FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12114

FusionGeneSummary for ESYT1_MED14

check button Fusion gene summary
Fusion gene informationFusion gene name: ESYT1_MED14
Fusion gene ID: 12114
HgeneTgene
Gene symbol

ESYT1

MED14

Gene ID

23344

9282

Gene nameextended synaptotagmin 1mediator complex subunit 14
SynonymsFAM62A|MBC2CRSP150|CRSP2|CSRP|CXorf4|DRIP150|EXLM1|RGR1|TRAP170
Cytomap

12q13.2

Xp11.4

Type of geneprotein-codingprotein-coding
Descriptionextended synaptotagmin-1extended synaptotagmin like protein 1extended synaptotagmin protein 1family with sequence similarity 62 (C2 domain containing), member Amembrane-bound C2 domain-containing proteinmediator of RNA polymerase II transcription subunit 14ARC150CRSP complex subunit 2RGR1 homologactivator-recruited cofactor 150 kDa componentcofactor required for Sp1 transcriptional activation, subunit 2 (150kD)hRGR1human homolog of yeast RGR1thyr
Modification date2018052320180523
UniProtAcc

Q9BSJ8

O60244

Ensembl transtripts involved in fusion geneENST00000394048, ENST00000267113, 
ENST00000541590, ENST00000550878, 
ENST00000324817, ENST00000496531, 
Fusion gene scores* DoF score3 X 3 X 3=271 X 1 X 1=1
# samples 31
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: ESYT1 [Title/Abstract] AND MED14 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMED14

GO:0006367

transcription initiation from RNA polymerase II promoter

12218053

TgeneMED14

GO:0030518

intracellular steroid hormone receptor signaling pathway

11867769

TgeneMED14

GO:0030521

androgen receptor signaling pathway

12218053

TgeneMED14

GO:0045893

positive regulation of transcription, DNA-templated

10198638

TgeneMED14

GO:0045944

positive regulation of transcription by RNA polymerase II

12037571


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-86-7954-01AESYT1chr12

56532797

+MED14chrX

40514312

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000394048ENST00000324817ESYT1chr12

56532797

+MED14chrX

40514312

-
5CDS-intronENST00000394048ENST00000496531ESYT1chr12

56532797

+MED14chrX

40514312

-
In-frameENST00000267113ENST00000324817ESYT1chr12

56532797

+MED14chrX

40514312

-
5CDS-intronENST00000267113ENST00000496531ESYT1chr12

56532797

+MED14chrX

40514312

-
In-frameENST00000541590ENST00000324817ESYT1chr12

56532797

+MED14chrX

40514312

-
5CDS-intronENST00000541590ENST00000496531ESYT1chr12

56532797

+MED14chrX

40514312

-
3UTR-3CDSENST00000550878ENST00000324817ESYT1chr12

56532797

+MED14chrX

40514312

-
3UTR-intronENST00000550878ENST00000496531ESYT1chr12

56532797

+MED14chrX

40514312

-

Top

FusionProtFeatures for ESYT1_MED14


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ESYT1

Q9BSJ8

MED14

O60244

Binds glycerophospholipids in a barrel-like domain andmay play a role in cellular lipid transport (By similarity). Bindscalcium (via the C2 domains) and translocates to sites of contactbetween the endoplasmic reticulum and the cell membrane inresponse to increased cytosolic calcium levels. Helps tether theendoplasmic reticulum to the cell membrane and promotes theformation of appositions between the endoplasmic reticulum and thecell membrane. {ECO:0000250, ECO:0000269|PubMed:23791178,ECO:0000269|PubMed:24183667}. Component of the Mediator complex, a coactivatorinvolved in the regulated transcription of nearly all RNApolymerase II-dependent genes. Mediator functions as a bridge toconvey information from gene-specific regulatory proteins to thebasal RNA polymerase II transcription machinery. Mediator isrecruited to promoters by direct interactions with regulatoryproteins and serves as a scaffold for the assembly of a functionalpreinitiation complex with RNA polymerase II and the generaltranscription factors. {ECO:0000269|PubMed:15340088,ECO:0000269|PubMed:15625066, ECO:0000269|PubMed:16595664}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+243191_1168741115Coiled coilOntology_term=ECO:0000255
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+243191_1168641105Coiled coilOntology_term=ECO:0000255
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+243291_116874975Coiled coilOntology_term=ECO:0000255
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+2431135_3138741115DomainSMP-LTD
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+2431316_4178741115DomainC2 1
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+2431465_5588741115DomainC2 2
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+2431634_7358741115DomainC2 3
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+2431785_8778741115DomainC2 4
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+2431135_3138641105DomainSMP-LTD
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+2431316_4178641105DomainC2 1
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+2431465_5588641105DomainC2 2
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+2431634_7358641105DomainC2 3
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+2432135_313874975DomainSMP-LTD
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+2432316_417874975DomainC2 1
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+2432465_558874975DomainC2 2
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+2432634_735874975DomainC2 3
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+2432785_877874975DomainC2 4
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+24311_388741115Topological domainCytoplasmic
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+243160_628741115Topological domainLumenal
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+24311_388641105Topological domainCytoplasmic
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+243160_628641105Topological domainLumenal
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+24321_38874975Topological domainCytoplasmic
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+243260_62874975Topological domainLumenal
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+243139_598741115TransmembraneHelical
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+243163_838741115TransmembraneHelical
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+243139_598641105TransmembraneHelical
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+243163_838641105TransmembraneHelical
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+243239_59874975TransmembraneHelical
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+243263_83874975TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+24311012_10158741115Compositional biasNote=Poly-Leu
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+2431924_9358741115Compositional biasNote=Poly-Ser
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+24311012_10158641105Compositional biasNote=Poly-Leu
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+2431924_9358641105Compositional biasNote=Poly-Ser
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+24321012_1015874975Compositional biasNote=Poly-Leu
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+2432924_935874975Compositional biasNote=Poly-Ser
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+2431972_10778741115DomainC2 5
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+2431785_8778641105DomainC2 4
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+2431972_10778641105DomainC2 5
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+2432972_1077874975DomainC2 5
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+24311018_10258741115RegionRequired for phosphatidylinositol 4%2C5-bisphosphate-dependent location at the cell membrane
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+24311018_10258641105RegionRequired for phosphatidylinositol 4%2C5-bisphosphate-dependent location at the cell membrane
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+24321018_1025874975RegionRequired for phosphatidylinositol 4%2C5-bisphosphate-dependent location at the cell membrane
HgeneESYT1chr12:56532797chrX:40514312ENST00000267113+243184_11048741115Topological domainCytoplasmic
HgeneESYT1chr12:56532797chrX:40514312ENST00000394048+243184_11048641105Topological domainCytoplasmic
HgeneESYT1chr12:56532797chrX:40514312ENST00000541590+243284_1104874975Topological domainCytoplasmic
TgeneMED14chr12:56532797chrX:40514312ENST00000324817-27311002_116513241455Compositional biasNote=Pro-rich
TgeneMED14chr12:56532797chrX:40514312ENST00000324817-27311182_118613241455MotifNote=LXXLL motif 2
TgeneMED14chr12:56532797chrX:40514312ENST00000324817-273169_7313241455MotifNote=LXXLL motif 1


Top

FusionGeneSequence for ESYT1_MED14


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ESYT1_ENST00000394048_chr12_56532797_+_MED14_ENST00000324817_chrX_40514312_-_995aa
MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLG
WRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFT
FTRVELGEKPLRIIGVKVHPGQRKEQILLDLNISYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRVILEPLIGDLPFVGAVSMFFIRRPTL
DINWTGMTNLLDIPGLSSLSDTMIMDSIAAFLVLPNRLLVPLVPDLQDVAQLRSPLPRGIIRIHLLAARGLSSKDKYVKGLIEGKSDPYA
LVRLGTQTFCSRVIDEELNPQWGETYEVMVHEVPGQEIEVEVFDKDPDKDDFLGRMKLDVGKVLQASVLDDWFPLQGGQGQVHLRLEWLS
LLSDAEKLEQVLQWNWGVSSRPDPPSAAILVVYLDRAQDLPLKKGNKEPNPMVQLSIQDVTQESKAVYSTNCPVWEEAFRFFLQDPQSQE
LDVQVKDDSRALTLGALTLPLARLLTAPELILDQWFQLSSSGPNSRLYMKLVMRILYLDSSEICFPTVPGCPGAWDVDSENPQRGSSVDA
PPRPCHTTPDSQFGTEHVLRIHVLEAQDLIAKDRFLGGLVKGKSDPYVKLKLAGRSFRSHVVREDLNPRWNEVFEVIVTSVPGQELEVEV
FDKDLDKDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALLSIYMERAEDL
PLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTESLELQFPDQATQLKWNVQFCLTIPPSAPPIAPPGTPAVVLK
SKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVRDLMANLTLPP

>In-frame_ESYT1_ENST00000267113_chr12_56532797_+_MED14_ENST00000324817_chrX_40514312_-_1005aa
MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLG
WRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFT
FTRVELGEKPLRIIGVKVHPGQRKEQILLDLNISYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRVILEPLIGDLPFVGAVSMFFIRRPTL
DINWTGMTNLLDIPGLSSLSDTMIMDSIAAFLVLPNRLLVPLVPDLQDVAQLRSPLPRGIIRIHLLAARGLSSKDKYVKGLIEGKSDPYA
LVRLGTQTFCSRVIDEELNPQWGETYEVMVHEVPGQEIEVEVFDKDPDKDDFLGRMKLDVGKVLQASVLDDWFPLQGGQGQVHLRLEWLS
LLSDAEKLEQVLQWNWGVSSRPDPPSAAILVVYLDRAQDLPMVTSELYPPQLKKGNKEPNPMVQLSIQDVTQESKAVYSTNCPVWEEAFR
FFLQDPQSQELDVQVKDDSRALTLGALTLPLARLLTAPELILDQWFQLSSSGPNSRLYMKLVMRILYLDSSEICFPTVPGCPGAWDVDSE
NPQRGSSVDAPPRPCHTTPDSQFGTEHVLRIHVLEAQDLIAKDRFLGGLVKGKSDPYVKLKLAGRSFRSHVVREDLNPRWNEVFEVIVTS
VPGQELEVEVFDKDLDKDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALL
SIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTESLELQFPDQATQLKWNVQFCLTIPPSAPPIA
PPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVR

>In-frame_ESYT1_ENST00000541590_chr12_56532797_+_MED14_ENST00000324817_chrX_40514312_-_1005aa
MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLG
WRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFT
FTRVELGEKPLRIIGVKVHPGQRKEQILLDLNISYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRVILEPLIGDLPFVGAVSMFFIRRPTL
DINWTGMTNLLDIPGLSSLSDTMIMDSIAAFLVLPNRLLVPLVPDLQDVAQLRSPLPRGIIRIHLLAARGLSSKDKYVKGLIEGKSDPYA
LVRLGTQTFCSRVIDEELNPQWGETYEVMVHEVPGQEIEVEVFDKDPDKDDFLGRMKLDVGKVLQASVLDDWFPLQGGQGQVHLRLEWLS
LLSDAEKLEQVLQWNWGVSSRPDPPSAAILVVYLDRAQDLPMVTSELYPPQLKKGNKEPNPMVQLSIQDVTQESKAVYSTNCPVWEEAFR
FFLQDPQSQELDVQVKDDSRALTLGALTLPLARLLTAPELILDQWFQLSSSGPNSRLYMKLVMRILYLDSSEICFPTVPGCPGAWDVDSE
NPQRGSSVDAPPRPCHTTPDSQFGTEHVLRIHVLEAQDLIAKDRFLGGLVKGKSDPYVKLKLAGRSFRSHVVREDLNPRWNEVFEVIVTS
VPGQELEVEVFDKDLDKDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALL
SIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTESLELQFPDQATQLKWNVQFCLTIPPSAPPIA
PPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ESYT1_ENST00000394048_chr12_56532797_+_MED14_ENST00000324817_chrX_40514312_-_2985nt
ATGGAGCGATCTCCAGGAGAGGGCCCCAGCCCCAGCCCCATGGACCAGCCCTCTGCTCCCTCCGACCCCACTGACCAGCCCCCCGCTGCT
CACGCAAAGCCAGACCCAGGTTCTGGGGGCCAACCTGCTGGCCCTGGCGCGGCGGGTGAGGCCCTGGCGGTGCTGACTTCATTCGGGAGG
CGGTTGCTGGTGCTGATACCTGTGTATTTGGCCGGGGCAGTGGGACTCAGCGTGGGTTTCGTGCTCTTCGGCCTCGCCCTCTACCTGGGC
TGGCGCCGGGTCCGCGACGAGAAAGAACGGAGCCTTCGAGCAGCGAGGCAGCTACTGGACGACGAGGAGCAGCTCACTGCGAAAACTCTC
TATATGAGTCATCGAGAGCTACCTGCCTGGGTCAGCTTCCCAGACGTGGAAAAGGCTGAATGGCTCAATAAGATTGTGGCCCAGGTCTGG
CCCTTCCTGGGCCAGTATATGGAGAAGCTTCTGGCTGAAACTGTGGCTCCGGCTGTTAGGGGATCTAACCCCCATCTGCAAACATTTACA
TTTACACGAGTGGAACTGGGTGAAAAGCCATTGCGCATCATTGGAGTCAAGGTTCACCCAGGTCAGAGAAAAGAGCAGATCCTGCTGGAC
TTGAACATCAGCTATGTAGGTGATGTGCAGATTGATGTGGAAGTGAAGAAATATTTTTGCAAAGCAGGAGTCAAGGGCATGCAGCTACAT
GGCGTTTTGCGGGTGATACTGGAGCCACTCATTGGGGACCTTCCCTTCGTGGGGGCTGTGTCAATGTTCTTCATCCGACGCCCGACCCTA
GACATCAACTGGACAGGGATGACCAACCTGCTGGATATCCCAGGACTTAGCTCACTCTCTGACACCATGATCATGGACTCCATTGCTGCC
TTCCTCGTGTTGCCCAACCGATTACTGGTGCCCCTTGTGCCTGACCTTCAAGATGTGGCTCAGTTGCGTTCCCCTCTGCCCAGGGGCATT
ATTCGAATTCACCTGCTGGCTGCTCGAGGGCTGAGTTCCAAGGACAAATATGTGAAGGGCCTGATTGAGGGCAAGTCAGACCCATATGCA
CTTGTGCGTTTGGGTACCCAGACATTCTGCAGTCGTGTCATTGATGAAGAACTCAACCCACAGTGGGGAGAGACTTATGAGGTGATGGTA
CACGAGGTCCCAGGGCAGGAGATTGAAGTGGAGGTGTTCGACAAGGATCCAGATAAAGATGACTTTCTGGGCAGAATGAAGCTGGATGTA
GGGAAGGTGTTACAGGCTAGCGTTCTGGATGATTGGTTCCCTCTACAAGGTGGGCAAGGCCAAGTTCACTTGAGGCTAGAATGGCTGTCA
CTTTTGTCAGATGCAGAGAAACTGGAGCAGGTTCTACAGTGGAATTGGGGAGTCTCCTCTCGACCAGATCCCCCGTCAGCTGCCATCTTA
GTTGTCTACCTGGATCGGGCCCAGGATCTTCCTCTGAAGAAGGGGAACAAGGAACCCAACCCTATGGTACAACTGTCAATTCAGGATGTG
ACTCAGGAGAGCAAGGCTGTCTACAGTACCAACTGCCCAGTGTGGGAGGAAGCGTTCCGGTTCTTCCTACAAGACCCTCAAAGCCAGGAG
CTCGATGTGCAAGTGAAGGATGATTCCAGGGCCCTGACTTTAGGAGCACTGACGCTGCCTCTGGCCCGCCTGCTGACTGCCCCAGAACTC
ATCCTGGACCAGTGGTTCCAGCTCAGCAGCTCTGGTCCAAACTCCAGACTCTATATGAAACTAGTCATGAGGATCCTGTACTTGGATTCA
TCAGAAATATGCTTCCCCACGGTGCCTGGTTGTCCTGGTGCTTGGGACGTGGACAGTGAGAATCCCCAGAGAGGCAGCAGTGTGGATGCC
CCACCTCGACCCTGTCACACGACTCCTGATAGCCAGTTTGGGACTGAGCATGTGCTTCGGATCCATGTATTAGAGGCCCAGGACCTGATT
GCCAAAGACCGTTTCTTGGGGGGACTGGTGAAGGGCAAGTCAGACCCCTATGTCAAACTAAAGTTGGCAGGACGAAGCTTCCGGAGCCAT
GTTGTTCGGGAAGATCTCAATCCCCGCTGGAATGAGGTTTTTGAGGTGATCGTCACATCAGTTCCAGGCCAAGAGCTAGAGGTTGAAGTC
TTTGACAAGGACTTGGACAAGGATGATTTTCTGGGCAGGTGTAAAGTGCGTCTCACCACAGTCTTAAACAGTGGCTTCCTTGATGAGTGG
CTGACCCTGGAGGATGTCCCATCTGGCCGCCTGCACTTGCGCCTGGAGCGTCTCACCCCCCGTCCCACTGCTGCTGAGTTAGAGGAGGTG
CTGCAGGTGAATAGTTTGATCCAGACTCAGAAGAGTGCGGAGCTGGCTGCGGCCCTGCTATCCATCTATATGGAGCGGGCAGAGGACCTC
CCGCTGCGAAAAGGCACCAAGCACCTCAGCCCTTATGCTACTCTCACTGTGGGAGATAGTTCTCATAAAACCAAGACTATTTCGCAAACT
TCAGCCCCTGTCTGGGATGAGAGTGCCTCCTTTCTCATCAGGAAACCACACACTGAGAGCCTAGAGTTGCAGTTCCCTGACCAAGCAACA
CAGCTAAAATGGAATGTTCAGTTTTGCCTGACGATCCCTCCCAGCGCGCCGCCGATTGCACCTCCTGGGACGCCTGCTGTGGTGCTGAAA
TCCAAAATGCTATTTTTTCTTCAACTAACTCAGAAAACATCGGTCCCTCCCCAAGAACCTGTTAGTATTATAGTTCCAATCATTTATGAC
ATGGCTTCAGGTACAACCCAGCAGGCAGACATTCCCAGACAGCAGAACTCTTCTGTTGCTGCTCCCATGATGGTCAGCAACATTCTGAAG
AGGTTTGCAGAGATGAATCCACCACGACAAGGTGAATGCACAATATTTGCAGCTGTTCGTGATTTAATGGCTAATCTTACACTGCCCCCT

