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGTTGATCTT

>In-frame_EWSR1_ENST00000414183_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_1507nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAA
AGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCAC
ACCAGGACTCATACAGGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCAT
CACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAGGCAGCACAG
TGTGTGAACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTCCAAGACAAG
ATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCCCTGGAGAAG
CAGCTAACAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCATGTCCCCCT

>In-frame_EWSR1_ENST00000333395_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_2391nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATAC
AGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGA
AAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAA
CATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGT
CTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTCCAAGACAAGATACCGGTGCTTCTGGAAAC
TACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTA
GTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTT
ATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAATATTTATAGGCCAGGGCATGTGTATGTGTCTGCTAATGT
AAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAGAGCAAGGCATCGGGGGTGAATCTTGTCTAACATTCC
CGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGCAACTTTTAAAGCTCATGCATTTCAAGCAGCTGAAGAAAA
AATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCAGTTAATTCAATGTGAACACTGGCACACTGCTCTTAA
GAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAGTGGTAATCATATGTGTCTTTATAGATGTACATACCTCCT
TGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAAAAACCATGCTGGTATATGGCTTCAAGTTGTAAAAAT
GAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAAGACTGTTTTTAAGTAACTTAAGGACCTTTGGGTCTACAA
GTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGATGGTCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGT
GTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGCTTGAAATTACTGTGTAAATATATGTCTGATAATGATTTG
CTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGTTGATCTTACAAGATATTGATGATAACACTTAAAATT

>In-frame_EWSR1_ENST00000333395_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_2400nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATAC
AGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAA
AACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCA
TCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAGGCAGCACAGTGTGTGAACTG
CTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTCCAAGACAAGATACCGGTGCT
TCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCCCTGGAGAAGCAGCTAACAAT
GTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCATGTCCCCCTGACCCTTCCCT
TCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAATATTTATAGGCCAGGGCATGTGTATGTGTC
TGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAGAGCAAGGCATCGGGGGTGAATCTTGTC
TAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGCAACTTTTAAAGCTCATGCATTTCAAGCAGC
TGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCAGTTAATTCAATGTGAACACTGGCACAC
TGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAGTGGTAATCATATGTGTCTTTATAGATGTAC
ATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAAAAACCATGCTGGTATATGGCTTCAAGT
TGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAAGACTGTTTTTAAGTAACTTAAGGACCTTTG
GGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGATGGTCGTGTGTGTGTGTGTGTGTGTGTG
TGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGCTTGAAATTACTGTGTAAATATATGTCTGAT
AATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGTTGATCTTACAAGATATTGATGATAACA

>In-frame_EWSR1_ENST00000333395_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_2397nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATAC
AGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAA
AACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCA
TCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAGGCAGCACAGTGTGTGAACTG
CTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTCCAAGACAAGATACCGGTGCT
TCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCCCTGGAGAAGCAGCTAACAAT
GTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCATGTCCCCCTGACCCTTCCCT
TCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAATATTTATAGGCCAGGGCATGTGTATGTGTC
TGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAGAGCAAGGCATCGGGGGTGAATCTTGTC
TAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGCAACTTTTAAAGCTCATGCATTTCAAGCAGC
TGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCAGTTAATTCAATGTGAACACTGGCACAC
TGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAGTGGTAATCATATGTGTCTTTATAGATGTAC
ATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAAAAACCATGCTGGTATATGGCTTCAAGT
TGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAAGACTGTTTTTAAGTAACTTAAGGACCTTTG
GGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGATGGTCGTGTGTGTGTGTGTGTGTGTGTG
TGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGCTTGAAATTACTGTGTAAATATATGTCTGAT
AATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGTTGATCTTACAAGATATTGATGATAACA

>In-frame_EWSR1_ENST00000333395_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_1487nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGACATAC
AGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTGA
AAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGAGAAA
CATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTCAAGT
CTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTCCAAGACAAGATACCGGTGCTTCTGGAAAC
TACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTGGTTA
GTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTT

