FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12109

FusionGeneSummary for ESRRG_ACBD3

check button Fusion gene summary
Fusion gene informationFusion gene name: ESRRG_ACBD3
Fusion gene ID: 12109
HgeneTgene
Gene symbol

ESRRG

ACBD3

Gene ID

2104

64746

Gene nameestrogen related receptor gammaacyl-CoA binding domain containing 3
SynonymsERR-gamma|ERR3|ERRg|ERRgamma|NR3B3GCP60|GOCAP1|GOLPH1|PAP7
Cytomap

1q41

1q42.12

Type of geneprotein-codingprotein-coding
Descriptionestrogen-related receptor gammaERR gamma-2estrogen receptor-related protein 3nuclear receptor subfamily 3 group B member 3Golgi resident protein GCP60PBR- and PKA-associated protein 7PKA (RIalpha)-associated proteinacyl-Coenzyme A binding domain containing 3golgi complex associated protein 1, 60kDagolgi phosphoprotein 1peripheral benzodiazepine receptor-associated prot
Modification date2018051920180519
UniProtAcc

P62508

Q9H3P7

Ensembl transtripts involved in fusion geneENST00000361525, ENST00000366940, 
ENST00000361395, ENST00000366938, 
ENST00000359162, ENST00000493603, 
ENST00000463665, ENST00000487276, 
ENST00000493748, ENST00000471371, 
ENST00000391890, ENST00000366937, 
ENST00000408911, ENST00000360012, 
ENST00000366812, ENST00000464927, 
Fusion gene scores* DoF score4 X 4 X 2=323 X 3 X 3=27
# samples 43
** MAII scorelog2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ESRRG [Title/Abstract] AND ACBD3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneESRRG

GO:0006355

regulation of transcription, DNA-templated

23836911


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-B6-A0IQ-01AESRRGchr1

216850418

-ACBD3chr1

226353701

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000361525ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
5CDS-intronENST00000361525ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-
Frame-shiftENST00000366940ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
5CDS-intronENST00000366940ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-
In-frameENST00000361395ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
5CDS-intronENST00000361395ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-
Frame-shiftENST00000366938ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
5CDS-intronENST00000366938ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-
Frame-shiftENST00000359162ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
5CDS-intronENST00000359162ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-
Frame-shiftENST00000493603ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
5CDS-intronENST00000493603ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-
Frame-shiftENST00000463665ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
5CDS-intronENST00000463665ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-
Frame-shiftENST00000487276ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
5CDS-intronENST00000487276ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-
In-frameENST00000493748ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
5CDS-intronENST00000493748ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-
intron-3CDSENST00000471371ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
intron-intronENST00000471371ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-
Frame-shiftENST00000391890ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
5CDS-intronENST00000391890ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-
Frame-shiftENST00000366937ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
5CDS-intronENST00000366937ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-
In-frameENST00000408911ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
5CDS-intronENST00000408911ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-
Frame-shiftENST00000360012ENST00000366812ESRRGchr1

216850418

-ACBD3chr1

226353701

-
5CDS-intronENST00000360012ENST00000464927ESRRGchr1

216850418

-ACBD3chr1

226353701

-

Top

FusionProtFeatures for ESRRG_ACBD3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ESRRG

P62508

ACBD3

Q9H3P7

Involved in the maintenance of Golgi structure byinteracting with giantin, affecting protein transport between theendoplasmic reticulum and Golgi (PubMed:11590181). Involved inhormone-induced steroid biosynthesis in testicular Leydig cells(By similarity). Recruits PI4KB to the Golgi apparatus membrane;enhances the enzyme activity of PI4KB activity via its membranerecruitment thereby increasing the local concentration of thesubstrate in the vicinity of the kinase (PubMed:27009356).{ECO:0000250|UniProtKB:Q8BMP6, ECO:0000269|PubMed:11590181,ECO:0000269|PubMed:27009356}. (Microbial infection) Sensitizes PI4KB activation byKobuviral (Aichi) 3A protein. {ECO:0000269|PubMed:27989622}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ESRRG_ACBD3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ESRRG_ENST00000361395_chr1_216850418_-_ACBD3_ENST00000366812_chr1_226353701_-_568aa
MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQ
TKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGND
RRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKEEEKRRREEEERLRREEEERRR
IEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSS
KVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHE
EGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGR

>In-frame_ESRRG_ENST00000493748_chr1_216850418_-_ACBD3_ENST00000366812_chr1_226353701_-_568aa
MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQ
TKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGND
RRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKEEEKRRREEEERLRREEEERRR
IEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSS
KVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHE
EGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGR

>In-frame_ESRRG_ENST00000408911_chr1_216850418_-_ACBD3_ENST00000366812_chr1_226353701_-_591aa
MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPI
LGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQEKDGKAFHPTYEEKLKLVALHKQ
VLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQ
KEEEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLA
QQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQ
QDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ESRRG_ENST00000361395_chr1_216850418_-_ACBD3_ENST00000366812_chr1_226353701_-_1704nt
ATGTCAAACAAAGATCGACACATTGATTCCAGCTGTTCGTCCTTCATCAAGACGGAACCTTCCAGCCCAGCCTCCCTGACGGACAGCGTC
AACCACCACAGCCCTGGTGGCTCTTCAGACGCCAGTGGGAGCTACAGTTCAACCATGAATGGCCATCAGAACGGACTTGACTCGCCACCT
CTCTACCCTTCTGCTCCTATCCTGGGAGGTAGTGGGCCTGTCAGGAAACTGTATGATGACTGCTCCAGCACCATTGTTGAAGATCCCCAG
ACCAAGTGTGAATACATGCTCAACTCGATGCCCAAGAGACTGTGTTTAGTGTGTGGTGACATCGCTTCTGGGTACCACTATGGGGTAGCA
TCATGTGAAGCCTGCAAGGCATTCTTCAAGAGGACAATTCAAGAAAAAGATGGCAAAGCATTTCATCCAACTTATGAAGAAAAATTGAAG
CTTGTGGCACTGCATAAGCAAGTTCTTATGGGCCCATATAATCCAGACACTTGTCCTGAGGTTGGATTCTTTGATGTGTTGGGGAATGAC
AGGAGGAGAGAATGGGCAGCCCTGGGAAACATGTCTAAAGAGGATGCCATGGTGGAGTTTGTCAAGCTCTTAAATAGGTGTTGCCATCTC
TTTTCAACATATGTTGCGTCCCACAAAATAGAGAAGGAAGAGCAAGAAAAAAAAAGGAAGGAGGAAGAGGAGCGAAGGCGGCGTGAAGAG
GAAGAAAGAGAACGTCTGCAAAAGGAGGAAGAGAAACGTAGGAGAGAAGAAGAGGAAAGGCTTCGACGGGAGGAAGAGGAAAGGAGACGG
ATAGAAGAAGAAAGGCTTCGGTTGGAGCAGCAAAAGCAGCAGATAATGGCAGCTTTAAACTCCCAGACTGCCGTGCAGTTCCAGCAGTAT
GCAGCCCAACAGTATCCAGGGAACTACGAACAGCAGCAAATTCTCATCCGCCAGTTGCAGGAGCAACACTATCAGCAGTACATGCAGCAG
TTGTATCAAGTCCAGCTTGCACAGCAACAGGCAGCATTACAGAAACAACAGGAAGTAGTAGTGGCTGGGTCTTCCTTGCCTACATCATCA
AAAGTGAATGCAACTGTACCAAGTAATATGATGTCAGTTAATGGACAGGCCAAAACACACACTGACAGCTCCGAAAAAGAACTGGAACCA
GAAGCTGCAGAAGAAGCCCTGGAGAATGGACCAAAAGAATCTCTTCCAGTAATAGCAGCTCCATCCATGTGGACACGACCTCAGATCAAA
GACTTCAAAGAGAAGATTCAGCAGGATGCAGATTCCGTGATTACAGTGGGCCGAGGAGAAGTGGTCACTGTTCGAGTACCCACCCATGAA
GAAGGATCATATCTCTTTTGGGAATTTGCCACAGACAATTATGACATTGGGTTTGGGGTGTATTTTGAATGGACAGACTCTCCAAACACT
GCTGTCAGCGTGCATGTCAGTGAGTCCAGCGATGACGACGAGGAGGAAGAAGAAAACATCGGTTGTGAAGAGAAAGCCAAAAAGAATGCC
AACAAGCCTTTGCTGGATGAGATTGTGCCTGTGTACCGACGGGACTGTCATGAGGAGGTGTATGCTGGCAGCCATCAATATCCAGGGAGA

>In-frame_ESRRG_ENST00000493748_chr1_216850418_-_ACBD3_ENST00000366812_chr1_226353701_-_1704nt
ATGTCAAACAAAGATCGACACATTGATTCCAGCTGTTCGTCCTTCATCAAGACGGAACCTTCCAGCCCAGCCTCCCTGACGGACAGCGTC
AACCACCACAGCCCTGGTGGCTCTTCAGACGCCAGTGGGAGCTACAGTTCAACCATGAATGGCCATCAGAACGGACTTGACTCGCCACCT
CTCTACCCTTCTGCTCCTATCCTGGGAGGTAGTGGGCCTGTCAGGAAACTGTATGATGACTGCTCCAGCACCATTGTTGAAGATCCCCAG
ACCAAGTGTGAATACATGCTCAACTCGATGCCCAAGAGACTGTGTTTAGTGTGTGGTGACATCGCTTCTGGGTACCACTATGGGGTAGCA
TCATGTGAAGCCTGCAAGGCATTCTTCAAGAGGACAATTCAAGAAAAAGATGGCAAAGCATTTCATCCAACTTATGAAGAAAAATTGAAG
CTTGTGGCACTGCATAAGCAAGTTCTTATGGGCCCATATAATCCAGACACTTGTCCTGAGGTTGGATTCTTTGATGTGTTGGGGAATGAC
AGGAGGAGAGAATGGGCAGCCCTGGGAAACATGTCTAAAGAGGATGCCATGGTGGAGTTTGTCAAGCTCTTAAATAGGTGTTGCCATCTC
TTTTCAACATATGTTGCGTCCCACAAAATAGAGAAGGAAGAGCAAGAAAAAAAAAGGAAGGAGGAAGAGGAGCGAAGGCGGCGTGAAGAG
GAAGAAAGAGAACGTCTGCAAAAGGAGGAAGAGAAACGTAGGAGAGAAGAAGAGGAAAGGCTTCGACGGGAGGAAGAGGAAAGGAGACGG
ATAGAAGAAGAAAGGCTTCGGTTGGAGCAGCAAAAGCAGCAGATAATGGCAGCTTTAAACTCCCAGACTGCCGTGCAGTTCCAGCAGTAT
GCAGCCCAACAGTATCCAGGGAACTACGAACAGCAGCAAATTCTCATCCGCCAGTTGCAGGAGCAACACTATCAGCAGTACATGCAGCAG
TTGTATCAAGTCCAGCTTGCACAGCAACAGGCAGCATTACAGAAACAACAGGAAGTAGTAGTGGCTGGGTCTTCCTTGCCTACATCATCA
AAAGTGAATGCAACTGTACCAAGTAATATGATGTCAGTTAATGGACAGGCCAAAACACACACTGACAGCTCCGAAAAAGAACTGGAACCA
GAAGCTGCAGAAGAAGCCCTGGAGAATGGACCAAAAGAATCTCTTCCAGTAATAGCAGCTCCATCCATGTGGACACGACCTCAGATCAAA
GACTTCAAAGAGAAGATTCAGCAGGATGCAGATTCCGTGATTACAGTGGGCCGAGGAGAAGTGGTCACTGTTCGAGTACCCACCCATGAA
GAAGGATCATATCTCTTTTGGGAATTTGCCACAGACAATTATGACATTGGGTTTGGGGTGTATTTTGAATGGACAGACTCTCCAAACACT
GCTGTCAGCGTGCATGTCAGTGAGTCCAGCGATGACGACGAGGAGGAAGAAGAAAACATCGGTTGTGAAGAGAAAGCCAAAAAGAATGCC
AACAAGCCTTTGCTGGATGAGATTGTGCCTGTGTACCGACGGGACTGTCATGAGGAGGTGTATGCTGGCAGCCATCAATATCCAGGGAGA