>In-frame_ESYT1_ENST00000267113_chr12_56532797_+_MED14_ENST00000324817_chrX_40514312_-_3015nt
ATGGAGCGATCTCCAGGAGAGGGCCCCAGCCCCAGCCCCATGGACCAGCCCTCTGCTCCCTCCGACCCCACTGACCAGCCCCCCGCTGCT
CACGCAAAGCCAGACCCAGGTTCTGGGGGCCAACCTGCTGGCCCTGGCGCGGCGGGTGAGGCCCTGGCGGTGCTGACTTCATTCGGGAGG
CGGTTGCTGGTGCTGATACCTGTGTATTTGGCCGGGGCAGTGGGACTCAGCGTGGGTTTCGTGCTCTTCGGCCTCGCCCTCTACCTGGGC
TGGCGCCGGGTCCGCGACGAGAAAGAACGGAGCCTTCGAGCAGCGAGGCAGCTACTGGACGACGAGGAGCAGCTCACTGCGAAAACTCTC
TATATGAGTCATCGAGAGCTACCTGCCTGGGTCAGCTTCCCAGACGTGGAAAAGGCTGAATGGCTCAATAAGATTGTGGCCCAGGTCTGG
CCCTTCCTGGGCCAGTATATGGAGAAGCTTCTGGCTGAAACTGTGGCTCCGGCTGTTAGGGGATCTAACCCCCATCTGCAAACATTTACA
TTTACACGAGTGGAACTGGGTGAAAAGCCATTGCGCATCATTGGAGTCAAGGTTCACCCAGGTCAGAGAAAAGAGCAGATCCTGCTGGAC
TTGAACATCAGCTATGTAGGTGATGTGCAGATTGATGTGGAAGTGAAGAAATATTTTTGCAAAGCAGGAGTCAAGGGCATGCAGCTACAT
GGCGTTTTGCGGGTGATACTGGAGCCACTCATTGGGGACCTTCCCTTCGTGGGGGCTGTGTCAATGTTCTTCATCCGACGCCCGACCCTA
GACATCAACTGGACAGGGATGACCAACCTGCTGGATATCCCAGGACTTAGCTCACTCTCTGACACCATGATCATGGACTCCATTGCTGCC
TTCCTCGTGTTGCCCAACCGATTACTGGTGCCCCTTGTGCCTGACCTTCAAGATGTGGCTCAGTTGCGTTCCCCTCTGCCCAGGGGCATT
ATTCGAATTCACCTGCTGGCTGCTCGAGGGCTGAGTTCCAAGGACAAATATGTGAAGGGCCTGATTGAGGGCAAGTCAGACCCATATGCA
CTTGTGCGTTTGGGTACCCAGACATTCTGCAGTCGTGTCATTGATGAAGAACTCAACCCACAGTGGGGAGAGACTTATGAGGTGATGGTA
CACGAGGTCCCAGGGCAGGAGATTGAAGTGGAGGTGTTCGACAAGGATCCAGATAAAGATGACTTTCTGGGCAGAATGAAGCTGGATGTA
GGGAAGGTGTTACAGGCTAGCGTTCTGGATGATTGGTTCCCTCTACAAGGTGGGCAAGGCCAAGTTCACTTGAGGCTAGAATGGCTGTCA
CTTTTGTCAGATGCAGAGAAACTGGAGCAGGTTCTACAGTGGAATTGGGGAGTCTCCTCTCGACCAGATCCCCCGTCAGCTGCCATCTTA
GTTGTCTACCTGGATCGGGCCCAGGATCTTCCTATGGTGACCTCTGAATTGTACCCACCACAGCTGAAGAAGGGGAACAAGGAACCCAAC
CCTATGGTACAACTGTCAATTCAGGATGTGACTCAGGAGAGCAAGGCTGTCTACAGTACCAACTGCCCAGTGTGGGAGGAAGCGTTCCGG
TTCTTCCTACAAGACCCTCAAAGCCAGGAGCTCGATGTGCAAGTGAAGGATGATTCCAGGGCCCTGACTTTAGGAGCACTGACGCTGCCT
CTGGCCCGCCTGCTGACTGCCCCAGAACTCATCCTGGACCAGTGGTTCCAGCTCAGCAGCTCTGGTCCAAACTCCAGACTCTATATGAAA
CTAGTCATGAGGATCCTGTACTTGGATTCATCAGAAATATGCTTCCCCACGGTGCCTGGTTGTCCTGGTGCTTGGGACGTGGACAGTGAG
AATCCCCAGAGAGGCAGCAGTGTGGATGCCCCACCTCGACCCTGTCACACGACTCCTGATAGCCAGTTTGGGACTGAGCATGTGCTTCGG
ATCCATGTATTAGAGGCCCAGGACCTGATTGCCAAAGACCGTTTCTTGGGGGGACTGGTGAAGGGCAAGTCAGACCCCTATGTCAAACTA
AAGTTGGCAGGACGAAGCTTCCGGAGCCATGTTGTTCGGGAAGATCTCAATCCCCGCTGGAATGAGGTTTTTGAGGTGATCGTCACATCA
GTTCCAGGCCAAGAGCTAGAGGTTGAAGTCTTTGACAAGGACTTGGACAAGGATGATTTTCTGGGCAGGTGTAAAGTGCGTCTCACCACA
GTCTTAAACAGTGGCTTCCTTGATGAGTGGCTGACCCTGGAGGATGTCCCATCTGGCCGCCTGCACTTGCGCCTGGAGCGTCTCACCCCC
CGTCCCACTGCTGCTGAGTTAGAGGAGGTGCTGCAGGTGAATAGTTTGATCCAGACTCAGAAGAGTGCGGAGCTGGCTGCGGCCCTGCTA
TCCATCTATATGGAGCGGGCAGAGGACCTCCCGCTGCGAAAAGGCACCAAGCACCTCAGCCCTTATGCTACTCTCACTGTGGGAGATAGT
TCTCATAAAACCAAGACTATTTCGCAAACTTCAGCCCCTGTCTGGGATGAGAGTGCCTCCTTTCTCATCAGGAAACCACACACTGAGAGC
CTAGAGTTGCAGTTCCCTGACCAAGCAACACAGCTAAAATGGAATGTTCAGTTTTGCCTGACGATCCCTCCCAGCGCGCCGCCGATTGCA
CCTCCTGGGACGCCTGCTGTGGTGCTGAAATCCAAAATGCTATTTTTTCTTCAACTAACTCAGAAAACATCGGTCCCTCCCCAAGAACCT
GTTAGTATTATAGTTCCAATCATTTATGACATGGCTTCAGGTACAACCCAGCAGGCAGACATTCCCAGACAGCAGAACTCTTCTGTTGCT
GCTCCCATGATGGTCAGCAACATTCTGAAGAGGTTTGCAGAGATGAATCCACCACGACAAGGTGAATGCACAATATTTGCAGCTGTTCGT