>In-frame_EWSR1_ENST00000332035_chr22_29683128_+_WT1_ENST00000379079_chr11_32414301_-_2215nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGAC
ATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAG
GTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGA
GAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTC
AAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTCCAAGACAAGATACCGGTGCTTCTGG
AAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTG
GTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCATGTCCCCCTGACCCTTCCCTTCTTT
TTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAATATTTATAGGCCAGGGCATGTGTATGTGTCTGCTA
ATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAGAGCAAGGCATCGGGGGTGAATCTTGTCTAACA
TTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGCAACTTTTAAAGCTCATGCATTTCAAGCAGCTGAAG
AAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCAGTTAATTCAATGTGAACACTGGCACACTGCTC
TTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAGTGGTAATCATATGTGTCTTTATAGATGTACATACC
TCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAAAAACCATGCTGGTATATGGCTTCAAGTTGTAA
AAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAAGACTGTTTTTAAGTAACTTAAGGACCTTTGGGTCT
ACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGATGGTCGTGTGTGTGTGTGTGTGTGTGTGTGTGT
GTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGCTTGAAATTACTGTGTAAATATATGTCTGATAATGA
TTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGTTGATCTTACAAGATATTGATGATAACACTTAA

>In-frame_EWSR1_ENST00000332035_chr22_29683128_+_WT1_ENST00000332351_chr11_32414301_-_2224nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGAC
ATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAG
GTAAAACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACA
TGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAGGCAGCACAGTGTGTGA
ACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTCCAAGACAAGATACCGG
TGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCCCTGGAGAAGCAGCTAA
CAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCATGTCCCCCTGACCCTT
CCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAATATTTATAGGCCAGGGCATGTGTATG
TGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAGAGCAAGGCATCGGGGGTGAATCT
TGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGCAACTTTTAAAGCTCATGCATTTCAAG
CAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCAGTTAATTCAATGTGAACACTGGC
ACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAGTGGTAATCATATGTGTCTTTATAGAT
GTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAAAAACCATGCTGGTATATGGCTTC
AAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAAGACTGTTTTTAAGTAACTTAAGGACC
TTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGATGGTCGTGTGTGTGTGTGTGTGTG
TGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGCTTGAAATTACTGTGTAAATATATGTC
TGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGTTGATCTTACAAGATATTGATGAT

>In-frame_EWSR1_ENST00000332035_chr22_29683128_+_WT1_ENST00000530998_chr11_32414301_-_2221nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGAC
ATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAG
GTAAAACAAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACA
TGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAGGCAGCACAGTGTGTGA
ACTGCTTTCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTCCAAGACAAGATACCGG
TGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCCCTGGAGAAGCAGCTAA
CAATGTCTGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCATGTCCCCCTGACCCTT
CCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGAATTATTGTACCATTTTCTATCATGGAATATTTATAGGCCAGGGCATGTGTATG
TGTCTGCTAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAGAGCAAGGCATCGGGGGTGAATCT
TGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCTGGAAAGCAGGATGTAGTTCTGCCAGGCAACTTTTAAAGCTCATGCATTTCAAG
CAGCTGAAGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCAGTTAATTCAATGTGAACACTGGC
ACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTTTTTGTGTATGTTTTTGACTCTTTTGAGTGGTAATCATATGTGTCTTTATAGAT
GTACATACCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAAAAACCATGCTGGTATATGGCTTC
AAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAGGGGATGGTCCAGGATCTCCACTGATAAGACTGTTTTTAAGTAACTTAAGGACC
TTTGGGTCTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGATGGTCGTGTGTGTGTGTGTGTGTG
TGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAAGGGAGGGAATTTATTATTTACCGTTGCTTGAAATTACTGTGTAAATATATGTC
TGATAATGATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGTTGATCTTACAAGATATTGATGAT

>In-frame_EWSR1_ENST00000332035_chr22_29683128_+_WT1_ENST00000448076_chr11_32414301_-_1311nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGAGTGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCAGCTCAAAAGACACCAAAGGAGAC
ATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCAGCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAG
GTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGATGAATTAGTCCGCCATCACAACATGCATCAGA
GAAACATGACCAAACTCCAGCTGGCGCTTTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAGGCAGCACAGTGTGTGAACTGCTTTC
AAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATCCAACTTCCAAGACAAGATACCGGTGCTTCTGG
AAACTACCAGGTGTGCCTGGAAGAGTTGGTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCCCTGGAGAAGCAGCTAACAATGTCTG
GTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAGCTGATCATGTCCCCCTGACCCTTCCCTTCTTT