>In-frame_ESRRG_ENST00000408911_chr1_216850418_-_ACBD3_ENST00000366812_chr1_226353701_-_1773nt
ATGGATTCGGTAGAACTTTGCCTTCCTGAATCTTTTTCCCTGCACTACGAGGAAGAGCTTCTCTGCAGAATGTCAAACAAAGATCGACAC
ATTGATTCCAGCTGTTCGTCCTTCATCAAGACGGAACCTTCCAGCCCAGCCTCCCTGACGGACAGCGTCAACCACCACAGCCCTGGTGGC
TCTTCAGACGCCAGTGGGAGCTACAGTTCAACCATGAATGGCCATCAGAACGGACTTGACTCGCCACCTCTCTACCCTTCTGCTCCTATC
CTGGGAGGTAGTGGGCCTGTCAGGAAACTGTATGATGACTGCTCCAGCACCATTGTTGAAGATCCCCAGACCAAGTGTGAATACATGCTC
AACTCGATGCCCAAGAGACTGTGTTTAGTGTGTGGTGACATCGCTTCTGGGTACCACTATGGGGTAGCATCATGTGAAGCCTGCAAGGCA
TTCTTCAAGAGGACAATTCAAGAAAAAGATGGCAAAGCATTTCATCCAACTTATGAAGAAAAATTGAAGCTTGTGGCACTGCATAAGCAA
GTTCTTATGGGCCCATATAATCCAGACACTTGTCCTGAGGTTGGATTCTTTGATGTGTTGGGGAATGACAGGAGGAGAGAATGGGCAGCC
CTGGGAAACATGTCTAAAGAGGATGCCATGGTGGAGTTTGTCAAGCTCTTAAATAGGTGTTGCCATCTCTTTTCAACATATGTTGCGTCC
CACAAAATAGAGAAGGAAGAGCAAGAAAAAAAAAGGAAGGAGGAAGAGGAGCGAAGGCGGCGTGAAGAGGAAGAAAGAGAACGTCTGCAA
AAGGAGGAAGAGAAACGTAGGAGAGAAGAAGAGGAAAGGCTTCGACGGGAGGAAGAGGAAAGGAGACGGATAGAAGAAGAAAGGCTTCGG
TTGGAGCAGCAAAAGCAGCAGATAATGGCAGCTTTAAACTCCCAGACTGCCGTGCAGTTCCAGCAGTATGCAGCCCAACAGTATCCAGGG
AACTACGAACAGCAGCAAATTCTCATCCGCCAGTTGCAGGAGCAACACTATCAGCAGTACATGCAGCAGTTGTATCAAGTCCAGCTTGCA
CAGCAACAGGCAGCATTACAGAAACAACAGGAAGTAGTAGTGGCTGGGTCTTCCTTGCCTACATCATCAAAAGTGAATGCAACTGTACCA
AGTAATATGATGTCAGTTAATGGACAGGCCAAAACACACACTGACAGCTCCGAAAAAGAACTGGAACCAGAAGCTGCAGAAGAAGCCCTG
GAGAATGGACCAAAAGAATCTCTTCCAGTAATAGCAGCTCCATCCATGTGGACACGACCTCAGATCAAAGACTTCAAAGAGAAGATTCAG
CAGGATGCAGATTCCGTGATTACAGTGGGCCGAGGAGAAGTGGTCACTGTTCGAGTACCCACCCATGAAGAAGGATCATATCTCTTTTGG
GAATTTGCCACAGACAATTATGACATTGGGTTTGGGGTGTATTTTGAATGGACAGACTCTCCAAACACTGCTGTCAGCGTGCATGTCAGT
GAGTCCAGCGATGACGACGAGGAGGAAGAAGAAAACATCGGTTGTGAAGAGAAAGCCAAAAAGAATGCCAACAAGCCTTTGCTGGATGAG
ATTGTGCCTGTGTACCGACGGGACTGTCATGAGGAGGTGTATGCTGGCAGCCATCAATATCCAGGGAGAGGAGTCTATCTCCTCAAGTTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ESRRG_ENST00000361395_chr1_216850418_-_ACBD3_ENST00000366812_chr1_226353701_-_3858nt
AGCTGACAATTTACTGGTTCATCAATGAAACAATATTAAATTATGAAGATGTAAGGAAAAAATCCTACGCTAACACTGTCGCAGTTTGAA
AGCTTTAAAAAGTTGAAGTCTATTGGAAACCTTCTTATAAGAAACCTTCCTAGTCAGAGAATTCAACTTTCTTCTTTTCTTCATTCATGA
AAATGCAGATCCACTGAGAAAGGGAATAAGGCTTCTCTGCAGAATGTCAAACAAAGATCGACACATTGATTCCAGCTGTTCGTCCTTCAT
CAAGACGGAACCTTCCAGCCCAGCCTCCCTGACGGACAGCGTCAACCACCACAGCCCTGGTGGCTCTTCAGACGCCAGTGGGAGCTACAG
TTCAACCATGAATGGCCATCAGAACGGACTTGACTCGCCACCTCTCTACCCTTCTGCTCCTATCCTGGGAGGTAGTGGGCCTGTCAGGAA
ACTGTATGATGACTGCTCCAGCACCATTGTTGAAGATCCCCAGACCAAGTGTGAATACATGCTCAACTCGATGCCCAAGAGACTGTGTTT
AGTGTGTGGTGACATCGCTTCTGGGTACCACTATGGGGTAGCATCATGTGAAGCCTGCAAGGCATTCTTCAAGAGGACAATTCAAGAAAA
AGATGGCAAAGCATTTCATCCAACTTATGAAGAAAAATTGAAGCTTGTGGCACTGCATAAGCAAGTTCTTATGGGCCCATATAATCCAGA
CACTTGTCCTGAGGTTGGATTCTTTGATGTGTTGGGGAATGACAGGAGGAGAGAATGGGCAGCCCTGGGAAACATGTCTAAAGAGGATGC
CATGGTGGAGTTTGTCAAGCTCTTAAATAGGTGTTGCCATCTCTTTTCAACATATGTTGCGTCCCACAAAATAGAGAAGGAAGAGCAAGA