>In-frame_ESYT1_ENST00000541590_chr12_56532797_+_MED14_ENST00000324817_chrX_40514312_-_3015nt
ATGGAGCGATCTCCAGGAGAGGGCCCCAGCCCCAGCCCCATGGACCAGCCCTCTGCTCCCTCCGACCCCACTGACCAGCCCCCCGCTGCT
CACGCAAAGCCAGACCCAGGTTCTGGGGGCCAACCTGCTGGCCCTGGCGCGGCGGGTGAGGCCCTGGCGGTGCTGACTTCATTCGGGAGG
CGGTTGCTGGTGCTGATACCTGTGTATTTGGCCGGGGCAGTGGGACTCAGCGTGGGTTTCGTGCTCTTCGGCCTCGCCCTCTACCTGGGC
TGGCGCCGGGTCCGCGACGAGAAAGAACGGAGCCTTCGAGCAGCGAGGCAGCTACTGGACGACGAGGAGCAGCTCACTGCGAAAACTCTC
TATATGAGTCATCGAGAGCTACCTGCCTGGGTCAGCTTCCCAGACGTGGAAAAGGCTGAATGGCTCAATAAGATTGTGGCCCAGGTCTGG
CCCTTCCTGGGCCAGTATATGGAGAAGCTTCTGGCTGAAACTGTGGCTCCGGCTGTTAGGGGATCTAACCCCCATCTGCAAACATTTACA
TTTACACGAGTGGAACTGGGTGAAAAGCCATTGCGCATCATTGGAGTCAAGGTTCACCCAGGTCAGAGAAAAGAGCAGATCCTGCTGGAC
TTGAACATCAGCTATGTAGGTGATGTGCAGATTGATGTGGAAGTGAAGAAATATTTTTGCAAAGCAGGAGTCAAGGGCATGCAGCTACAT
GGCGTTTTGCGGGTGATACTGGAGCCACTCATTGGGGACCTTCCCTTCGTGGGGGCTGTGTCAATGTTCTTCATCCGACGCCCGACCCTA
GACATCAACTGGACAGGGATGACCAACCTGCTGGATATCCCAGGACTTAGCTCACTCTCTGACACCATGATCATGGACTCCATTGCTGCC
TTCCTCGTGTTGCCCAACCGATTACTGGTGCCCCTTGTGCCTGACCTTCAAGATGTGGCTCAGTTGCGTTCCCCTCTGCCCAGGGGCATT
ATTCGAATTCACCTGCTGGCTGCTCGAGGGCTGAGTTCCAAGGACAAATATGTGAAGGGCCTGATTGAGGGCAAGTCAGACCCATATGCA
CTTGTGCGTTTGGGTACCCAGACATTCTGCAGTCGTGTCATTGATGAAGAACTCAACCCACAGTGGGGAGAGACTTATGAGGTGATGGTA
CACGAGGTCCCAGGGCAGGAGATTGAAGTGGAGGTGTTCGACAAGGATCCAGATAAAGATGACTTTCTGGGCAGAATGAAGCTGGATGTA
GGGAAGGTGTTACAGGCTAGCGTTCTGGATGATTGGTTCCCTCTACAAGGTGGGCAAGGCCAAGTTCACTTGAGGCTAGAATGGCTGTCA
CTTTTGTCAGATGCAGAGAAACTGGAGCAGGTTCTACAGTGGAATTGGGGAGTCTCCTCTCGACCAGATCCCCCGTCAGCTGCCATCTTA
GTTGTCTACCTGGATCGGGCCCAGGATCTTCCTATGGTGACCTCTGAATTGTACCCACCACAGCTGAAGAAGGGGAACAAGGAACCCAAC
CCTATGGTACAACTGTCAATTCAGGATGTGACTCAGGAGAGCAAGGCTGTCTACAGTACCAACTGCCCAGTGTGGGAGGAAGCGTTCCGG
TTCTTCCTACAAGACCCTCAAAGCCAGGAGCTCGATGTGCAAGTGAAGGATGATTCCAGGGCCCTGACTTTAGGAGCACTGACGCTGCCT
CTGGCCCGCCTGCTGACTGCCCCAGAACTCATCCTGGACCAGTGGTTCCAGCTCAGCAGCTCTGGTCCAAACTCCAGACTCTATATGAAA
CTAGTCATGAGGATCCTGTACTTGGATTCATCAGAAATATGCTTCCCCACGGTGCCTGGTTGTCCTGGTGCTTGGGACGTGGACAGTGAG
AATCCCCAGAGAGGCAGCAGTGTGGATGCCCCACCTCGACCCTGTCACACGACTCCTGATAGCCAGTTTGGGACTGAGCATGTGCTTCGG
ATCCATGTATTAGAGGCCCAGGACCTGATTGCCAAAGACCGTTTCTTGGGGGGACTGGTGAAGGGCAAGTCAGACCCCTATGTCAAACTA
AAGTTGGCAGGACGAAGCTTCCGGAGCCATGTTGTTCGGGAAGATCTCAATCCCCGCTGGAATGAGGTTTTTGAGGTGATCGTCACATCA
GTTCCAGGCCAAGAGCTAGAGGTTGAAGTCTTTGACAAGGACTTGGACAAGGATGATTTTCTGGGCAGGTGTAAAGTGCGTCTCACCACA
GTCTTAAACAGTGGCTTCCTTGATGAGTGGCTGACCCTGGAGGATGTCCCATCTGGCCGCCTGCACTTGCGCCTGGAGCGTCTCACCCCC
CGTCCCACTGCTGCTGAGTTAGAGGAGGTGCTGCAGGTGAATAGTTTGATCCAGACTCAGAAGAGTGCGGAGCTGGCTGCGGCCCTGCTA
TCCATCTATATGGAGCGGGCAGAGGACCTCCCGCTGCGAAAAGGCACCAAGCACCTCAGCCCTTATGCTACTCTCACTGTGGGAGATAGT
TCTCATAAAACCAAGACTATTTCGCAAACTTCAGCCCCTGTCTGGGATGAGAGTGCCTCCTTTCTCATCAGGAAACCACACACTGAGAGC
CTAGAGTTGCAGTTCCCTGACCAAGCAACACAGCTAAAATGGAATGTTCAGTTTTGCCTGACGATCCCTCCCAGCGCGCCGCCGATTGCA
CCTCCTGGGACGCCTGCTGTGGTGCTGAAATCCAAAATGCTATTTTTTCTTCAACTAACTCAGAAAACATCGGTCCCTCCCCAAGAACCT
GTTAGTATTATAGTTCCAATCATTTATGACATGGCTTCAGGTACAACCCAGCAGGCAGACATTCCCAGACAGCAGAACTCTTCTGTTGCT
GCTCCCATGATGGTCAGCAACATTCTGAAGAGGTTTGCAGAGATGAATCCACCACGACAAGGTGAATGCACAATATTTGCAGCTGTTCGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ESYT1_ENST00000394048_chr12_56532797_+_MED14_ENST00000324817_chrX_40514312_-_6749nt
ATCTTGGCCTTCGGGCCCAATCAGGGAGGCCCTACCTATCCGAAACCCGGTCCGTTCCCCGCGGAAGAGGGGTGGAGTTTCAACCTTTTA
ACTCCACCTTGGTCTGTGCAGCGCGGACCAACCCAAATCGCCAGAAAGGAGGGGCGTGGCTTGAAGTCCCCTCCTCCATCCCGGGGATCA
CGTTTTGCCTGGGGGAGCTGATCGCAAGACTAGGCAACCTCCAGCCAGTCCCTGGGTCGGGCGGATCCTCCCAGAGGTGGCACAATGGAG
CGATCTCCAGGAGAGGGCCCCAGCCCCAGCCCCATGGACCAGCCCTCTGCTCCCTCCGACCCCACTGACCAGCCCCCCGCTGCTCACGCA
AAGCCAGACCCAGGTTCTGGGGGCCAACCTGCTGGCCCTGGCGCGGCGGGTGAGGCCCTGGCGGTGCTGACTTCATTCGGGAGGCGGTTG
CTGGTGCTGATACCTGTGTATTTGGCCGGGGCAGTGGGACTCAGCGTGGGTTTCGTGCTCTTCGGCCTCGCCCTCTACCTGGGCTGGCGC
CGGGTCCGCGACGAGAAAGAACGGAGCCTTCGAGCAGCGAGGCAGCTACTGGACGACGAGGAGCAGCTCACTGCGAAAACTCTCTATATG
AGTCATCGAGAGCTACCTGCCTGGGTCAGCTTCCCAGACGTGGAAAAGGCTGAATGGCTCAATAAGATTGTGGCCCAGGTCTGGCCCTTC
CTGGGCCAGTATATGGAGAAGCTTCTGGCTGAAACTGTGGCTCCGGCTGTTAGGGGATCTAACCCCCATCTGCAAACATTTACATTTACA
CGAGTGGAACTGGGTGAAAAGCCATTGCGCATCATTGGAGTCAAGGTTCACCCAGGTCAGAGAAAAGAGCAGATCCTGCTGGACTTGAAC
ATCAGCTATGTAGGTGATGTGCAGATTGATGTGGAAGTGAAGAAATATTTTTGCAAAGCAGGAGTCAAGGGCATGCAGCTACATGGCGTT
TTGCGGGTGATACTGGAGCCACTCATTGGGGACCTTCCCTTCGTGGGGGCTGTGTCAATGTTCTTCATCCGACGCCCGACCCTAGACATC
AACTGGACAGGGATGACCAACCTGCTGGATATCCCAGGACTTAGCTCACTCTCTGACACCATGATCATGGACTCCATTGCTGCCTTCCTC
GTGTTGCCCAACCGATTACTGGTGCCCCTTGTGCCTGACCTTCAAGATGTGGCTCAGTTGCGTTCCCCTCTGCCCAGGGGCATTATTCGA
ATTCACCTGCTGGCTGCTCGAGGGCTGAGTTCCAAGGACAAATATGTGAAGGGCCTGATTGAGGGCAAGTCAGACCCATATGCACTTGTG
CGTTTGGGTACCCAGACATTCTGCAGTCGTGTCATTGATGAAGAACTCAACCCACAGTGGGGAGAGACTTATGAGGTGATGGTACACGAG
GTCCCAGGGCAGGAGATTGAAGTGGAGGTGTTCGACAAGGATCCAGATAAAGATGACTTTCTGGGCAGAATGAAGCTGGATGTAGGGAAG
GTGTTACAGGCTAGCGTTCTGGATGATTGGTTCCCTCTACAAGGTGGGCAAGGCCAAGTTCACTTGAGGCTAGAATGGCTGTCACTTTTG
TCAGATGCAGAGAAACTGGAGCAGGTTCTACAGTGGAATTGGGGAGTCTCCTCTCGACCAGATCCCCCGTCAGCTGCCATCTTAGTTGTC