Top

FusionGenePPI for EWSR1_WT1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EWSR1PRTFDC1, ZDHHC3, MSC, SLC22A24, MYO1F, KXD1, KHDRBS2, DNAJB3, FASN, NLE1, MNS1, PRUNE2, WWP2, NDUFB1, BNIP3L, NSUN4, KRR1, WWP1, RMND5B, SLC1A1, RASL11B, DFFA, WDR37, RPS15A, CPSF6, C11orf16, YY1AP1, RNF183, MTCP1, TULP2, RBPMS, KEL, MYOZ2, FAM131C, HMGA1, NPPB, HERPUD1, CD177, RPL31, VPS72, ACTL6A, RAD23A, MAGEA11, CFDP1, DMRTB1, CXADR, ZNF165, SSBP2, TPGS2, RAB37, CETP, NDUFV1, DYNLL2, NBPF3, CEACAM5, GPBP1L1, SERP2, GNPDA1, C19orf57, ELAVL3, ELAVL4, LILRA3, BAD, CCDC7, MRPS18B, CUEDC2, CNST, TSPAN3, CCDC91, TRIM37, NINL, NTNG2, CPSF7, PGLS, EPT1, MYL6, SMAD4, TMSB4Y, TRPV5, MVK, MAPK1IP1L, MDFI, MTMR9, PLSCR1, RALYL, PDHX, C10orf12, RHOXF2, MATK, SALL2, AGT, KCNMB1, SUV39H2, SMNDC1, ARHGDIA, PUF60, GSK3B, ILK, CD2BP2, BARD1, CREBBP, BTK, SF1, SNRPC, ELK1, PTK2B, CALM1, POU4F1, EZH2, IRF3, TONSL, RFX3, HLTF, SUPT4H1, ZNF184, HIST1H2BN, BLZF1, HDAC3, FXR2, HMGN4, POLR3A, ECD, ZBTB1, SCMH1, SUZ12, E2F8, TRIM5, ZNF383, DHX9, SMN1, PCM1, RAD21, NDRG1, CEBPA, ELAVL1, SIRT7, HNRNPA1, TSG101, TP53, POLR2A, YBX1, TDRD3, CUL3, CUL4A, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, KCND3, ATN1, ATXN3, ERCC5, HBP1, HSPA2, PCBP1, USP7, SRSF5, TMEM126A, SAP30BP, GORASP2, MBD3, MRPS9, HAX1, SFXN1, ITGA5, TCIRG1, RNF168, GEMIN5, HAS1, MTCH1, NDUFA5, MCAT, MRPL57, HDAC2, ESR1, FN1, VCAM1, ITGA4, CD81, PRMT1, SF3B4, EP300, PRRC2A, EWSR1, FUS, ITGB5, NONO, TRAF3, HNRNPUL1, EPAS1, CHERP, CDK12, ITCH, WBP4, RPA3, RPA2, RPA1, HSPA5, RIOK2, TRAF1, TRAF2, SEC24D, TFG, SEC24A, SSBP3, PRR13, ATPAF2, PEF1, JUN, CUL7, OBSL1, CCDC8, RNF2, BMI1, EGFR, ABL1, SRPK1, ABCE1, PRMT8, RPS6KB2, ACAA2, ACAT1, EIF4H, ANXA2, HIP1R, PICALM, POR, NTRK1, SCARNA22, NPM1, KRT2, PRDX2, S100A9, YWHAZ, DDX17, PCLO, ANXA6, SEC24C, GIPC1, CSRP2, FHL1, HNRNPA3, CTTN, MARCKSL1, PARP1, SERPINB3, CCDC50, KIF2A, KRT6B, HIST1H1D, STK38, H2AFV, PACSIN2, U2AF1, RSL24D1, XRCC5, ESYT3, RPL29, SDF2L1, LRP1B, MSN, SEC23A, RPL7A, SNX18, PPIL1, RPS27A, IGHM, SUMO3, GTF2I, RUVBL1, KRT16, RBM8A, RPL8, SRSF9, ZC3HAV1L, GAPDH, ETV3, IGF2R, COL5A2, HNRNPD, ANP32B, WAC, TFAP2A, TTN, CBR3, ARGLU1, HNRNPAB, SRRT, ATP1B3, COPS7B, PRR12, ATF3, NOMO3, NOMO1, NOMO2, EYA3, C1orf198, MAZ, U2AF2, SSB, TRA2B, C1orf52, HMGB1, HMGB1P10, RPRD1A, HNRNPH3, EIF5A2, C1orf131, SEC13, MAPRE1, CSTF2T, SRSF3, LENG1, UPF1, HDGFRP2, RPS10P7, RPS10P11, RPS10, RPS10P13, RPS10P4, RPS10P22, DACH1, ANO1, NCOR1, MLX, SUMO1P3, SUMO1, WIZ, PFDN6, ARFIP2, ZHX3, EEF1B2, MBIP, BAG6, DENND2A, PRCC, SRSF1, EIF4ENIF1, SPTAN1, CDCA8, PLS3, API5P1, API5, PSMA4, DNTTIP1, AKAP8, NCOA3, SMTN, FBRS, SMARCE1, ERC1, WBP11, SPTBN1, NFRKB, OLA1, ZNF207, R3HDM1, TRIM33, SAFB, UBFD1, SRSF7, SRSF2, GATA6, VDAC1P1, VDAC1, IL16, GMNN, ILF2, MED4, QKI, VCL, MFAP1, SNAP29, PADI1, BCL9, BCL9L, PKM, GPATCH11, CASC3, PSMC6, CACYBP, RPL12P6, RPL12P32, RPL12P14, RPL12, RPL12P2, RPL12P35, RPL12P19, TPI1, TPI1P1, CHAF1A, MIA3, CIC, SDCBP, CA2, FKBP3, ACE, NKX2-5, CSTF2, PFDN2, UBTF, FAM207A, LOC729774, BRD8, C12orf45, C1orf35, TCF20, SOD1, SPAG7, MED8, ETS2, ALDOC, FKBP4, INCENP, CEP85, CECR2, TFE3, SUPT16HP1, SUPT16H, MAPT, HTATSF1, RPS18P12, RPS18P5, KPNA2, TMX1, CKAP4, HSPE1, COPRS, PTGES3, LAMP2, ERLIN2, CTNNBL1, TOMM22, NRBF2, C9orf78, NCOA6, MED26, RANBP1, LOC389842, LOC727803, HMGB3, CANX, PUS7, RPSAP19, RPSA, RPSAP18, RPSAP58, RPSAP15, RPSAP8, RPSAP9, RPSAP12, RPSAP29, RPSAP61, ARHGAP17, USF1, PSIP1, SNRPEP2, SNRPE, NUDT5, PPM1G, OTUB1, AHCY, COPS3, NSMCE2, SAE1, PROSER1, GRWD1, CREB5, TAF9B, RBM33, EDF1, PGK1, FAM114A2, SRRM1, RAD23B, CIAPIN1, CIAPIN1P, LRRC59, PABPN1, KMT2A, RPRD1B, GPATCH8, CCDC43, DGCR14, PPP1R2, ERICH1, EIF5A, EIF5AL1, BAG3, PCNA, SOX7, PNISR, FAM168A, MED15, SRSF11, SIRT1, RSF1, MAML1, HPRT1, SPDL1, CRTC3, CEP55, CDV3, ALYREF, RNF40, STOML2, DGCR8, NUCKS1, UBN2, PSMD7, WNT10A, HMBS, KHDRBS1, VBP1, NCSTN, CDCA2, SFSWAP, ZRANB2, DDB1, RBBP6, ZEB1, SRSF6, LOC644422, EIF2S1, RFX5, RPS19, RPS19P3, TALDO1, CWC15, CDCA5, LOC645086, C11orf58, TXN, STX12, PHRF1, BSG, TAF4, SH3GL1, LIN37, HRNR, FAM192A, RRBP1, KIAA0907, GOLGB1, PAX9, P4HB, CHMP5, LDHB, CALR, SUMO2P1, SUMO2, PDIA6, AHSA1, EN2, CCDC124, RPLP0P6, RPLP0P2, RPLP0P3, RPLP0, NIPBL, PDLIM4, PRKCSH, C15orf39, HNRNPDL, PDIA4, NUP210, RPLP2P3, RPLP2, PRDX4, DAZAP1, UBE2T, PHAX, AMOT, MARCKS, LOC284685