AAAAAAAAGGAAGGAGGAAGAGGAGCGAAGGCGGCGTGAAGAGGAAGAAAGAGAACGTCTGCAAAAGGAGGAAGAGAAACGTAGGAGAGA
AGAAGAGGAAAGGCTTCGACGGGAGGAAGAGGAAAGGAGACGGATAGAAGAAGAAAGGCTTCGGTTGGAGCAGCAAAAGCAGCAGATAAT
GGCAGCTTTAAACTCCCAGACTGCCGTGCAGTTCCAGCAGTATGCAGCCCAACAGTATCCAGGGAACTACGAACAGCAGCAAATTCTCAT
CCGCCAGTTGCAGGAGCAACACTATCAGCAGTACATGCAGCAGTTGTATCAAGTCCAGCTTGCACAGCAACAGGCAGCATTACAGAAACA
ACAGGAAGTAGTAGTGGCTGGGTCTTCCTTGCCTACATCATCAAAAGTGAATGCAACTGTACCAAGTAATATGATGTCAGTTAATGGACA
GGCCAAAACACACACTGACAGCTCCGAAAAAGAACTGGAACCAGAAGCTGCAGAAGAAGCCCTGGAGAATGGACCAAAAGAATCTCTTCC
AGTAATAGCAGCTCCATCCATGTGGACACGACCTCAGATCAAAGACTTCAAAGAGAAGATTCAGCAGGATGCAGATTCCGTGATTACAGT
GGGCCGAGGAGAAGTGGTCACTGTTCGAGTACCCACCCATGAAGAAGGATCATATCTCTTTTGGGAATTTGCCACAGACAATTATGACAT
TGGGTTTGGGGTGTATTTTGAATGGACAGACTCTCCAAACACTGCTGTCAGCGTGCATGTCAGTGAGTCCAGCGATGACGACGAGGAGGA
AGAAGAAAACATCGGTTGTGAAGAGAAAGCCAAAAAGAATGCCAACAAGCCTTTGCTGGATGAGATTGTGCCTGTGTACCGACGGGACTG
TCATGAGGAGGTGTATGCTGGCAGCCATCAATATCCAGGGAGAGGAGTCTATCTCCTCAAGTTTGACAACTCCTACTCTTTGTGGCGGTC
AAAATCAGTCTACTACAGAGTCTATTATACTAGATAAAAATGTTGTTACAAAGTCTGGAGTCTAGGGTTGGGCAGAAGATGACATTTAAT
TTGGAAATTTCTTTTTACTTTTGTGGAGCATTAGAGTCACAGTTTACCTTATTGATATTGGTCTGATGGTTTGTGAACTCTTGCTGGGAA
TCAAAATTTCCTTGAGACTCTTTAGCATTCATACTTTGGGGTTAAAGGAGATTCCTCAGACTCATCCAGCCCTTGGGTGCTGACCAGCAG
AGTCACTAGTGGATGCTGAAGTTACATGAGCTACATGTTAAATATTTAAAGTCTCCAAAATAAAACACCCCAACGTTGACCTTACCCGGC
TGATGGTTAGCCCCTTGCTGCCTGCTCCATGTGTCTTATGAGAGCCCGTAGTTACAGTGTCCTCTAATTTGAAATCCATAAGTTAACAAG
TCTATATCAGGTGCAGCTGGCTTTGATTAAAGGCCATTTTTAAAACTTAAAAACTCAACACCTCACAGATTATAATAGAAAAAGAAATGG
CCTCAGTTTGATCTCGTTCAGAATGACCCAGATTGTTTCTGCTTTGGGTGCAGCTGTTTAGTTCAGAGTTATATTACAGAGAATTATTTT
CTGAGATAATCTTAAACTAGAATGTTCAAAACTAATTGATAATTGAAGTATCAAGATACGTAGAACACCTCAGAGATTTTTCTTCAGGAA
CTTCCACAAACTTTGAATCCTTGTATCTTTATTTGGTATTCATACTACTAGTAGCAAAATACAGGTTTTTTGTTTTGTTTTGTTTTGTTT
TGGCTTCATAGAGTATCTCAAATTGAAACTTTTCTGCACAAAGAATAAAATTAAGGATTTTATAAACTCAAATTGGCACCTACTGAATTA
AAATACATAAAATCATTTAAATATAATTCAGCATATGGGAAGTAACATTGCACTAATATGGAAATCACTGCCAGAGACAGTCTATTTTCT
TTTAATTTGTTACTACTTAGTCACAAACCCCACATTATTCCAGTTTGGAATTACTTATTAAGGAGAATTGGAAATACATATGCCCATGCT
TAAATTTTATAGCTTTAATTTGTGTTATTTCTTTATTGACGGGAAGAGGTACATCTTTTTTTCCTTACTGAAAACAAATATGGATTAATT
GCCTCAAATTTGTATAAGTGATTGGCTAGTGATTCTTGTTTTCAGAAGGGAGAGTGGTATAGATAGAAAATGACAAAGATGGCAATATAC
ACTTAATGTTGTTATTGTATGTTGTTACTGAAGTACTTAGATTTTTAAAATTTCAAATCCTAAATCACTTCTTGTAGGAGGGTTTTCATT
AACTGCAGTATATACAGTTCACTACATATGGGTTGTTTGAGTTTTTTGTGTGCTGTATTTCTTTCTGTTTTTTAATACCTGGTTTTGTAC
ATATCTAACTCTGTTCTCTTTTGGTTGTTCAGAAACTGGATTTTTTTTTTCTTAAGCAGTGCTTAATTTGTGTTTTTTAATTTTGATTCA
GAAGTAGTCCCAGCTCATAGGTGTTCATACTGTTACATCCAGAACATTTGTCAGGCTCTCTGTCAGCTTTCATGTACATATGGTATAGAA
ACCATGGAGTTAGGCACTTCCTGGATTTTTTTTTTATGAGAAAAATACTGTATTTAAAATGTAAAATAAACTTTTAAAAAGCAGGCACTA
ATATATATTTCTTCCAGCCTTTGATTACAAATTTGTCCTTGCACATGTTAAGATGAATTATCTCCTAAAAATATCATTGTTCTTGGGAGC
AGTGTATGTTACTTTACATAGCAGCGGTTCCTGTCATGTGTTCATGTCAGAATATTTTTGGTTTTAAACTTTCTTATTGCCTTTGGCTGT