TACCTGGATCGGGCCCAGGATCTTCCTCTGAAGAAGGGGAACAAGGAACCCAACCCTATGGTACAACTGTCAATTCAGGATGTGACTCAG
GAGAGCAAGGCTGTCTACAGTACCAACTGCCCAGTGTGGGAGGAAGCGTTCCGGTTCTTCCTACAAGACCCTCAAAGCCAGGAGCTCGAT
GTGCAAGTGAAGGATGATTCCAGGGCCCTGACTTTAGGAGCACTGACGCTGCCTCTGGCCCGCCTGCTGACTGCCCCAGAACTCATCCTG
GACCAGTGGTTCCAGCTCAGCAGCTCTGGTCCAAACTCCAGACTCTATATGAAACTAGTCATGAGGATCCTGTACTTGGATTCATCAGAA
ATATGCTTCCCCACGGTGCCTGGTTGTCCTGGTGCTTGGGACGTGGACAGTGAGAATCCCCAGAGAGGCAGCAGTGTGGATGCCCCACCT
CGACCCTGTCACACGACTCCTGATAGCCAGTTTGGGACTGAGCATGTGCTTCGGATCCATGTATTAGAGGCCCAGGACCTGATTGCCAAA
GACCGTTTCTTGGGGGGACTGGTGAAGGGCAAGTCAGACCCCTATGTCAAACTAAAGTTGGCAGGACGAAGCTTCCGGAGCCATGTTGTT
CGGGAAGATCTCAATCCCCGCTGGAATGAGGTTTTTGAGGTGATCGTCACATCAGTTCCAGGCCAAGAGCTAGAGGTTGAAGTCTTTGAC
AAGGACTTGGACAAGGATGATTTTCTGGGCAGGTGTAAAGTGCGTCTCACCACAGTCTTAAACAGTGGCTTCCTTGATGAGTGGCTGACC
CTGGAGGATGTCCCATCTGGCCGCCTGCACTTGCGCCTGGAGCGTCTCACCCCCCGTCCCACTGCTGCTGAGTTAGAGGAGGTGCTGCAG
GTGAATAGTTTGATCCAGACTCAGAAGAGTGCGGAGCTGGCTGCGGCCCTGCTATCCATCTATATGGAGCGGGCAGAGGACCTCCCGCTG
CGAAAAGGCACCAAGCACCTCAGCCCTTATGCTACTCTCACTGTGGGAGATAGTTCTCATAAAACCAAGACTATTTCGCAAACTTCAGCC
CCTGTCTGGGATGAGAGTGCCTCCTTTCTCATCAGGAAACCACACACTGAGAGCCTAGAGTTGCAGTTCCCTGACCAAGCAACACAGCTA
AAATGGAATGTTCAGTTTTGCCTGACGATCCCTCCCAGCGCGCCGCCGATTGCACCTCCTGGGACGCCTGCTGTGGTGCTGAAATCCAAA
ATGCTATTTTTTCTTCAACTAACTCAGAAAACATCGGTCCCTCCCCAAGAACCTGTTAGTATTATAGTTCCAATCATTTATGACATGGCT
TCAGGTACAACCCAGCAGGCAGACATTCCCAGACAGCAGAACTCTTCTGTTGCTGCTCCCATGATGGTCAGCAACATTCTGAAGAGGTTT
GCAGAGATGAATCCACCACGACAAGGTGAATGCACAATATTTGCAGCTGTTCGTGATTTAATGGCTAATCTTACACTGCCCCCTGGTGGG
CGTCCATAGACACTATTGTTTTTAAACCAGGAAGGCTGACAGATGAGACAACAAAAAAAATCTGAATTCAGCCTTCAGTTTAAAAAAGGA
AAAGGACTTTTTTTTTAAACTTTAAGAGCTAAATATTCTAAACTGGCAAAAATTTTCAGGGTGCACTTCTTTCATCAAAATGATCATCCA
TCTTTTGTATAATGAACTTGTATAGTGTGTTTAAATGGGACACATTTCAAAGGAAATAAATCAGTGTCCGTTTGCCAGTAATAAATTTAA
TATTCTGTTTTATACTATAAAGTTATGAAAATGCCAAACTTGTTTATTTAATTGTTTTCTTATGTTTTGGGTGTAATAGTCCTTTTTTGG
TTTTTGTTTTGTTTTTTAAGGCAGGTCTGTCATTTTTGAATACTGTAAAACTGTGATAAACTTTATATTGAAGCTGTATTTTAATATGAC
CGCTTTGAATCCTTACATGAAATGTTCTGGGAGTTGTTATAAACACACCCCAAGGAAGCAATATTTAATAAAACTAGGTCAAAAACAAAA
CAAAACAGTGACACTCACTTGTGTGTATATAAACTCTAGAGACATCTTAGGCCCTCCCTTCATCTTTAACCTGGTGGATGGAGCCAGTTA
TTAATTTATAATAATACATGTCTGAAATTTGACCAAAAACATCTTCTTTATGTCAAGGTTAATATATTTTCTTCAGACATTCCTAACTTG
ACTAGTGGTTAACATTTAGCACCTTGGTTGTCTTTCAATATATAGGATTTGGGTGAAAAATAAGGAACTTAGTCTTTGAGAAGGGACAGT
ATGTGGTTCGTATTGATCAAGGATCCCAAATAATGCAATCATTCTCATCTGTTGAGGATGTGGGAACTTTTCTGTCAGGAAAATTTAGTT
TACAGAATACTTCTGCATACAACATTAATTAGGAAACAAAGAACTTTAATGCTGTACCTCTGCATGAAGTTTCTGTGAGCTTTCTTTATC
TTGCTTAACTTATCCTCCTTTCCTTCCCCACCAAAATTGGGATTGTTCTAAACAATTTCAATTTAATTCATTGTCAACAAAACGATAGAA
TGTTTTGCTTGGAAGAAACCTGGTCCATTCCCCTCATTGTGAAGAATCCCGAATCCTGGGCCTGTCCAGGGTCAAATGGAGTTTTTGGTA
TTAATACATCTCTGCAGGGTTTCTTTTTGGAGCACTGTGCTGTCTTTCCTAGTCAGTCAGGGACTTTTTTAAGCTTCAAAGAACATGGTC
TGATGCAAAGGTCTTCTACCGACTTCATGGTATTTAGGAAAAATTTTTAAGTGATAATACCATGCCGAGTTACCTGGTCACTGTAATACT
GGTTCTCCATTAAAATGTAGATGCTTTGTCTAATTCCACTTCAAGATGATTTAATTGAGCTTCTATAACTATCAACTATCAAATTCTAGT
TTCAAGTATCTCACTGTACCTATATCATATCTGTTCTCAACTTTGTTTGATTCTCCACTCATTTTCAATCAGAGTTGAAGCCTTCTTTGC
CTTTCTTCTTTGTCTTATTTCTGCCTTCATCTCCCACTTCTCACCCAACTCTGCCACTGTTCAGGAGCAGTTGACTAAACTTTTATCCTT
CCTTTAACTTAATCTTTTTATCCTTCTGTTTTTAGTTCTTACAGTGGTAATCACATCAGTTTGGCAATCTAAGATGTCTTTATCAAGGGT
CAGCCCTTTTCTATTTGGAGCTGAATCTTTTCTTTCATGTAGAAATCTACATGTATATACAAGAAATGTATTTTTATCTGCAGGATAATA
TTGTTTCAAATAATTTTATTAAGAGTTAACTTTTTAGGTATTTTCCCTTTTAATGTGGTTTTGAAATGTTAATTGCATTTTTACACATGA
TGCATTCAGTGGACACTCTTTTTTCCTAATTATAACTCATCTCTGAATGCATTGTGCCAATCAAGAGTAAGATAGGATTCAGTGCGCAAA
ATTTGCTTTTGATGCTTATTAAGAGTAAACCCATGAATTTGAATTTTTATATTATGCTTGGTACTTGGAATTGATATATACCTTATTAAA
GCTTGAAAACATTTAGCATTTGAATAGTAAGTTTCATCACAAATCATGTCTTTTGCCTCTTTTGTTACCCAGGTTCGATCAAGGGGACTG
GATGCCCAAGTGATTTTCTCTAATAATCGGGTTGGGACTTAACTTTAAGGTGTTTTCAATGTGATTTTAGTATTTACAGTAATAAATAAA
ATTTATACAAAGTTTCAGAGAACTACCAACTCTCTAGTTAATTTTGATGAAGATGTTTTCATTAATAGTCTGGTTTAGTATTAATTTAAC
CTTGAAATAAGAAATTGGTCCTGATTTGCCACCTTCATTTTTCCATCTGCTGAAATGCCATTTCAGAATGTATAAAAGTACTTTCAGAAT
TAGAAGAAAAGTGAGAGCTTCAGCAGAACGTGTCAAGTCGCTAATAACAGGAGTCGAACCTTATGTTTGAAAATTAACTGAGTGAGTTAA
GTGCAAGCATAAACTAAAATTTATATGACTTTGAATTTAAGAACCACTAATAACTGTGTTCTAATTAACACAGTAATCTGTTCAGCCAAA
GGATACTAACAGCCATTCTTTGGACTGTGGTTAATTTGATAACTTCAAGAAGTTATAACTTTGCTACCCTGGATTCTGATGCAATTTCAA
TATAAAAAGTTGTTCCTTTCATAGTTTTTCCCCCCAAAAGAAGTGCCTATTACATTTTACCTTAATGTTTATTTATCATCCAAGTGTTCT
TGATATAAAATCAGTATACAGAAAATTTTAAGAGAACTTACATTCAAGGGACATAGAGGGAAAATGTTAATGTGTATTTCATTGTTTCTT
GTGGAATTTTTTTTTCATTCGGTTTGAGAATGGACAGTGTGTCTAAGGATGTGATTTAAATTTACTTAGGATGGATTTAGCATTGAGGTT
ATTAAGACAAAGTTAGCAGAGGCCAGCCAGCACTGTGCTGCACAACTCCAGGAACTCCATGGTATGCTCACAATTTTCTGCAAGTTGCCT
CCACTTCCAAGTGGCCAGTGATTTGTTAAAATACCTTGCCCAAGAATATAACTGATTGATGAAAGGGCATATTTAGGTCAATATAAAATA
ATAGCAAGTATTTACTGAGAGCTTACTGTGTGCTAGGCATTTTCTTAATATTTCAATGTGTATTTAATCCTCACAACAACCCAATGTGGT
AGGTTATTGATATCCTCTTCTTAAAAATGAGTAAATGGAGGCCCAGAGAAATGTAATTTGCCTGAGATCAAATTAAGGTTGCTTAAGATC
AAACTGCTAAGAAGGGGCAGTTTGAGTCTGAGCTAGTGCTCCTAAACACTGGACATTTTTGCTGTGAACCACAGTCGGGAAGGTTTAATG