, SMARCC1, BCORL1, RFC4, GLRX3, ANP32E, HYOU1, NPM3, ATF7IP, SARNP, TRA2A, HDGF, STIP1, PELP1, KCTD12, GLO1, PCF11, CLIC1, DNAJC8, RNF114, SLC4A1AP, FAM50A, GTF2A1, PRPF40A, CDC37, PPIAP22, PPIA, SMARCC2, MEGF11, KIAA1143, DENR, LAMP1, MYBL2, PITX1, UBE2MP1, UBE2M, CHTF8, OTX1, NACA, FNBP4, GTF2F2, GLTSCR1, GTF2E1, PQBP1, EMD, RNF113A, GPALPP1, SNRPA, RRP15, RPS25, RPS25P8, GMEB2, LNPEP, DNAJB1, IGBP1P1, IGBP1, HINT1, ARID1A, PPIB, ANXA11, MATR3, PPARGC1A, MCM2, UBASH3B, SFPQ, CAPN13, HEY1, BRCA1WT1WTAP, UBE2I, PAWR, TP53, U2AF2, MEN1, SUZ12, EZH2, DNMT1, DVL3, NPM3, ZNF205, TAOK1, HSPA4, CIAO1, EGR1, MDM2, KRT40, KRTAP10-8, KRTAP10-3, CASZ1, CCL5, DIRAS3, KLK7, NAT2, THRSP, NANOG, CCDC136, CCDC33, CEP70, DVL2, ETV7, FAM9B, FMR1NB, GOLGA2, HMBOX1, IDI1, KPNA4, KPNA5, KRTAP10-1, KRTAP10-4, KRTAP10-5, KRTAP10-7, KRTAP10-9, LDOC1, MAGEA8, RNASEH2B, SERF2, THAP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EWSR1_WT1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EWSR1_WT1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEWSR1C0553580Ewings sarcoma3CTD_human;HPO;ORPHANET
HgeneEWSR1C0206663Neuroectodermal Tumor, Primitive1CTD_human
TgeneWT1C0950121Denys-Drash Syndrome17CTD_human;ORPHANET;UNIPROT
TgeneWT1C0027708Nephroblastoma6CTD_human;HPO;ORPHANET;UNIPROT
TgeneWT1C3151568NEPHROTIC SYNDROME, TYPE 44CTD_human;UNIPROT
TgeneWT1C0009375Colonic Neoplasms1CTD_human
TgeneWT1C0017636Glioblastoma1CTD_human
TgeneWT1C0017658Glomerulonephritis1CTD_human
TgeneWT1C0019284Diaphragmatic Hernia1CTD_human
TgeneWT1C0023418leukemia1CTD_human
TgeneWT1C0023467Leukemia, Myelocytic, Acute1CTD_human
TgeneWT1C0023473Myeloid Leukemia, Chronic1CTD_human
TgeneWT1C0023487Acute Promyelocytic Leukemia1CTD_human
TgeneWT1C0024121Lung Neoplasms1CTD_human
TgeneWT1C0027809Neurilemmoma1CTD_human
TgeneWT1C0030297Pancreatic Neoplasm1CTD_human
TgeneWT1C0031149Peritoneal Neoplasms1CTD_human
TgeneWT1C0085215Ovarian Failure, Premature1CTD_human
TgeneWT1C0235833Congenital diaphragmatic hernia1CTD_human;HPO
TgeneWT1C0345967Malignant mesothelioma1CTD_human;HPO
TgeneWT1C0950122Frasier Syndrome1CTD_human;ORPHANET;UNIPROT
TgeneWT1C1458155Mammary Neoplasms1CTD_human