>In-frame_ESRRG_ENST00000493748_chr1_216850418_-_ACBD3_ENST00000366812_chr1_226353701_-_4250nt
ATTCTGGGCAAAGTGTGGTGACTTGTGGATTTTCACTGTGACGATGTTGCTACACGGTCCTTCACTTGGAGTTAGTGCAACAAGGAGACA
TCTGAGCTTAAAATTTATGAAACATCTAAAGAAATCAAGCTTTATATAGGATCACCGTTGTGGGTTGAATTGTGTATCCCCAAAAGATGT
TGAAGTCCTGACCACCTCCCTATACCTTACAATATAGCCTTTTACGGAAGTAGGGTCTTTGCAGAAGATCAAGTTAAGATGAAATCATTT
GATTGGGCCCTAGTTCAATATATCTTATGTCCTTATAAAAGGAGACAATTTGGACACAGGGACAAGGGGAGAATGCCACATAAAGATTGG
AATTATGCTGCCATAAGCCAAGGAACTCCAAAGATCGCTGGCAAGCTGCTAAAAGCTAGCACAGATTCATGGAACAGAGTCTCCGTCATA
GCCTACAAAAGGAATCAACCCTGCTGACATCTTGATTTCAGACTTCTAGCCTCCAGAACTAGCTGACAATTTACTGGTTCATCAATGAAA
CAATATTAAATTATGAAGATGTAAGGAAAAAATCCTACGCTAACACTGTCGCAGTTTGAAAGGCTTCTCTGCAGAATGTCAAACAAAGAT
CGACACATTGATTCCAGCTGTTCGTCCTTCATCAAGACGGAACCTTCCAGCCCAGCCTCCCTGACGGACAGCGTCAACCACCACAGCCCT
GGTGGCTCTTCAGACGCCAGTGGGAGCTACAGTTCAACCATGAATGGCCATCAGAACGGACTTGACTCGCCACCTCTCTACCCTTCTGCT
CCTATCCTGGGAGGTAGTGGGCCTGTCAGGAAACTGTATGATGACTGCTCCAGCACCATTGTTGAAGATCCCCAGACCAAGTGTGAATAC
ATGCTCAACTCGATGCCCAAGAGACTGTGTTTAGTGTGTGGTGACATCGCTTCTGGGTACCACTATGGGGTAGCATCATGTGAAGCCTGC
AAGGCATTCTTCAAGAGGACAATTCAAGAAAAAGATGGCAAAGCATTTCATCCAACTTATGAAGAAAAATTGAAGCTTGTGGCACTGCAT
AAGCAAGTTCTTATGGGCCCATATAATCCAGACACTTGTCCTGAGGTTGGATTCTTTGATGTGTTGGGGAATGACAGGAGGAGAGAATGG
GCAGCCCTGGGAAACATGTCTAAAGAGGATGCCATGGTGGAGTTTGTCAAGCTCTTAAATAGGTGTTGCCATCTCTTTTCAACATATGTT
GCGTCCCACAAAATAGAGAAGGAAGAGCAAGAAAAAAAAAGGAAGGAGGAAGAGGAGCGAAGGCGGCGTGAAGAGGAAGAAAGAGAACGT
CTGCAAAAGGAGGAAGAGAAACGTAGGAGAGAAGAAGAGGAAAGGCTTCGACGGGAGGAAGAGGAAAGGAGACGGATAGAAGAAGAAAGG
CTTCGGTTGGAGCAGCAAAAGCAGCAGATAATGGCAGCTTTAAACTCCCAGACTGCCGTGCAGTTCCAGCAGTATGCAGCCCAACAGTAT
CCAGGGAACTACGAACAGCAGCAAATTCTCATCCGCCAGTTGCAGGAGCAACACTATCAGCAGTACATGCAGCAGTTGTATCAAGTCCAG
CTTGCACAGCAACAGGCAGCATTACAGAAACAACAGGAAGTAGTAGTGGCTGGGTCTTCCTTGCCTACATCATCAAAAGTGAATGCAACT
GTACCAAGTAATATGATGTCAGTTAATGGACAGGCCAAAACACACACTGACAGCTCCGAAAAAGAACTGGAACCAGAAGCTGCAGAAGAA
GCCCTGGAGAATGGACCAAAAGAATCTCTTCCAGTAATAGCAGCTCCATCCATGTGGACACGACCTCAGATCAAAGACTTCAAAGAGAAG
ATTCAGCAGGATGCAGATTCCGTGATTACAGTGGGCCGAGGAGAAGTGGTCACTGTTCGAGTACCCACCCATGAAGAAGGATCATATCTC
TTTTGGGAATTTGCCACAGACAATTATGACATTGGGTTTGGGGTGTATTTTGAATGGACAGACTCTCCAAACACTGCTGTCAGCGTGCAT