>In-frame_ESYT1_ENST00000267113_chr12_56532797_+_MED14_ENST00000324817_chrX_40514312_-_6568nt
AGGCAACCTCCAGCCAGTCCCTGGGTCGGGCGGATCCTCCCAGAGGTGGCACAATGGAGCGATCTCCAGGAGAGGGCCCCAGCCCCAGCC
CCATGGACCAGCCCTCTGCTCCCTCCGACCCCACTGACCAGCCCCCCGCTGCTCACGCAAAGCCAGACCCAGGTTCTGGGGGCCAACCTG
CTGGCCCTGGCGCGGCGGGTGAGGCCCTGGCGGTGCTGACTTCATTCGGGAGGCGGTTGCTGGTGCTGATACCTGTGTATTTGGCCGGGG
CAGTGGGACTCAGCGTGGGTTTCGTGCTCTTCGGCCTCGCCCTCTACCTGGGCTGGCGCCGGGTCCGCGACGAGAAAGAACGGAGCCTTC
GAGCAGCGAGGCAGCTACTGGACGACGAGGAGCAGCTCACTGCGAAAACTCTCTATATGAGTCATCGAGAGCTACCTGCCTGGGTCAGCT
TCCCAGACGTGGAAAAGGCTGAATGGCTCAATAAGATTGTGGCCCAGGTCTGGCCCTTCCTGGGCCAGTATATGGAGAAGCTTCTGGCTG
AAACTGTGGCTCCGGCTGTTAGGGGATCTAACCCCCATCTGCAAACATTTACATTTACACGAGTGGAACTGGGTGAAAAGCCATTGCGCA
TCATTGGAGTCAAGGTTCACCCAGGTCAGAGAAAAGAGCAGATCCTGCTGGACTTGAACATCAGCTATGTAGGTGATGTGCAGATTGATG
TGGAAGTGAAGAAATATTTTTGCAAAGCAGGAGTCAAGGGCATGCAGCTACATGGCGTTTTGCGGGTGATACTGGAGCCACTCATTGGGG
ACCTTCCCTTCGTGGGGGCTGTGTCAATGTTCTTCATCCGACGCCCGACCCTAGACATCAACTGGACAGGGATGACCAACCTGCTGGATA
TCCCAGGACTTAGCTCACTCTCTGACACCATGATCATGGACTCCATTGCTGCCTTCCTCGTGTTGCCCAACCGATTACTGGTGCCCCTTG
TGCCTGACCTTCAAGATGTGGCTCAGTTGCGTTCCCCTCTGCCCAGGGGCATTATTCGAATTCACCTGCTGGCTGCTCGAGGGCTGAGTT
CCAAGGACAAATATGTGAAGGGCCTGATTGAGGGCAAGTCAGACCCATATGCACTTGTGCGTTTGGGTACCCAGACATTCTGCAGTCGTG
TCATTGATGAAGAACTCAACCCACAGTGGGGAGAGACTTATGAGGTGATGGTACACGAGGTCCCAGGGCAGGAGATTGAAGTGGAGGTGT
TCGACAAGGATCCAGATAAAGATGACTTTCTGGGCAGAATGAAGCTGGATGTAGGGAAGGTGTTACAGGCTAGCGTTCTGGATGATTGGT
TCCCTCTACAAGGTGGGCAAGGCCAAGTTCACTTGAGGCTAGAATGGCTGTCACTTTTGTCAGATGCAGAGAAACTGGAGCAGGTTCTAC
AGTGGAATTGGGGAGTCTCCTCTCGACCAGATCCCCCGTCAGCTGCCATCTTAGTTGTCTACCTGGATCGGGCCCAGGATCTTCCTATGG
TGACCTCTGAATTGTACCCACCACAGCTGAAGAAGGGGAACAAGGAACCCAACCCTATGGTACAACTGTCAATTCAGGATGTGACTCAGG
AGAGCAAGGCTGTCTACAGTACCAACTGCCCAGTGTGGGAGGAAGCGTTCCGGTTCTTCCTACAAGACCCTCAAAGCCAGGAGCTCGATG
TGCAAGTGAAGGATGATTCCAGGGCCCTGACTTTAGGAGCACTGACGCTGCCTCTGGCCCGCCTGCTGACTGCCCCAGAACTCATCCTGG
ACCAGTGGTTCCAGCTCAGCAGCTCTGGTCCAAACTCCAGACTCTATATGAAACTAGTCATGAGGATCCTGTACTTGGATTCATCAGAAA
TATGCTTCCCCACGGTGCCTGGTTGTCCTGGTGCTTGGGACGTGGACAGTGAGAATCCCCAGAGAGGCAGCAGTGTGGATGCCCCACCTC
GACCCTGTCACACGACTCCTGATAGCCAGTTTGGGACTGAGCATGTGCTTCGGATCCATGTATTAGAGGCCCAGGACCTGATTGCCAAAG
ACCGTTTCTTGGGGGGACTGGTGAAGGGCAAGTCAGACCCCTATGTCAAACTAAAGTTGGCAGGACGAAGCTTCCGGAGCCATGTTGTTC
GGGAAGATCTCAATCCCCGCTGGAATGAGGTTTTTGAGGTGATCGTCACATCAGTTCCAGGCCAAGAGCTAGAGGTTGAAGTCTTTGACA
AGGACTTGGACAAGGATGATTTTCTGGGCAGGTGTAAAGTGCGTCTCACCACAGTCTTAAACAGTGGCTTCCTTGATGAGTGGCTGACCC
TGGAGGATGTCCCATCTGGCCGCCTGCACTTGCGCCTGGAGCGTCTCACCCCCCGTCCCACTGCTGCTGAGTTAGAGGAGGTGCTGCAGG
TGAATAGTTTGATCCAGACTCAGAAGAGTGCGGAGCTGGCTGCGGCCCTGCTATCCATCTATATGGAGCGGGCAGAGGACCTCCCGCTGC
GAAAAGGCACCAAGCACCTCAGCCCTTATGCTACTCTCACTGTGGGAGATAGTTCTCATAAAACCAAGACTATTTCGCAAACTTCAGCCC
CTGTCTGGGATGAGAGTGCCTCCTTTCTCATCAGGAAACCACACACTGAGAGCCTAGAGTTGCAGTTCCCTGACCAAGCAACACAGCTAA
AATGGAATGTTCAGTTTTGCCTGACGATCCCTCCCAGCGCGCCGCCGATTGCACCTCCTGGGACGCCTGCTGTGGTGCTGAAATCCAAAA
TGCTATTTTTTCTTCAACTAACTCAGAAAACATCGGTCCCTCCCCAAGAACCTGTTAGTATTATAGTTCCAATCATTTATGACATGGCTT
CAGGTACAACCCAGCAGGCAGACATTCCCAGACAGCAGAACTCTTCTGTTGCTGCTCCCATGATGGTCAGCAACATTCTGAAGAGGTTTG
CAGAGATGAATCCACCACGACAAGGTGAATGCACAATATTTGCAGCTGTTCGTGATTTAATGGCTAATCTTACACTGCCCCCTGGTGGGC
GTCCATAGACACTATTGTTTTTAAACCAGGAAGGCTGACAGATGAGACAACAAAAAAAATCTGAATTCAGCCTTCAGTTTAAAAAAGGAA
AAGGACTTTTTTTTTAAACTTTAAGAGCTAAATATTCTAAACTGGCAAAAATTTTCAGGGTGCACTTCTTTCATCAAAATGATCATCCAT
CTTTTGTATAATGAACTTGTATAGTGTGTTTAAATGGGACACATTTCAAAGGAAATAAATCAGTGTCCGTTTGCCAGTAATAAATTTAAT
ATTCTGTTTTATACTATAAAGTTATGAAAATGCCAAACTTGTTTATTTAATTGTTTTCTTATGTTTTGGGTGTAATAGTCCTTTTTTGGT
TTTTGTTTTGTTTTTTAAGGCAGGTCTGTCATTTTTGAATACTGTAAAACTGTGATAAACTTTATATTGAAGCTGTATTTTAATATGACC
GCTTTGAATCCTTACATGAAATGTTCTGGGAGTTGTTATAAACACACCCCAAGGAAGCAATATTTAATAAAACTAGGTCAAAAACAAAAC
AAAACAGTGACACTCACTTGTGTGTATATAAACTCTAGAGACATCTTAGGCCCTCCCTTCATCTTTAACCTGGTGGATGGAGCCAGTTAT
TAATTTATAATAATACATGTCTGAAATTTGACCAAAAACATCTTCTTTATGTCAAGGTTAATATATTTTCTTCAGACATTCCTAACTTGA
CTAGTGGTTAACATTTAGCACCTTGGTTGTCTTTCAATATATAGGATTTGGGTGAAAAATAAGGAACTTAGTCTTTGAGAAGGGACAGTA
TGTGGTTCGTATTGATCAAGGATCCCAAATAATGCAATCATTCTCATCTGTTGAGGATGTGGGAACTTTTCTGTCAGGAAAATTTAGTTT
ACAGAATACTTCTGCATACAACATTAATTAGGAAACAAAGAACTTTAATGCTGTACCTCTGCATGAAGTTTCTGTGAGCTTTCTTTATCT
TGCTTAACTTATCCTCCTTTCCTTCCCCACCAAAATTGGGATTGTTCTAAACAATTTCAATTTAATTCATTGTCAACAAAACGATAGAAT
GTTTTGCTTGGAAGAAACCTGGTCCATTCCCCTCATTGTGAAGAATCCCGAATCCTGGGCCTGTCCAGGGTCAAATGGAGTTTTTGGTAT
TAATACATCTCTGCAGGGTTTCTTTTTGGAGCACTGTGCTGTCTTTCCTAGTCAGTCAGGGACTTTTTTAAGCTTCAAAGAACATGGTCT
GATGCAAAGGTCTTCTACCGACTTCATGGTATTTAGGAAAAATTTTTAAGTGATAATACCATGCCGAGTTACCTGGTCACTGTAATACTG
GTTCTCCATTAAAATGTAGATGCTTTGTCTAATTCCACTTCAAGATGATTTAATTGAGCTTCTATAACTATCAACTATCAAATTCTAGTT
TCAAGTATCTCACTGTACCTATATCATATCTGTTCTCAACTTTGTTTGATTCTCCACTCATTTTCAATCAGAGTTGAAGCCTTCTTTGCC
TTTCTTCTTTGTCTTATTTCTGCCTTCATCTCCCACTTCTCACCCAACTCTGCCACTGTTCAGGAGCAGTTGACTAAACTTTTATCCTTC
CTTTAACTTAATCTTTTTATCCTTCTGTTTTTAGTTCTTACAGTGGTAATCACATCAGTTTGGCAATCTAAGATGTCTTTATCAAGGGTC
AGCCCTTTTCTATTTGGAGCTGAATCTTTTCTTTCATGTAGAAATCTACATGTATATACAAGAAATGTATTTTTATCTGCAGGATAATAT
TGTTTCAAATAATTTTATTAAGAGTTAACTTTTTAGGTATTTTCCCTTTTAATGTGGTTTTGAAATGTTAATTGCATTTTTACACATGAT
GCATTCAGTGGACACTCTTTTTTCCTAATTATAACTCATCTCTGAATGCATTGTGCCAATCAAGAGTAAGATAGGATTCAGTGCGCAAAA
TTTGCTTTTGATGCTTATTAAGAGTAAACCCATGAATTTGAATTTTTATATTATGCTTGGTACTTGGAATTGATATATACCTTATTAAAG
CTTGAAAACATTTAGCATTTGAATAGTAAGTTTCATCACAAATCATGTCTTTTGCCTCTTTTGTTACCCAGGTTCGATCAAGGGGACTGG
ATGCCCAAGTGATTTTCTCTAATAATCGGGTTGGGACTTAACTTTAAGGTGTTTTCAATGTGATTTTAGTATTTACAGTAATAAATAAAA
TTTATACAAAGTTTCAGAGAACTACCAACTCTCTAGTTAATTTTGATGAAGATGTTTTCATTAATAGTCTGGTTTAGTATTAATTTAACC
TTGAAATAAGAAATTGGTCCTGATTTGCCACCTTCATTTTTCCATCTGCTGAAATGCCATTTCAGAATGTATAAAAGTACTTTCAGAATT
AGAAGAAAAGTGAGAGCTTCAGCAGAACGTGTCAAGTCGCTAATAACAGGAGTCGAACCTTATGTTTGAAAATTAACTGAGTGAGTTAAG
TGCAAGCATAAACTAAAATTTATATGACTTTGAATTTAAGAACCACTAATAACTGTGTTCTAATTAACACAGTAATCTGTTCAGCCAAAG
GATACTAACAGCCATTCTTTGGACTGTGGTTAATTTGATAACTTCAAGAAGTTATAACTTTGCTACCCTGGATTCTGATGCAATTTCAAT
ATAAAAAGTTGTTCCTTTCATAGTTTTTCCCCCCAAAAGAAGTGCCTATTACATTTTACCTTAATGTTTATTTATCATCCAAGTGTTCTT
GATATAAAATCAGTATACAGAAAATTTTAAGAGAACTTACATTCAAGGGACATAGAGGGAAAATGTTAATGTGTATTTCATTGTTTCTTG
TGGAATTTTTTTTTCATTCGGTTTGAGAATGGACAGTGTGTCTAAGGATGTGATTTAAATTTACTTAGGATGGATTTAGCATTGAGGTTA
TTAAGACAAAGTTAGCAGAGGCCAGCCAGCACTGTGCTGCACAACTCCAGGAACTCCATGGTATGCTCACAATTTTCTGCAAGTTGCCTC
CACTTCCAAGTGGCCAGTGATTTGTTAAAATACCTTGCCCAAGAATATAACTGATTGATGAAAGGGCATATTTAGGTCAATATAAAATAA
TAGCAAGTATTTACTGAGAGCTTACTGTGTGCTAGGCATTTTCTTAATATTTCAATGTGTATTTAATCCTCACAACAACCCAATGTGGTA
GGTTATTGATATCCTCTTCTTAAAAATGAGTAAATGGAGGCCCAGAGAAATGTAATTTGCCTGAGATCAAATTAAGGTTGCTTAAGATCA
AACTGCTAAGAAGGGGCAGTTTGAGTCTGAGCTAGTGCTCCTAAACACTGGACATTTTTGCTGTGAACCACAGTCGGGAAGGTTTAATGT