GTCAGTGAGTCCAGCGATGACGACGAGGAGGAAGAAGAAAACATCGGTTGTGAAGAGAAAGCCAAAAAGAATGCCAACAAGCCTTTGCTG
GATGAGATTGTGCCTGTGTACCGACGGGACTGTCATGAGGAGGTGTATGCTGGCAGCCATCAATATCCAGGGAGAGGAGTCTATCTCCTC
AAGTTTGACAACTCCTACTCTTTGTGGCGGTCAAAATCAGTCTACTACAGAGTCTATTATACTAGATAAAAATGTTGTTACAAAGTCTGG
AGTCTAGGGTTGGGCAGAAGATGACATTTAATTTGGAAATTTCTTTTTACTTTTGTGGAGCATTAGAGTCACAGTTTACCTTATTGATAT
TGGTCTGATGGTTTGTGAACTCTTGCTGGGAATCAAAATTTCCTTGAGACTCTTTAGCATTCATACTTTGGGGTTAAAGGAGATTCCTCA
GACTCATCCAGCCCTTGGGTGCTGACCAGCAGAGTCACTAGTGGATGCTGAAGTTACATGAGCTACATGTTAAATATTTAAAGTCTCCAA
AATAAAACACCCCAACGTTGACCTTACCCGGCTGATGGTTAGCCCCTTGCTGCCTGCTCCATGTGTCTTATGAGAGCCCGTAGTTACAGT
GTCCTCTAATTTGAAATCCATAAGTTAACAAGTCTATATCAGGTGCAGCTGGCTTTGATTAAAGGCCATTTTTAAAACTTAAAAACTCAA
CACCTCACAGATTATAATAGAAAAAGAAATGGCCTCAGTTTGATCTCGTTCAGAATGACCCAGATTGTTTCTGCTTTGGGTGCAGCTGTT
TAGTTCAGAGTTATATTACAGAGAATTATTTTCTGAGATAATCTTAAACTAGAATGTTCAAAACTAATTGATAATTGAAGTATCAAGATA
CGTAGAACACCTCAGAGATTTTTCTTCAGGAACTTCCACAAACTTTGAATCCTTGTATCTTTATTTGGTATTCATACTACTAGTAGCAAA
ATACAGGTTTTTTGTTTTGTTTTGTTTTGTTTTGGCTTCATAGAGTATCTCAAATTGAAACTTTTCTGCACAAAGAATAAAATTAAGGAT
TTTATAAACTCAAATTGGCACCTACTGAATTAAAATACATAAAATCATTTAAATATAATTCAGCATATGGGAAGTAACATTGCACTAATA
TGGAAATCACTGCCAGAGACAGTCTATTTTCTTTTAATTTGTTACTACTTAGTCACAAACCCCACATTATTCCAGTTTGGAATTACTTAT
TAAGGAGAATTGGAAATACATATGCCCATGCTTAAATTTTATAGCTTTAATTTGTGTTATTTCTTTATTGACGGGAAGAGGTACATCTTT
TTTTCCTTACTGAAAACAAATATGGATTAATTGCCTCAAATTTGTATAAGTGATTGGCTAGTGATTCTTGTTTTCAGAAGGGAGAGTGGT
ATAGATAGAAAATGACAAAGATGGCAATATACACTTAATGTTGTTATTGTATGTTGTTACTGAAGTACTTAGATTTTTAAAATTTCAAAT
CCTAAATCACTTCTTGTAGGAGGGTTTTCATTAACTGCAGTATATACAGTTCACTACATATGGGTTGTTTGAGTTTTTTGTGTGCTGTAT
TTCTTTCTGTTTTTTAATACCTGGTTTTGTACATATCTAACTCTGTTCTCTTTTGGTTGTTCAGAAACTGGATTTTTTTTTTCTTAAGCA
GTGCTTAATTTGTGTTTTTTAATTTTGATTCAGAAGTAGTCCCAGCTCATAGGTGTTCATACTGTTACATCCAGAACATTTGTCAGGCTC
TCTGTCAGCTTTCATGTACATATGGTATAGAAACCATGGAGTTAGGCACTTCCTGGATTTTTTTTTTATGAGAAAAATACTGTATTTAAA
ATGTAAAATAAACTTTTAAAAAGCAGGCACTAATATATATTTCTTCCAGCCTTTGATTACAAATTTGTCCTTGCACATGTTAAGATGAAT
TATCTCCTAAAAATATCATTGTTCTTGGGAGCAGTGTATGTTACTTTACATAGCAGCGGTTCCTGTCATGTGTTCATGTCAGAATATTTT
TGGTTTTAAACTTTCTTATTGCCTTTGGCTGTTGATTAGTACAGTACAAGTGCGATTTCAAAAAGATCTTGAAAGTAATATATTTAATCA

>In-frame_ESRRG_ENST00000408911_chr1_216850418_-_ACBD3_ENST00000366812_chr1_226353701_-_3858nt
AAGTCCTTGATTAGGAGAGTGTGAGAGCTTTGGTCCCAACTGGCTGTGCCTATAGGCTTGTCACTAGGAGAACATTTGTGTTAATTGCAC
TGTGCTCTGTCAAGGAAACTTTGATTTATAGCTGGGGTGCACAAATAATGGTTGCCGGTCGCACATGGATTCGGTAGAACTTTGCCTTCC
TGAATCTTTTTCCCTGCACTACGAGGAAGAGCTTCTCTGCAGAATGTCAAACAAAGATCGACACATTGATTCCAGCTGTTCGTCCTTCAT
CAAGACGGAACCTTCCAGCCCAGCCTCCCTGACGGACAGCGTCAACCACCACAGCCCTGGTGGCTCTTCAGACGCCAGTGGGAGCTACAG
TTCAACCATGAATGGCCATCAGAACGGACTTGACTCGCCACCTCTCTACCCTTCTGCTCCTATCCTGGGAGGTAGTGGGCCTGTCAGGAA
ACTGTATGATGACTGCTCCAGCACCATTGTTGAAGATCCCCAGACCAAGTGTGAATACATGCTCAACTCGATGCCCAAGAGACTGTGTTT
AGTGTGTGGTGACATCGCTTCTGGGTACCACTATGGGGTAGCATCATGTGAAGCCTGCAAGGCATTCTTCAAGAGGACAATTCAAGAAAA
AGATGGCAAAGCATTTCATCCAACTTATGAAGAAAAATTGAAGCTTGTGGCACTGCATAAGCAAGTTCTTATGGGCCCATATAATCCAGA
CACTTGTCCTGAGGTTGGATTCTTTGATGTGTTGGGGAATGACAGGAGGAGAGAATGGGCAGCCCTGGGAAACATGTCTAAAGAGGATGC
CATGGTGGAGTTTGTCAAGCTCTTAAATAGGTGTTGCCATCTCTTTTCAACATATGTTGCGTCCCACAAAATAGAGAAGGAAGAGCAAGA
AAAAAAAAGGAAGGAGGAAGAGGAGCGAAGGCGGCGTGAAGAGGAAGAAAGAGAACGTCTGCAAAAGGAGGAAGAGAAACGTAGGAGAGA
AGAAGAGGAAAGGCTTCGACGGGAGGAAGAGGAAAGGAGACGGATAGAAGAAGAAAGGCTTCGGTTGGAGCAGCAAAAGCAGCAGATAAT
GGCAGCTTTAAACTCCCAGACTGCCGTGCAGTTCCAGCAGTATGCAGCCCAACAGTATCCAGGGAACTACGAACAGCAGCAAATTCTCAT
CCGCCAGTTGCAGGAGCAACACTATCAGCAGTACATGCAGCAGTTGTATCAAGTCCAGCTTGCACAGCAACAGGCAGCATTACAGAAACA
ACAGGAAGTAGTAGTGGCTGGGTCTTCCTTGCCTACATCATCAAAAGTGAATGCAACTGTACCAAGTAATATGATGTCAGTTAATGGACA
GGCCAAAACACACACTGACAGCTCCGAAAAAGAACTGGAACCAGAAGCTGCAGAAGAAGCCCTGGAGAATGGACCAAAAGAATCTCTTCC
AGTAATAGCAGCTCCATCCATGTGGACACGACCTCAGATCAAAGACTTCAAAGAGAAGATTCAGCAGGATGCAGATTCCGTGATTACAGT
GGGCCGAGGAGAAGTGGTCACTGTTCGAGTACCCACCCATGAAGAAGGATCATATCTCTTTTGGGAATTTGCCACAGACAATTATGACAT
TGGGTTTGGGGTGTATTTTGAATGGACAGACTCTCCAAACACTGCTGTCAGCGTGCATGTCAGTGAGTCCAGCGATGACGACGAGGAGGA
AGAAGAAAACATCGGTTGTGAAGAGAAAGCCAAAAAGAATGCCAACAAGCCTTTGCTGGATGAGATTGTGCCTGTGTACCGACGGGACTG
TCATGAGGAGGTGTATGCTGGCAGCCATCAATATCCAGGGAGAGGAGTCTATCTCCTCAAGTTTGACAACTCCTACTCTTTGTGGCGGTC
AAAATCAGTCTACTACAGAGTCTATTATACTAGATAAAAATGTTGTTACAAAGTCTGGAGTCTAGGGTTGGGCAGAAGATGACATTTAAT
TTGGAAATTTCTTTTTACTTTTGTGGAGCATTAGAGTCACAGTTTACCTTATTGATATTGGTCTGATGGTTTGTGAACTCTTGCTGGGAA
TCAAAATTTCCTTGAGACTCTTTAGCATTCATACTTTGGGGTTAAAGGAGATTCCTCAGACTCATCCAGCCCTTGGGTGCTGACCAGCAG
AGTCACTAGTGGATGCTGAAGTTACATGAGCTACATGTTAAATATTTAAAGTCTCCAAAATAAAACACCCCAACGTTGACCTTACCCGGC
TGATGGTTAGCCCCTTGCTGCCTGCTCCATGTGTCTTATGAGAGCCCGTAGTTACAGTGTCCTCTAATTTGAAATCCATAAGTTAACAAG
TCTATATCAGGTGCAGCTGGCTTTGATTAAAGGCCATTTTTAAAACTTAAAAACTCAACACCTCACAGATTATAATAGAAAAAGAAATGG
CCTCAGTTTGATCTCGTTCAGAATGACCCAGATTGTTTCTGCTTTGGGTGCAGCTGTTTAGTTCAGAGTTATATTACAGAGAATTATTTT
CTGAGATAATCTTAAACTAGAATGTTCAAAACTAATTGATAATTGAAGTATCAAGATACGTAGAACACCTCAGAGATTTTTCTTCAGGAA
CTTCCACAAACTTTGAATCCTTGTATCTTTATTTGGTATTCATACTACTAGTAGCAAAATACAGGTTTTTTGTTTTGTTTTGTTTTGTTT
TGGCTTCATAGAGTATCTCAAATTGAAACTTTTCTGCACAAAGAATAAAATTAAGGATTTTATAAACTCAAATTGGCACCTACTGAATTA
AAATACATAAAATCATTTAAATATAATTCAGCATATGGGAAGTAACATTGCACTAATATGGAAATCACTGCCAGAGACAGTCTATTTTCT
TTTAATTTGTTACTACTTAGTCACAAACCCCACATTATTCCAGTTTGGAATTACTTATTAAGGAGAATTGGAAATACATATGCCCATGCT
TAAATTTTATAGCTTTAATTTGTGTTATTTCTTTATTGACGGGAAGAGGTACATCTTTTTTTCCTTACTGAAAACAAATATGGATTAATT
GCCTCAAATTTGTATAAGTGATTGGCTAGTGATTCTTGTTTTCAGAAGGGAGAGTGGTATAGATAGAAAATGACAAAGATGGCAATATAC
ACTTAATGTTGTTATTGTATGTTGTTACTGAAGTACTTAGATTTTTAAAATTTCAAATCCTAAATCACTTCTTGTAGGAGGGTTTTCATT
AACTGCAGTATATACAGTTCACTACATATGGGTTGTTTGAGTTTTTTGTGTGCTGTATTTCTTTCTGTTTTTTAATACCTGGTTTTGTAC
ATATCTAACTCTGTTCTCTTTTGGTTGTTCAGAAACTGGATTTTTTTTTTCTTAAGCAGTGCTTAATTTGTGTTTTTTAATTTTGATTCA
GAAGTAGTCCCAGCTCATAGGTGTTCATACTGTTACATCCAGAACATTTGTCAGGCTCTCTGTCAGCTTTCATGTACATATGGTATAGAA
ACCATGGAGTTAGGCACTTCCTGGATTTTTTTTTTATGAGAAAAATACTGTATTTAAAATGTAAAATAAACTTTTAAAAAGCAGGCACTA
ATATATATTTCTTCCAGCCTTTGATTACAAATTTGTCCTTGCACATGTTAAGATGAATTATCTCCTAAAAATATCATTGTTCTTGGGAGC
AGTGTATGTTACTTTACATAGCAGCGGTTCCTGTCATGTGTTCATGTCAGAATATTTTTGGTTTTAAACTTTCTTATTGCCTTTGGCTGT