>In-frame_ESYT1_ENST00000541590_chr12_56532797_+_MED14_ENST00000324817_chrX_40514312_-_6568nt
AGGCAACCTCCAGCCAGTCCCTGGGTCGGGCGGATCCTCCCAGAGGTGGCACAATGGAGCGATCTCCAGGAGAGGGCCCCAGCCCCAGCC
CCATGGACCAGCCCTCTGCTCCCTCCGACCCCACTGACCAGCCCCCCGCTGCTCACGCAAAGCCAGACCCAGGTTCTGGGGGCCAACCTG
CTGGCCCTGGCGCGGCGGGTGAGGCCCTGGCGGTGCTGACTTCATTCGGGAGGCGGTTGCTGGTGCTGATACCTGTGTATTTGGCCGGGG
CAGTGGGACTCAGCGTGGGTTTCGTGCTCTTCGGCCTCGCCCTCTACCTGGGCTGGCGCCGGGTCCGCGACGAGAAAGAACGGAGCCTTC
GAGCAGCGAGGCAGCTACTGGACGACGAGGAGCAGCTCACTGCGAAAACTCTCTATATGAGTCATCGAGAGCTACCTGCCTGGGTCAGCT
TCCCAGACGTGGAAAAGGCTGAATGGCTCAATAAGATTGTGGCCCAGGTCTGGCCCTTCCTGGGCCAGTATATGGAGAAGCTTCTGGCTG
AAACTGTGGCTCCGGCTGTTAGGGGATCTAACCCCCATCTGCAAACATTTACATTTACACGAGTGGAACTGGGTGAAAAGCCATTGCGCA
TCATTGGAGTCAAGGTTCACCCAGGTCAGAGAAAAGAGCAGATCCTGCTGGACTTGAACATCAGCTATGTAGGTGATGTGCAGATTGATG
TGGAAGTGAAGAAATATTTTTGCAAAGCAGGAGTCAAGGGCATGCAGCTACATGGCGTTTTGCGGGTGATACTGGAGCCACTCATTGGGG
ACCTTCCCTTCGTGGGGGCTGTGTCAATGTTCTTCATCCGACGCCCGACCCTAGACATCAACTGGACAGGGATGACCAACCTGCTGGATA
TCCCAGGACTTAGCTCACTCTCTGACACCATGATCATGGACTCCATTGCTGCCTTCCTCGTGTTGCCCAACCGATTACTGGTGCCCCTTG
TGCCTGACCTTCAAGATGTGGCTCAGTTGCGTTCCCCTCTGCCCAGGGGCATTATTCGAATTCACCTGCTGGCTGCTCGAGGGCTGAGTT
CCAAGGACAAATATGTGAAGGGCCTGATTGAGGGCAAGTCAGACCCATATGCACTTGTGCGTTTGGGTACCCAGACATTCTGCAGTCGTG
TCATTGATGAAGAACTCAACCCACAGTGGGGAGAGACTTATGAGGTGATGGTACACGAGGTCCCAGGGCAGGAGATTGAAGTGGAGGTGT
TCGACAAGGATCCAGATAAAGATGACTTTCTGGGCAGAATGAAGCTGGATGTAGGGAAGGTGTTACAGGCTAGCGTTCTGGATGATTGGT
TCCCTCTACAAGGTGGGCAAGGCCAAGTTCACTTGAGGCTAGAATGGCTGTCACTTTTGTCAGATGCAGAGAAACTGGAGCAGGTTCTAC
AGTGGAATTGGGGAGTCTCCTCTCGACCAGATCCCCCGTCAGCTGCCATCTTAGTTGTCTACCTGGATCGGGCCCAGGATCTTCCTATGG
TGACCTCTGAATTGTACCCACCACAGCTGAAGAAGGGGAACAAGGAACCCAACCCTATGGTACAACTGTCAATTCAGGATGTGACTCAGG
AGAGCAAGGCTGTCTACAGTACCAACTGCCCAGTGTGGGAGGAAGCGTTCCGGTTCTTCCTACAAGACCCTCAAAGCCAGGAGCTCGATG
TGCAAGTGAAGGATGATTCCAGGGCCCTGACTTTAGGAGCACTGACGCTGCCTCTGGCCCGCCTGCTGACTGCCCCAGAACTCATCCTGG
ACCAGTGGTTCCAGCTCAGCAGCTCTGGTCCAAACTCCAGACTCTATATGAAACTAGTCATGAGGATCCTGTACTTGGATTCATCAGAAA
TATGCTTCCCCACGGTGCCTGGTTGTCCTGGTGCTTGGGACGTGGACAGTGAGAATCCCCAGAGAGGCAGCAGTGTGGATGCCCCACCTC
GACCCTGTCACACGACTCCTGATAGCCAGTTTGGGACTGAGCATGTGCTTCGGATCCATGTATTAGAGGCCCAGGACCTGATTGCCAAAG
ACCGTTTCTTGGGGGGACTGGTGAAGGGCAAGTCAGACCCCTATGTCAAACTAAAGTTGGCAGGACGAAGCTTCCGGAGCCATGTTGTTC
GGGAAGATCTCAATCCCCGCTGGAATGAGGTTTTTGAGGTGATCGTCACATCAGTTCCAGGCCAAGAGCTAGAGGTTGAAGTCTTTGACA
AGGACTTGGACAAGGATGATTTTCTGGGCAGGTGTAAAGTGCGTCTCACCACAGTCTTAAACAGTGGCTTCCTTGATGAGTGGCTGACCC
TGGAGGATGTCCCATCTGGCCGCCTGCACTTGCGCCTGGAGCGTCTCACCCCCCGTCCCACTGCTGCTGAGTTAGAGGAGGTGCTGCAGG
TGAATAGTTTGATCCAGACTCAGAAGAGTGCGGAGCTGGCTGCGGCCCTGCTATCCATCTATATGGAGCGGGCAGAGGACCTCCCGCTGC
GAAAAGGCACCAAGCACCTCAGCCCTTATGCTACTCTCACTGTGGGAGATAGTTCTCATAAAACCAAGACTATTTCGCAAACTTCAGCCC
CTGTCTGGGATGAGAGTGCCTCCTTTCTCATCAGGAAACCACACACTGAGAGCCTAGAGTTGCAGTTCCCTGACCAAGCAACACAGCTAA
AATGGAATGTTCAGTTTTGCCTGACGATCCCTCCCAGCGCGCCGCCGATTGCACCTCCTGGGACGCCTGCTGTGGTGCTGAAATCCAAAA
TGCTATTTTTTCTTCAACTAACTCAGAAAACATCGGTCCCTCCCCAAGAACCTGTTAGTATTATAGTTCCAATCATTTATGACATGGCTT
CAGGTACAACCCAGCAGGCAGACATTCCCAGACAGCAGAACTCTTCTGTTGCTGCTCCCATGATGGTCAGCAACATTCTGAAGAGGTTTG
CAGAGATGAATCCACCACGACAAGGTGAATGCACAATATTTGCAGCTGTTCGTGATTTAATGGCTAATCTTACACTGCCCCCTGGTGGGC
GTCCATAGACACTATTGTTTTTAAACCAGGAAGGCTGACAGATGAGACAACAAAAAAAATCTGAATTCAGCCTTCAGTTTAAAAAAGGAA
AAGGACTTTTTTTTTAAACTTTAAGAGCTAAATATTCTAAACTGGCAAAAATTTTCAGGGTGCACTTCTTTCATCAAAATGATCATCCAT
CTTTTGTATAATGAACTTGTATAGTGTGTTTAAATGGGACACATTTCAAAGGAAATAAATCAGTGTCCGTTTGCCAGTAATAAATTTAAT
ATTCTGTTTTATACTATAAAGTTATGAAAATGCCAAACTTGTTTATTTAATTGTTTTCTTATGTTTTGGGTGTAATAGTCCTTTTTTGGT
TTTTGTTTTGTTTTTTAAGGCAGGTCTGTCATTTTTGAATACTGTAAAACTGTGATAAACTTTATATTGAAGCTGTATTTTAATATGACC
GCTTTGAATCCTTACATGAAATGTTCTGGGAGTTGTTATAAACACACCCCAAGGAAGCAATATTTAATAAAACTAGGTCAAAAACAAAAC
AAAACAGTGACACTCACTTGTGTGTATATAAACTCTAGAGACATCTTAGGCCCTCCCTTCATCTTTAACCTGGTGGATGGAGCCAGTTAT
TAATTTATAATAATACATGTCTGAAATTTGACCAAAAACATCTTCTTTATGTCAAGGTTAATATATTTTCTTCAGACATTCCTAACTTGA
CTAGTGGTTAACATTTAGCACCTTGGTTGTCTTTCAATATATAGGATTTGGGTGAAAAATAAGGAACTTAGTCTTTGAGAAGGGACAGTA
TGTGGTTCGTATTGATCAAGGATCCCAAATAATGCAATCATTCTCATCTGTTGAGGATGTGGGAACTTTTCTGTCAGGAAAATTTAGTTT
ACAGAATACTTCTGCATACAACATTAATTAGGAAACAAAGAACTTTAATGCTGTACCTCTGCATGAAGTTTCTGTGAGCTTTCTTTATCT
TGCTTAACTTATCCTCCTTTCCTTCCCCACCAAAATTGGGATTGTTCTAAACAATTTCAATTTAATTCATTGTCAACAAAACGATAGAAT
GTTTTGCTTGGAAGAAACCTGGTCCATTCCCCTCATTGTGAAGAATCCCGAATCCTGGGCCTGTCCAGGGTCAAATGGAGTTTTTGGTAT
TAATACATCTCTGCAGGGTTTCTTTTTGGAGCACTGTGCTGTCTTTCCTAGTCAGTCAGGGACTTTTTTAAGCTTCAAAGAACATGGTCT
GATGCAAAGGTCTTCTACCGACTTCATGGTATTTAGGAAAAATTTTTAAGTGATAATACCATGCCGAGTTACCTGGTCACTGTAATACTG
GTTCTCCATTAAAATGTAGATGCTTTGTCTAATTCCACTTCAAGATGATTTAATTGAGCTTCTATAACTATCAACTATCAAATTCTAGTT
TCAAGTATCTCACTGTACCTATATCATATCTGTTCTCAACTTTGTTTGATTCTCCACTCATTTTCAATCAGAGTTGAAGCCTTCTTTGCC
TTTCTTCTTTGTCTTATTTCTGCCTTCATCTCCCACTTCTCACCCAACTCTGCCACTGTTCAGGAGCAGTTGACTAAACTTTTATCCTTC
CTTTAACTTAATCTTTTTATCCTTCTGTTTTTAGTTCTTACAGTGGTAATCACATCAGTTTGGCAATCTAAGATGTCTTTATCAAGGGTC
AGCCCTTTTCTATTTGGAGCTGAATCTTTTCTTTCATGTAGAAATCTACATGTATATACAAGAAATGTATTTTTATCTGCAGGATAATAT
TGTTTCAAATAATTTTATTAAGAGTTAACTTTTTAGGTATTTTCCCTTTTAATGTGGTTTTGAAATGTTAATTGCATTTTTACACATGAT
GCATTCAGTGGACACTCTTTTTTCCTAATTATAACTCATCTCTGAATGCATTGTGCCAATCAAGAGTAAGATAGGATTCAGTGCGCAAAA
TTTGCTTTTGATGCTTATTAAGAGTAAACCCATGAATTTGAATTTTTATATTATGCTTGGTACTTGGAATTGATATATACCTTATTAAAG
CTTGAAAACATTTAGCATTTGAATAGTAAGTTTCATCACAAATCATGTCTTTTGCCTCTTTTGTTACCCAGGTTCGATCAAGGGGACTGG
ATGCCCAAGTGATTTTCTCTAATAATCGGGTTGGGACTTAACTTTAAGGTGTTTTCAATGTGATTTTAGTATTTACAGTAATAAATAAAA
TTTATACAAAGTTTCAGAGAACTACCAACTCTCTAGTTAATTTTGATGAAGATGTTTTCATTAATAGTCTGGTTTAGTATTAATTTAACC
TTGAAATAAGAAATTGGTCCTGATTTGCCACCTTCATTTTTCCATCTGCTGAAATGCCATTTCAGAATGTATAAAAGTACTTTCAGAATT
AGAAGAAAAGTGAGAGCTTCAGCAGAACGTGTCAAGTCGCTAATAACAGGAGTCGAACCTTATGTTTGAAAATTAACTGAGTGAGTTAAG
TGCAAGCATAAACTAAAATTTATATGACTTTGAATTTAAGAACCACTAATAACTGTGTTCTAATTAACACAGTAATCTGTTCAGCCAAAG
GATACTAACAGCCATTCTTTGGACTGTGGTTAATTTGATAACTTCAAGAAGTTATAACTTTGCTACCCTGGATTCTGATGCAATTTCAAT
ATAAAAAGTTGTTCCTTTCATAGTTTTTCCCCCCAAAAGAAGTGCCTATTACATTTTACCTTAATGTTTATTTATCATCCAAGTGTTCTT
GATATAAAATCAGTATACAGAAAATTTTAAGAGAACTTACATTCAAGGGACATAGAGGGAAAATGTTAATGTGTATTTCATTGTTTCTTG
TGGAATTTTTTTTTCATTCGGTTTGAGAATGGACAGTGTGTCTAAGGATGTGATTTAAATTTACTTAGGATGGATTTAGCATTGAGGTTA
TTAAGACAAAGTTAGCAGAGGCCAGCCAGCACTGTGCTGCACAACTCCAGGAACTCCATGGTATGCTCACAATTTTCTGCAAGTTGCCTC
CACTTCCAAGTGGCCAGTGATTTGTTAAAATACCTTGCCCAAGAATATAACTGATTGATGAAAGGGCATATTTAGGTCAATATAAAATAA
TAGCAAGTATTTACTGAGAGCTTACTGTGTGCTAGGCATTTTCTTAATATTTCAATGTGTATTTAATCCTCACAACAACCCAATGTGGTA
GGTTATTGATATCCTCTTCTTAAAAATGAGTAAATGGAGGCCCAGAGAAATGTAATTTGCCTGAGATCAAATTAAGGTTGCTTAAGATCA
AACTGCTAAGAAGGGGCAGTTTGAGTCTGAGCTAGTGCTCCTAAACACTGGACATTTTTGCTGTGAACCACAGTCGGGAAGGTTTAATGT


Top

FusionGenePPI for ESYT1_MED14


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ESYT1CDK2, MYH10, SFXN3, VCAM1, FN1, ITGA4, CFTR, RPA3, RPA2, RPA1, MDM2, DERL1, DERL2, SYNJ2BP, ESYT2, ARL6IP5, YIF1B, FAF2, EDEM1, SCGN, BTN2A1, TREML2, NTRK1, NUP35, TCTN2, TCTN3, EVC2, TMEM17, TMEM216, ATL3, FOXL1, RHOU, U2AF2, CDH1, TSPAN11, UGT1A9, KCNC4, HCCS, COMT, RDH11, DCAKD, TMX1, GBA, NCDNMED14MED10, MED9, MED29, MED19, MED28, MED26, PPARGC1A, NR3C1, CDK8, MED21, MED6, VDR, HNF4A, STAT2, ESR1, ESR2, MED1, BRD4, GATA1, PARP1, TRRAP, SREBF1, MED12, MED18, ZC3H13, OBFC1, QKI, TADA2A, MED25, MED15, TRA, MED23, MED7, MED24, CRSP5, MED17, MED27, ACTN1, ACTN2, DCTN1, UACA, NECAB2, CTDP1, MED16, MED4, MED13, MED8, MED11, PPP6R1, FBXW7, EPAS1, PPARG, CDK19, HECW2, CCNC, NR1I3, TCL1B, HIF1A, UNK, NTRK1, ACTL6B, MED20, KIF11, LAMB3, POLR2G, SUPT5H, EMC2, BIRC5, LMO2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneMED14chr12:56532797chrX:40514312ENST00000324817-2731500_82413241455SREBF1
TgeneMED14chr12:56532797chrX:40514312ENST00000324817-2731188_56613241455STAT2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ESYT1_MED14


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ESYT1_MED14


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneMED14C0014175Endometriosis1CTD_human