Top

FusionGenePPI for ESRRG_ACBD3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ESRRGESRRG, NCOA1, HGS, ESRRA, NRIP1, SP1, PPARGC1A, NR0B2, PARK2, NR0B1, DUT, PROX1, EBP, PNRC1, PNRC2, ARHGEF15, TLE1, APP, SRA1, SRPK1, KIFC3, MEOX2, NUP160, KIAA1598, CCDC67, SUMO1P1, PSMC5, DNMT3LACBD3GOLGB1, ELAVL1, CUL3, SMURF2, GORASP2, GTF2E1, DUS3L, EFTUD2, HARS, RPUSD2, SARS, SNF8, TBCD, UNC45A, VPS36, WDR12, PPIE, SLC35A1, TBC1D22A, KDM2B, PKN2, SRSF2, NTRK1, NUP35, EVC2, TMEM17, TMEM216, ERRFI1, CDH1, LRFN4, TBC1D22B, DLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ESRRG_ACBD3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneESRRGP62508DB00675TamoxifenEstrogen-related receptor gammasmall moleculeapproved
HgeneESRRGP62508DB02659Cholic AcidEstrogen-related receptor gammasmall moleculeapproved
HgeneESRRGP62508DB00255DiethylstilbestrolEstrogen-related receptor gammasmall moleculeapproved|investigational
HgeneESRRGP62508DB00783EstradiolEstrogen-related receptor gammasmall moleculeapproved|investigational|vet_approved

Top

RelatedDiseases for ESRRG_ACBD3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource